F389794

General Info

Members Datasets Scaffolds Average Seq Length
290 153 289 212

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10009118|Ga0213876_100091183
Length 238
Sequence MTGFFISRPSESFAASFQSQLSKMHESNNSYTKDNFHVLCNQLAKKDAALKAIIDKYGLPPMWSRPAIFQSLILTILEQQVSLASAYAAFKKLKAKIGFVTPKKILALTDAELRACYFSRQKIIYARALATAIVTKQLNLKKLGTLTDNEIRIELKKIKGIGDWTVDVYLMHALQRTDLFPLGDIALVNSLKEVKQLHPKATKEEMLAIAESWRPYRTIASMILWHAYIKKRGIKVLT

Samples

Sample ID Description Type Environment
1 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
126 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
127 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
128 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
129 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
134 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
135 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
136 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
137 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
138 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
139 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
143 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
147 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
153 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0
Isolates 0.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.38
Nodule 0
Rhizoplane 0
Rhizosphere 96.21
Stem 0
Stem Tuber 0
Unclassified 2.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10024406 3300002459 Bacteria 1254
2 rootH1_10200657 3300003323 Bacteria 8741
3 rootH1_10402054 3300003323 Bacteria 1222
4 Ga0065704_10111241 3300005289 Unclassified 1961
5 Ga0065712_10020465 3300005290 Bacteria 1319
6 Ga0065712_10083934 3300005290 Bacteria 2800
7 Ga0065712_10132749 3300005290 Bacteria 1519
8 Ga0065715_10285187 3300005293 Unclassified 1076
9 Ga0065715_10317153 3300005293 Bacteria 1007
10 Ga0065707_10201075 3300005295 Bacteria 1308
11 Ga0070676_10026898 3300005328 Bacteria 3258
12 Ga0070683_100011799 3300005329 Bacteria 7569
13 Ga0070683_100716875 3300005329 Bacteria 958
14 Ga0070690_100213942 3300005330 Bacteria 1347
15 Ga0070690_100674032 3300005330 Bacteria 792
16 Ga0070670_100038326 3300005331 Bacteria 4122
17 Ga0070670_100108872 3300005331 Bacteria 2387
18 Ga0070670_100261657 3300005331 Bacteria 1508
19 Ga0070670_100977058 3300005331 Bacteria 769
20 Ga0068869_100205855 3300005334 Unclassified 1553
21 Ga0070680_100040567 3300005336 Bacteria 3770
22 Ga0068868_100404401 3300005338 Bacteria 1179
23 Ga0070689_100247352 3300005340 Bacteria 1470
24 Ga0070689_100294961 3300005340 Bacteria 1348
25 Ga0070692_10437380 3300005345 Bacteria 834
26 Ga0070668_100544310 3300005347 Unclassified 1010
27 Ga0070669_100030940 3300005353 Bacteria 3864
28 Ga0070669_100048237 3300005353 Bacteria 3108
29 Ga0070669_100363164 3300005353 Unclassified 1178
30 Ga0070669_100640276 3300005353 Unclassified 894
31 Ga0070675_100081285 3300005354 Bacteria 2702
32 Ga0070675_100215798 3300005354 Bacteria 1669
33 Ga0070673_100294754 3300005364 Unclassified 1426
34 Ga0070673_100469081 3300005364 Bacteria 1135
35 Ga0070673_100629834 3300005364 Bacteria 980
36 Ga0070688_100004079 3300005365 Bacteria 7578
37 Ga0070688_100291510 3300005365 Bacteria 1176
38 Ga0070659_100159195 3300005366 Bacteria 1845
39 Ga0070667_100011123 3300005367 Bacteria 7444
40 Ga0070667_100098695 3300005367 Bacteria 2520
41 Ga0070667_100823744 3300005367 Bacteria 862
42 Ga0070701_10724043 3300005438 Bacteria 671
43 Ga0070700_100255309 3300005441 Bacteria 1260
44 Ga0070663_100036139 3300005455 Bacteria 3432
45 Ga0070678_100131546 3300005456 Unclassified 1989
46 Ga0070662_100358833 3300005457 Unclassified 1195
47 Ga0068867_100159882 3300005459 Bacteria 1776
48 Ga0068867_100221456 3300005459 Bacteria 1525
49 Ga0070685_10003838 3300005466 Bacteria 7602
50 Ga0070685_10008491 3300005466 Bacteria 5283
51 Ga0070685_10229249 3300005466 Bacteria 1221
52 Ga0070698_100002783 3300005471 Bacteria 19250
53 Ga0070698_100010172 3300005471 Bacteria 10049
54 Ga0070698_100010416 3300005471 Bacteria 9928
55 Ga0070698_100369181 3300005471 Bacteria 1367
56 Ga0070679_100065170 3300005530 Bacteria 3631
57 Ga0070679_100269912 3300005530 Bacteria 1655
58 Ga0070684_100076700 3300005535 Bacteria 2950
59 Ga0070684_100234528 3300005535 Bacteria 1676
60 Ga0068853_100084111 3300005539 Bacteria 2788
61 Ga0068853_100201432 3300005539 Bacteria 1812
62 Ga0068853_100212902 3300005539 Bacteria 1762
63 Ga0070672_100050673 3300005543 Bacteria 3235
64 Ga0070686_100064405 3300005544 Bacteria 2378
65 Ga0070664_100006035 3300005564 Bacteria 9794
66 Ga0070664_100504205 3300005564 Bacteria 1116
67 Ga0070664_101044132 3300005564 Bacteria 769
68 Ga0068857_100031357 3300005577 Bacteria 4696
69 Ga0068857_100042607 3300005577 Bacteria 4028
70 Ga0068857_100158172 3300005577 Bacteria 2055
71 Ga0068857_100225488 3300005577 Bacteria 1713
72 Ga0068854_100816830 3300005578 Unclassified 814
73 Ga0068852_100163728 3300005616 Bacteria 2079
74 Ga0068852_100367984 3300005616 Unclassified 1408
75 Ga0068852_100438886 3300005616 Bacteria 1290
76 Ga0068852_100734093 3300005616 Unclassified 999
77 Ga0068852_101303131 3300005616 Bacteria 748
78 Ga0068859_100026207 3300005617 Bacteria 5847
79 Ga0068859_100067439 3300005617 Bacteria 3612
80 Ga0068859_100077436 3300005617 Bacteria 3366
81 Ga0068859_100914366 3300005617 Bacteria 962
82 Ga0068864_100011571 3300005618 Bacteria 7285
83 Ga0068864_100028898 3300005618 Bacteria 4692
84 Ga0068864_100045464 3300005618 Bacteria 3766
85 Ga0068864_100458060 3300005618 Bacteria 1221
86 Ga0068861_100006815 3300005719 Bacteria 7802
87 Ga0068861_100079777 3300005719 Unclassified 2559
88 Ga0068861_100602557 3300005719 Bacteria 1008
89 Ga0068851_10194318 3300005834 Bacteria 1130
90 Ga0068870_10161133 3300005840 Unclassified 1330
91 Ga0068863_100014565 3300005841 Bacteria 7570
92 Ga0068863_100017654 3300005841 Bacteria 6833
93 Ga0068863_100167445 3300005841 Bacteria 2107
94 Ga0068863_100219975 3300005841 Bacteria 1829
95 Ga0068858_100069455 3300005842 Bacteria 3266
96 Ga0068860_100099699 3300005843 Bacteria 2770
97 Ga0068862_100015255 3300005844 Bacteria 6381
98 Ga0068862_100299016 3300005844 Bacteria 1480
99 Ga0068862_100395088 3300005844 Unclassified 1292
100 Ga0068862_100747394 3300005844 Bacteria 951
101 Ga0068862_101257843 3300005844 Unclassified 740
102 Ga0070715_10246218 3300006163 Unclassified 932
103 Ga0075366_10017390 3300006195 Bacteria 4138
104 Ga0097621_100042194 3300006237 Bacteria 3674
105 Ga0068871_100034981 3300006358 Bacteria 3989
106 Ga0075428_100725621 3300006844 Unclassified 1058
107 Ga0075428_100757935 3300006844 Bacteria 1033
108 Ga0075428_101439336 3300006844 Unclassified 723
109 Ga0075430_100018743 3300006846 Bacteria 5889
110 Ga0075431_100309249 3300006847 Unclassified 1595
111 Ga0075429_100007833 3300006880 Bacteria 9278
112 Ga0068865_100039115 3300006881 Bacteria 3215
113 Ga0097620_100026206 3300006931 Bacteria 5847
114 Ga0097620_100067442 3300006931 Bacteria 3612
115 Ga0097620_100077435 3300006931 Bacteria 3366
116 Ga0097620_100914503 3300006931 Bacteria 962
117 Ga0111539_10078829 3300009094 Bacteria 3874
118 Ga0111539_10129635 3300009094 Bacteria 2953
119 Ga0111539_10376909 3300009094 Bacteria 1652
120 Ga0111539_10918575 3300009094 Bacteria 1018
121 Ga0105247_10001441 3300009101 Bacteria 17229
122 Ga0114129_10083808 3300009147 Bacteria 4426
123 Ga0105242_10007012 3300009176 Bacteria 8700
124 Ga0105242_10040956 3300009176 Bacteria 3734
125 Ga0105242_10409259 3300009176 Bacteria 1268
126 Ga0105242_10572719 3300009176 Bacteria 1086
127 Ga0105242_11320267 3300009176 Bacteria 746
128 Ga0105242_11493969 3300009176 Bacteria 706
129 Ga0105237_10099799 3300009545 Bacteria 2894
130 Ga0105249_10015813 3300009553 Bacteria 6686
131 Ga0105249_10022815 3300009553 Bacteria 5611
132 Ga0105249_10135075 3300009553 Unclassified 2359
133 Ga0105249_10327892 3300009553 Bacteria 1544
134 Ga0105249_10328277 3300009553 Bacteria 1543
135 Ga0105249_10403295 3300009553 Bacteria 1398
136 Ga0105249_11176267 3300009553 Bacteria 838
137 Ga0105249_11659240 3300009553 Unclassified 712
138 Ga0105246_10171152 3300011119 Bacteria 1664
139 Ga0157371_10024202 3300013102 Bacteria 4436
140 Ga0157370_10005549 3300013104 Bacteria 14145
141 Ga0157370_10607387 3300013104 Bacteria 1001
142 Ga0157369_10063024 3300013105 Bacteria 3995
143 Ga0157369_10090429 3300013105 Bacteria 3268
144 Ga0157369_10537859 3300013105 Unclassified 1208
145 Ga0157374_10050379 3300013296 Bacteria 3870
146 Ga0157374_10070149 3300013296 Bacteria 3301
147 Ga0157378_10016875 3300013297 Bacteria 6399
148 Ga0157378_10108130 3300013297 Unclassified 2546
149 Ga0157378_10559701 3300013297 Unclassified 1150
150 Ga0163162_10107310 3300013306 Bacteria 2888
151 Ga0163162_10151780 3300013306 Bacteria 2435
152 Ga0157372_10063438 3300013307 Bacteria 4143
153 Ga0157372_10266979 3300013307 Bacteria 1988
154 Ga0157372_10585971 3300013307 Bacteria 1300
155 Ga0157372_10706813 3300013307 Bacteria 1173
156 Ga0157372_10729633 3300013307 Bacteria 1152
157 Ga0157372_10954640 3300013307 Bacteria 994
158 Ga0157375_10095874 3300013308 Bacteria 3038
159 Ga0157375_10127069 3300013308 Bacteria 2666
160 Ga0157375_10279785 3300013308 Bacteria 1832
161 Ga0157375_11317219 3300013308 Unclassified 849
162 Ga0163163_10060937 3300014325 Bacteria 3738
163 Ga0163163_10195332 3300014325 Bacteria 2071
164 Ga0163163_10208067 3300014325 Bacteria 2005
165 Ga0163163_10208290 3300014325 Unclassified 2004
166 Ga0163163_10522510 3300014325 Bacteria 1249
167 Ga0157380_10006312 3300014326 Bacteria 8330
168 Ga0157380_10014572 3300014326 Bacteria 5755
169 Ga0157380_10244781 3300014326 Bacteria 1619
170 Ga0157379_10073255 3300014968 Bacteria 3065
171 Ga0157376_10141784 3300014969 Bacteria 2157
172 Ga0163161_10056126 3300017792 Bacteria 2860
173 Ga0213876_10009118 3300021384 Bacteria 5341
174 Ga0207697_10025602 3300025315 Unclassified 2411
175 Ga0207697_10142640 3300025315 Unclassified 1040
176 Ga0207656_10109969 3300025321 Bacteria 1272
177 Ga0207710_10000326 3300025900 Bacteria 36470
178 Ga0207647_10003273 3300025904 Bacteria 12167
179 Ga0207685_10120629 3300025905 Bacteria 1150
180 Ga0207645_10479008 3300025907 Unclassified 842
181 Ga0207643_10026040 3300025908 Bacteria 3236
182 Ga0207705_10287674 3300025909 Bacteria 1259
183 Ga0207671_10075778 3300025914 Bacteria 2516
184 Ga0207660_10665662 3300025917 Bacteria 849
185 Ga0207662_10043507 3300025918 Bacteria 2649
186 Ga0207662_10112057 3300025918 Bacteria 1702
187 Ga0207662_10584811 3300025918 Unclassified 776
188 Ga0207652_10019095 3300025921 Bacteria 5632
189 Ga0207652_10233993 3300025921 Bacteria 1656
190 Ga0207646_10470458 3300025922 Unclassified 1133
191 Ga0207681_10353734 3300025923 Unclassified 1176
192 Ga0207681_10372222 3300025923 Bacteria 1148
193 Ga0207681_10388018 3300025923 Unclassified 1125
194 Ga0207650_10046818 3300025925 Bacteria 3185
195 Ga0207650_10220011 3300025925 Bacteria 1528
196 Ga0207650_10340414 3300025925 Bacteria 1232
197 Ga0207650_10560210 3300025925 Bacteria 959
198 Ga0207659_10104651 3300025926 Unclassified 2140
199 Ga0207644_10400669 3300025931 Bacteria 1122
200 Ga0207690_10033567 3300025932 Bacteria 3300
201 Ga0207686_10002599 3300025934 Bacteria 9795
202 Ga0207686_10090247 3300025934 Bacteria 2021
203 Ga0207686_10195797 3300025934 Unclassified 1444
204 Ga0207670_10034138 3300025936 Bacteria 3284
205 Ga0207670_10160957 3300025936 Bacteria 1675
206 Ga0207691_10023513 3300025940 Bacteria 5803
207 Ga0207691_10077243 3300025940 Bacteria 3000
208 Ga0207689_10196877 3300025942 Unclassified 1663
209 Ga0207689_10446124 3300025942 Bacteria 1081
210 Ga0207679_10406614 3300025945 Bacteria 1198
211 Ga0207651_10282074 3300025960 Bacteria 1373
212 Ga0207651_10414734 3300025960 Bacteria 1148
213 Ga0207651_10441380 3300025960 Unclassified 1115
214 Ga0207712_10004285 3300025961 Bacteria 9002
215 Ga0207712_10006820 3300025961 Bacteria 7206
216 Ga0207712_10060814 3300025961 Unclassified 2679
217 Ga0207712_10104783 3300025961 Bacteria 2110
218 Ga0207668_10288128 3300025972 Unclassified 1350
219 Ga0207640_10605379 3300025981 Bacteria 928
220 Ga0207658_10020814 3300025986 Bacteria 4544
221 Ga0207658_10071297 3300025986 Bacteria 2631
222 Ga0207658_10607924 3300025986 Bacteria 983
223 Ga0207703_10019247 3300026035 Bacteria 5332
224 Ga0207639_10023235 3300026041 Bacteria 4476
225 Ga0207678_10091710 3300026067 Bacteria 2597
226 Ga0207678_10227163 3300026067 Bacteria 1598
227 Ga0207708_10360996 3300026075 Unclassified 1194
228 Ga0207641_10001198 3300026088 Bacteria 25980
229 Ga0207641_10074101 3300026088 Bacteria 2935
230 Ga0207641_10210178 3300026088 Bacteria 1799
231 Ga0207641_10254123 3300026088 Bacteria 1642
232 Ga0207648_10034587 3300026089 Bacteria 4453
233 Ga0207648_10876899 3300026089 Bacteria 837
234 Ga0207676_10008331 3300026095 Bacteria 7369
235 Ga0207676_10016005 3300026095 Bacteria 5427
236 Ga0207676_10059421 3300026095 Bacteria 3019
237 Ga0207674_10011558 3300026116 Bacteria 9916
238 Ga0207674_10052457 3300026116 Bacteria 4159
239 Ga0207674_10131704 3300026116 Unclassified 2463
240 Ga0207674_10312051 3300026116 Bacteria 1522
241 Ga0207674_10566545 3300026116 Bacteria 1097
242 Ga0207674_10587069 3300026116 Bacteria 1076
243 Ga0207675_100000971 3300026118 Bacteria 28493
244 Ga0207675_100005986 3300026118 Bacteria 11578
245 Ga0207675_100961906 3300026118 Bacteria 871
246 Ga0207698_10235739 3300026142 Bacteria 1664
247 Ga0207698_10548968 3300026142 Bacteria 1132
248 Ga0207428_10222012 3300027907 Unclassified 1416
249 Ga0268265_10682148 3300028380 Bacteria 991
250 Ga0268265_11394825 3300028380 Bacteria 703
251 Ga0307410_10673299 3300031852 Unclassified 870
252 Ga0307407_10491925 3300031903 Unclassified 898
253 Ga0373937_1109135 3300036401 Unclassified 740
254 Ga0436365_0096822 3300039437 Bacteria 1142
255 Ga0436365_0181465 3300039437 Bacteria 30838
256 Ga0436365_0944366 3300039437 Bacteria 2917
257 Ga0439441_002825 3300042001 Bacteria 2486
258 Ga0439443_037078 3300042003 Unclassified 822
259 Ga0439457_071935 3300042014 Bacteria 789
260 Ga0453684_0088550 3300044712 Bacteria 3833
261 Ga0453684_0204002 3300044712 Bacteria 2303
262 Ga0466959_0112676 3300045049 Bacteria 1940
263 Ga0451576_0197771 3300045051 Bacteria 2100
264 Ga0495629_0210210 3300046459 Bacteria 1344
265 Ga0495580_0408194 3300046472 Bacteria 915
266 Ga0495662_0219699 3300046476 Unclassified 937
267 Ga0495630_0179308 3300046517 Unclassified 1615
268 Ga0495598_0037005 3300046537 Bacteria 1406
269 Ga0495621_0047946 3300046539 Bacteria 1520
270 Ga0495667_0169516 3300046559 Unclassified 1403
271 Ga0495657_0460083 3300046675 Bacteria 744
272 Ga0495658_0046739 3300046683 Bacteria 2435
273 Ga0495600_0156570 3300046809 Unclassified 1474
274 Ga0495674_0070845 3300047319 Bacteria 3012
275 Ga0495674_0213417 3300047319 Bacteria 1598
276 Ga0495672_0020228 3300047320 Bacteria 4367
277 Ga0495686_0016060 3300047472 Bacteria 5088
278 Ga0495686_0308639 3300047472 Bacteria 871
279 Ga0495602_0288804 3300048088 Unclassified 1205
280 Ga0501037_0088581 3300049573 Bacteria 2240
281 Ga0501044_0230406 3300049823 Bacteria 1800
282 nmdc:mga0k408_11492_c1 3300050493 Bacteria 4824
283 nmdc:mga0k408_56786_c1 3300050493 Bacteria 2272
284 nmdc:mga05p37_35535_c1 3300050507 Bacteria 3495
285 nmdc:mga09592_4183_c1 3300050508 Bacteria 11657
286 nmdc:mga06r32_365488_c1 3300050510 Unclassified 1426
287 nmdc:mga08y16_888628_c1 3300050511 Unclassified 878
288 Ga0495619_0096254 3300053085 Unclassified 2010
289 Ga0500611_000001 3300053727 Bacteria 385744

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046675 Ga0495657_0460083 Ga0495657_0460083_32_586 175
2 3300005364 Ga0070673_100629834 Ga0070673_1006298341 195
3 3300005564 Ga0070664_101044132 Ga0070664_1010441321 195
4 3300025945 Ga0207679_10406614 Ga0207679_104066142 195
5 3300013296 Ga0157374_10070149 Ga0157374_100701494 198
6 3300005289 Ga0065704_10111241 Ga0065704_101112413 199
7 3300005293 Ga0065715_10285187 Ga0065715_102851872 199
8 3300005328 Ga0070676_10026898 Ga0070676_100268981 199
9 3300005331 Ga0070670_100038326 Ga0070670_1000383262 199
10 3300005345 Ga0070692_10437380 Ga0070692_104373801 199
11 3300005347 Ga0070668_100544310 Ga0070668_1005443101 199
12 3300005353 Ga0070669_100048237 Ga0070669_1000482371 199
13 3300005354 Ga0070675_100081285 Ga0070675_1000812853 199
14 3300005364 Ga0070673_100469081 Ga0070673_1004690812 199
15 3300005441 Ga0070700_100255309 Ga0070700_1002553091 199
16 3300005457 Ga0070662_100358833 Ga0070662_1003588331 199
17 3300005543 Ga0070672_100050673 Ga0070672_1000506733 199
18 3300005577 Ga0068857_100031357 Ga0068857_1000313575 199
19 3300005578 Ga0068854_100816830 Ga0068854_1008168301 199
20 3300005617 Ga0068859_100067439 Ga0068859_1000674392 199
21 3300005719 Ga0068861_100079777 Ga0068861_1000797773 199
22 3300005844 Ga0068862_100015255 Ga0068862_1000152552 199
23 3300006844 Ga0075428_101439336 Ga0075428_1014393361 199
24 3300006931 Ga0097620_100067442 Ga0097620_1000674423 199
25 3300009094 Ga0111539_10078829 Ga0111539_100788292 199
26 3300009553 Ga0105249_10135075 Ga0105249_101350753 199
27 3300013306 Ga0163162_10107310 Ga0163162_101073103 199
28 3300013308 Ga0157375_10127069 Ga0157375_101270693 199
29 3300014326 Ga0157380_10014572 Ga0157380_100145727 199
30 3300025315 Ga0207697_10025602 Ga0207697_100256021 199
31 3300025907 Ga0207645_10479008 Ga0207645_104790082 199
32 3300025908 Ga0207643_10026040 Ga0207643_100260401 199
33 3300025918 Ga0207662_10584811 Ga0207662_105848111 199
34 3300025925 Ga0207650_10046818 Ga0207650_100468182 199
35 3300025926 Ga0207659_10104651 Ga0207659_101046511 199
36 3300025940 Ga0207691_10077243 Ga0207691_100772431 199
37 3300025960 Ga0207651_10414734 Ga0207651_104147342 199
38 3300025961 Ga0207712_10060814 Ga0207712_100608143 199
39 3300026075 Ga0207708_10360996 Ga0207708_103609961 199
40 3300026116 Ga0207674_10011558 Ga0207674_1001155811 199
41 3300026118 Ga0207675_100005986 Ga0207675_1000059861 199
42 3300013105 Ga0157369_10063024 Ga0157369_100630244 205
43 iso_pu_bacteria 2977232053 2977235228 205
44 3300003323 rootH1_10200657 rootH1_102006575 207
45 3300025315 Ga0207697_10142640 Ga0207697_101426402 207
46 3300005367 Ga0070667_100098695 Ga0070667_1000986951 209
47 3300013307 Ga0157372_10954640 Ga0157372_109546402 209
48 3300025986 Ga0207658_10071297 Ga0207658_100712971 209
49 3300031852 Ga0307410_10673299 Ga0307410_106732991 209
50 3300031903 Ga0307407_10491925 Ga0307407_104919251 209
51 3300039437 Ga0436365_0944366 Ga0436365_0944366_1627_2256 209
52 3300005329 Ga0070683_100011799 Ga0070683_1000117993 210
53 3300005331 Ga0070670_100108872 Ga0070670_1001088724 210
54 3300005331 Ga0070670_100977058 Ga0070670_1009770581 210
55 3300005336 Ga0070680_100040567 Ga0070680_1000405676 210
56 3300005338 Ga0068868_100404401 Ga0068868_1004044011 210
57 3300005366 Ga0070659_100159195 Ga0070659_1001591952 210
58 3300005367 Ga0070667_100011123 Ga0070667_1000111237 210
59 3300005530 Ga0070679_100065170 Ga0070679_1000651704 210
60 3300005530 Ga0070679_100269912 Ga0070679_1002699121 210
61 3300005535 Ga0070684_100076700 Ga0070684_1000767002 210
62 3300005539 Ga0068853_100201432 Ga0068853_1002014322 210
63 3300005539 Ga0068853_100212902 Ga0068853_1002129022 210
64 3300005564 Ga0070664_100006035 Ga0070664_10000603511 210
65 3300005616 Ga0068852_100367984 Ga0068852_1003679842 210
66 3300005617 Ga0068859_100026207 Ga0068859_1000262074 210
67 3300005834 Ga0068851_10194318 Ga0068851_101943182 210
68 3300006931 Ga0097620_100026206 Ga0097620_1000262064 210
69 3300009176 Ga0105242_11493969 Ga0105242_114939691 210
70 3300009545 Ga0105237_10099799 Ga0105237_100997992 210
71 3300013102 Ga0157371_10024202 Ga0157371_100242023 210
72 3300013104 Ga0157370_10607387 Ga0157370_106073871 210
73 3300013105 Ga0157369_10537859 Ga0157369_105378592 210
74 3300013297 Ga0157378_10016875 Ga0157378_100168753 210
75 3300013297 Ga0157378_10108130 Ga0157378_101081302 210
76 3300013307 Ga0157372_10266979 Ga0157372_102669792 210
77 3300013308 Ga0157375_10279785 Ga0157375_102797852 210
78 3300014325 Ga0163163_10060937 Ga0163163_100609372 210
79 3300025904 Ga0207647_10003273 Ga0207647_100032733 210
80 3300025914 Ga0207671_10075778 Ga0207671_100757782 210
81 3300025917 Ga0207660_10665662 Ga0207660_106656621 210
82 3300025921 Ga0207652_10019095 Ga0207652_100190954 210
83 3300025921 Ga0207652_10233993 Ga0207652_102339933 210
84 3300025925 Ga0207650_10560210 Ga0207650_105602101 210
85 3300025932 Ga0207690_10033567 Ga0207690_100335672 210
86 3300025986 Ga0207658_10020814 Ga0207658_100208147 210
87 3300026116 Ga0207674_10052457 Ga0207674_100524572 210
88 3300026142 Ga0207698_10548968 Ga0207698_105489682 210
89 3300036401 Ga0373937_1109135 Ga0373937_1109135_45_713 210
90 3300042014 Ga0439457_071935 Ga0439457_071935_91_732 210
91 3300044712 Ga0453684_0088550 Ga0453684_0088550_271_903 210
92 3300045049 Ga0466959_0112676 Ga0466959_0112676_735_1370 210
93 3300045051 Ga0451576_0197771 Ga0451576_0197771_417_1049 210
94 3300046459 Ga0495629_0210210 Ga0495629_0210210_91_759 210
95 3300046472 Ga0495580_0408194 Ga0495580_0408194_54_722 210
96 3300046476 Ga0495662_0219699 Ga0495662_0219699_177_845 210
97 3300046517 Ga0495630_0179308 Ga0495630_0179308_193_861 210
98 3300046559 Ga0495667_0169516 Ga0495667_0169516_503_1171 210
99 3300046683 Ga0495658_0046739 Ga0495658_0046739_766_1434 210
100 3300046809 Ga0495600_0156570 Ga0495600_0156570_767_1435 210
101 3300047319 Ga0495674_0070845 Ga0495674_0070845_2201_2869 210
102 3300047320 Ga0495672_0020228 Ga0495672_0020228_1539_2171 210
103 3300048088 Ga0495602_0288804 Ga0495602_0288804_241_909 210
104 3300053085 Ga0495619_0096254 Ga0495619_0096254_1281_1949 210
105 3300005334 Ga0068869_100205855 Ga0068869_1002058552 211
106 3300005367 Ga0070667_100823744 Ga0070667_1008237441 211
107 3300005459 Ga0068867_100221456 Ga0068867_1002214561 211
108 3300009147 Ga0114129_10083808 Ga0114129_100838085 211
109 3300011119 Ga0105246_10171152 Ga0105246_101711522 211
110 3300013307 Ga0157372_10585971 Ga0157372_105859712 211
111 3300025942 Ga0207689_10196877 Ga0207689_101968772 211
112 3300026067 Ga0207678_10227163 Ga0207678_102271632 211
113 3300047472 Ga0495686_0308639 Ga0495686_0308639_60_695 211
114 3300050507 nmdc:mga05p37_35535_c1 nmdc:mga05p37_35535_c1_2835_3470 211
115 3300002459 JGI24751J29686_10024406 JGI24751J29686_100244062 212
116 3300003323 rootH1_10402054 rootH1_104020542 212
117 3300005290 Ga0065712_10020465 Ga0065712_100204652 212
118 3300005290 Ga0065712_10083934 Ga0065712_100839342 212
119 3300005290 Ga0065712_10132749 Ga0065712_101327491 212
120 3300005293 Ga0065715_10317153 Ga0065715_103171531 212
121 3300005295 Ga0065707_10201075 Ga0065707_102010752 212
122 3300005329 Ga0070683_100716875 Ga0070683_1007168751 212
123 3300005330 Ga0070690_100213942 Ga0070690_1002139422 212
124 3300005330 Ga0070690_100674032 Ga0070690_1006740321 212
125 3300005331 Ga0070670_100261657 Ga0070670_1002616572 212
126 3300005340 Ga0070689_100247352 Ga0070689_1002473522 212
127 3300005340 Ga0070689_100294961 Ga0070689_1002949612 212
128 3300005353 Ga0070669_100030940 Ga0070669_1000309403 212
129 3300005353 Ga0070669_100363164 Ga0070669_1003631642 212
130 3300005353 Ga0070669_100640276 Ga0070669_1006402762 212
131 3300005354 Ga0070675_100215798 Ga0070675_1002157982 212
132 3300005364 Ga0070673_100294754 Ga0070673_1002947542 212
133 3300005365 Ga0070688_100004079 Ga0070688_1000040796 212
134 3300005365 Ga0070688_100291510 Ga0070688_1002915101 212
135 3300005438 Ga0070701_10724043 Ga0070701_107240431 212
136 3300005455 Ga0070663_100036139 Ga0070663_1000361394 212
137 3300005456 Ga0070678_100131546 Ga0070678_1001315462 212
138 3300005459 Ga0068867_100159882 Ga0068867_1001598822 212
139 3300005466 Ga0070685_10003838 Ga0070685_100038386 212
140 3300005466 Ga0070685_10008491 Ga0070685_100084915 212
141 3300005466 Ga0070685_10229249 Ga0070685_102292492 212
142 3300005471 Ga0070698_100002783 Ga0070698_1000027839 212
143 3300005471 Ga0070698_100010172 Ga0070698_1000101723 212
144 3300005471 Ga0070698_100010416 Ga0070698_1000104164 212
145 3300005471 Ga0070698_100369181 Ga0070698_1003691812 212
146 3300005535 Ga0070684_100234528 Ga0070684_1002345282 212
147 3300005539 Ga0068853_100084111 Ga0068853_1000841112 212
148 3300005544 Ga0070686_100064405 Ga0070686_1000644052 212
149 3300005564 Ga0070664_100504205 Ga0070664_1005042052 212
150 3300005577 Ga0068857_100042607 Ga0068857_1000426072 212
151 3300005577 Ga0068857_100158172 Ga0068857_1001581722 212
152 3300005577 Ga0068857_100225488 Ga0068857_1002254882 212
153 3300005616 Ga0068852_100163728 Ga0068852_1001637283 212
154 3300005616 Ga0068852_100438886 Ga0068852_1004388862 212
155 3300005616 Ga0068852_100734093 Ga0068852_1007340931 212
156 3300005616 Ga0068852_101303131 Ga0068852_1013031312 212
157 3300005617 Ga0068859_100077436 Ga0068859_1000774361 212
158 3300005617 Ga0068859_100914366 Ga0068859_1009143662 212
159 3300005618 Ga0068864_100011571 Ga0068864_1000115716 212
160 3300005618 Ga0068864_100028898 Ga0068864_1000288983 212
161 3300005618 Ga0068864_100045464 Ga0068864_1000454643 212
162 3300005618 Ga0068864_100458060 Ga0068864_1004580601 212
163 3300005719 Ga0068861_100006815 Ga0068861_1000068152 212
164 3300005719 Ga0068861_100602557 Ga0068861_1006025571 212
165 3300005840 Ga0068870_10161133 Ga0068870_101611332 212
166 3300005841 Ga0068863_100014565 Ga0068863_1000145653 212
167 3300005841 Ga0068863_100017654 Ga0068863_10001765410 212
168 3300005841 Ga0068863_100167445 Ga0068863_1001674452 212
169 3300005841 Ga0068863_100219975 Ga0068863_1002199752 212
170 3300005842 Ga0068858_100069455 Ga0068858_1000694553 212
171 3300005843 Ga0068860_100099699 Ga0068860_1000996992 212
172 3300005844 Ga0068862_100299016 Ga0068862_1002990161 212
173 3300005844 Ga0068862_100395088 Ga0068862_1003950882 212
174 3300005844 Ga0068862_100747394 Ga0068862_1007473942 212
175 3300005844 Ga0068862_101257843 Ga0068862_1012578431 212
176 3300006163 Ga0070715_10246218 Ga0070715_102462182 212
177 3300006195 Ga0075366_10017390 Ga0075366_100173904 212
178 3300006237 Ga0097621_100042194 Ga0097621_1000421942 212
179 3300006358 Ga0068871_100034981 Ga0068871_1000349815 212
180 3300006844 Ga0075428_100725621 Ga0075428_1007256212 212
181 3300006844 Ga0075428_100757935 Ga0075428_1007579352 212
182 3300006846 Ga0075430_100018743 Ga0075430_1000187437 212
183 3300006847 Ga0075431_100309249 Ga0075431_1003092492 212
184 3300006880 Ga0075429_100007833 Ga0075429_1000078337 212
185 3300006881 Ga0068865_100039115 Ga0068865_1000391153 212
186 3300006931 Ga0097620_100077435 Ga0097620_1000774351 212
187 3300006931 Ga0097620_100914503 Ga0097620_1009145032 212
188 3300009094 Ga0111539_10129635 Ga0111539_101296352 212
189 3300009094 Ga0111539_10376909 Ga0111539_103769092 212
190 3300009094 Ga0111539_10918575 Ga0111539_109185751 212
191 3300009101 Ga0105247_10001441 Ga0105247_100014412 212
192 3300009176 Ga0105242_10007012 Ga0105242_100070124 212
193 3300009176 Ga0105242_10040956 Ga0105242_100409564 212
194 3300009176 Ga0105242_10409259 Ga0105242_104092592 212
195 3300009176 Ga0105242_10572719 Ga0105242_105727192 212
196 3300009176 Ga0105242_11320267 Ga0105242_113202671 212
197 3300009553 Ga0105249_10015813 Ga0105249_100158137 212
198 3300009553 Ga0105249_10022815 Ga0105249_100228153 212
199 3300009553 Ga0105249_10327892 Ga0105249_103278922 212
200 3300009553 Ga0105249_10328277 Ga0105249_103282771 212
201 3300009553 Ga0105249_10403295 Ga0105249_104032952 212
202 3300009553 Ga0105249_11176267 Ga0105249_111762671 212
203 3300009553 Ga0105249_11659240 Ga0105249_116592401 212
204 3300013104 Ga0157370_10005549 Ga0157370_1000554911 212
205 3300013105 Ga0157369_10090429 Ga0157369_100904293 212
206 3300013296 Ga0157374_10050379 Ga0157374_100503792 212
207 3300013297 Ga0157378_10559701 Ga0157378_105597011 212
208 3300013306 Ga0163162_10151780 Ga0163162_101517802 212
209 3300013307 Ga0157372_10063438 Ga0157372_100634382 212
210 3300013307 Ga0157372_10706813 Ga0157372_107068131 212
211 3300013307 Ga0157372_10729633 Ga0157372_107296332 212
212 3300013308 Ga0157375_10095874 Ga0157375_100958742 212
213 3300013308 Ga0157375_11317219 Ga0157375_113172191 212
214 3300014325 Ga0163163_10195332 Ga0163163_101953323 212
215 3300014325 Ga0163163_10208067 Ga0163163_102080672 212
216 3300014325 Ga0163163_10208290 Ga0163163_102082903 212
217 3300014325 Ga0163163_10522510 Ga0163163_105225101 212
218 3300014326 Ga0157380_10006312 Ga0157380_100063125 212
219 3300014326 Ga0157380_10244781 Ga0157380_102447812 212
220 3300014968 Ga0157379_10073255 Ga0157379_100732552 212
221 3300014969 Ga0157376_10141784 Ga0157376_101417843 212
222 3300017792 Ga0163161_10056126 Ga0163161_100561263 212
223 3300021384 Ga0213876_10009118 Ga0213876_100091183 212
224 3300025321 Ga0207656_10109969 Ga0207656_101099691 212
225 3300025900 Ga0207710_10000326 Ga0207710_1000032611 212
226 3300025905 Ga0207685_10120629 Ga0207685_101206292 212
227 3300025909 Ga0207705_10287674 Ga0207705_102876741 212
228 3300025918 Ga0207662_10043507 Ga0207662_100435072 212
229 3300025918 Ga0207662_10112057 Ga0207662_101120572 212
230 3300025922 Ga0207646_10470458 Ga0207646_104704582 212
231 3300025923 Ga0207681_10353734 Ga0207681_103537342 212
232 3300025923 Ga0207681_10372222 Ga0207681_103722222 212
233 3300025923 Ga0207681_10388018 Ga0207681_103880182 212
234 3300025925 Ga0207650_10220011 Ga0207650_102200112 212
235 3300025925 Ga0207650_10340414 Ga0207650_103404142 212
236 3300025931 Ga0207644_10400669 Ga0207644_104006692 212
237 3300025934 Ga0207686_10002599 Ga0207686_100025998 212
238 3300025934 Ga0207686_10090247 Ga0207686_100902473 212
239 3300025934 Ga0207686_10195797 Ga0207686_101957972 212
240 3300025936 Ga0207670_10034138 Ga0207670_100341382 212
241 3300025936 Ga0207670_10160957 Ga0207670_101609572 212
242 3300025940 Ga0207691_10023513 Ga0207691_100235133 212
243 3300025942 Ga0207689_10446124 Ga0207689_104461242 212
244 3300025960 Ga0207651_10282074 Ga0207651_102820742 212
245 3300025960 Ga0207651_10441380 Ga0207651_104413802 212
246 3300025961 Ga0207712_10004285 Ga0207712_100042856 212
247 3300025961 Ga0207712_10006820 Ga0207712_100068205 212
248 3300025961 Ga0207712_10104783 Ga0207712_101047832 212
249 3300025972 Ga0207668_10288128 Ga0207668_102881282 212
250 3300025981 Ga0207640_10605379 Ga0207640_106053791 212
251 3300025986 Ga0207658_10607924 Ga0207658_106079241 212
252 3300026035 Ga0207703_10019247 Ga0207703_100192472 212
253 3300026041 Ga0207639_10023235 Ga0207639_100232355 212
254 3300026067 Ga0207678_10091710 Ga0207678_100917103 212
255 3300026088 Ga0207641_10001198 Ga0207641_100011986 212
256 3300026088 Ga0207641_10074101 Ga0207641_100741012 212
257 3300026088 Ga0207641_10210178 Ga0207641_102101781 212
258 3300026088 Ga0207641_10254123 Ga0207641_102541232 212
259 3300026089 Ga0207648_10034587 Ga0207648_100345872 212
260 3300026089 Ga0207648_10876899 Ga0207648_108768992 212
261 3300026095 Ga0207676_10008331 Ga0207676_100083318 212
262 3300026095 Ga0207676_10016005 Ga0207676_100160053 212
263 3300026095 Ga0207676_10059421 Ga0207676_100594212 212
264 3300026116 Ga0207674_10131704 Ga0207674_101317043 212
265 3300026116 Ga0207674_10312051 Ga0207674_103120512 212
266 3300026116 Ga0207674_10566545 Ga0207674_105665452 212
267 3300026116 Ga0207674_10587069 Ga0207674_105870691 212
268 3300026118 Ga0207675_100000971 Ga0207675_10000097125 212
269 3300026118 Ga0207675_100961906 Ga0207675_1009619061 212
270 3300026142 Ga0207698_10235739 Ga0207698_102357392 212
271 3300027907 Ga0207428_10222012 Ga0207428_102220121 212
272 3300028380 Ga0268265_10682148 Ga0268265_106821482 212
273 3300028380 Ga0268265_11394825 Ga0268265_113948251 212
274 3300039437 Ga0436365_0096822 Ga0436365_0096822_24_662 212
275 3300039437 Ga0436365_0181465 Ga0436365_0181465_2834_3550 212
276 3300042001 Ga0439441_002825 Ga0439441_002825_819_1457 212
277 3300042003 Ga0439443_037078 Ga0439443_037078_54_692 212
278 3300044712 Ga0453684_0204002 Ga0453684_0204002_674_1312 212
279 3300046537 Ga0495598_0037005 Ga0495598_0037005_634_1272 212
280 3300046539 Ga0495621_0047946 Ga0495621_0047946_194_832 212
281 3300047319 Ga0495674_0213417 Ga0495674_0213417_608_1246 212
282 3300047472 Ga0495686_0016060 Ga0495686_0016060_4155_4793 212
283 3300049573 Ga0501037_0088581 Ga0501037_0088581_540_1178 212
284 3300049823 Ga0501044_0230406 Ga0501044_0230406_702_1340 212
285 3300050493 nmdc:mga0k408_11492_c1 nmdc:mga0k408_11492_c1_3684_4322 212
286 3300050493 nmdc:mga0k408_56786_c1 nmdc:mga0k408_56786_c1_1094_1732 212
287 3300050508 nmdc:mga09592_4183_c1 nmdc:mga09592_4183_c1_7350_7988 212
288 3300050510 nmdc:mga06r32_365488_c1 nmdc:mga06r32_365488_c1_614_1252 212
289 3300050511 nmdc:mga08y16_888628_c1 nmdc:mga08y16_888628_c1_63_737 212
290 3300053727 Ga0500611_000001 Ga0500611_000001_312281_312919 212

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00730

HhH-GPD

HhH-GPD superfamily base excision DNA repair protein

73

215

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b21-assembly1.cif.gz_A unprecedented sculpting of dna at abasic sites by dna glycosylase homolog mag2 0.9182 8 199
3s6i-assembly1.cif.gz_A schizosaccaromyces pombe 3-methyladenine dna glycosylase (mag1) in complex with abasic-dna. 0.903 13 199
4ejz-assembly2.cif.gz_B structure of mbogg1 in complex with low affinity dna ligand 0.8778 10 207
1n3c-assembly1.cif.gz_A structural and biochemical exploration of a critical amino acid in human 8-oxoguanine glycosylase 0.8627 11 204
2noh-assembly1.cif.gz_A structure of catalytically inactive q315a human 8-oxoguanine glycosylase complexed to 8-oxoguanine dna 0.8597 10 204
ID Description Score Start End Superfamily
af_B4FZ58_120_231_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9429 42 150 1.10.340.30
4ejzB02 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9305 43 150 1.10.340.30
4b24A02 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9297 43 150 1.10.340.30
2h56B02 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9223 39 141 1.10.340.30
2yg8A02 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9182 43 145 1.10.340.30
ID Description Score Start End GO Terms
AF-G8T8U7-F1-model_v4 DNA-3-methyladenine glycosylase II (EC 3.2.2.21) 0.9944 2 210 GO:0005737
GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916
AF-A0A4Q3RRN0-F1-model_v4 DNA-3-methyladenine glycosylase II (EC 3.2.2.21) 0.9926 3 210 GO:0005737
GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916
AF-G8T8U7-F1-model_v4 DNA-3-methyladenine glycosylase II (EC 3.2.2.21) 0.9897 2 210 GO:0005737
GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916
AF-A0A2W2B4X4-F1-model_v4 DNA-3-methyladenine glycosylase II (EC 3.2.2.21) 0.9886 1 208 GO:0005737
GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916
AF-M3HXD7-F1-model_v4 DNA-3-methyladenine glycosylase II (EC 3.2.2.21) 0.9872 1 170 GO:0005737
GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916

Feature Viewer

pLDDT pTM Quality
96.24 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map