F389794
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 290 | 153 | 289 | 212 |
Family's Representative Sequence
| Representative Sequence | 3300021384|Ga0213876_10009118|Ga0213876_100091183 |
| Length | 238 |
| Sequence | MTGFFISRPSESFAASFQSQLSKMHESNNSYTKDNFHVLCNQLAKKDAALKAIIDKYGLPPMWSRPAIFQSLILTILEQQVSLASAYAAFKKLKAKIGFVTPKKILALTDAELRACYFSRQKIIYARALATAIVTKQLNLKKLGTLTDNEIRIELKKIKGIGDWTVDVYLMHALQRTDLFPLGDIALVNSLKEVKQLHPKATKEEMLAIAESWRPYRTIASMILWHAYIKKRGIKVLT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 45 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 55 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 56 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 57 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 58 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 59 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 81 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 120 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 122 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 123 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 124 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 125 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 126 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 127 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 128 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 129 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 130 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 131 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 148 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 149 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 150 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 151 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 152 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.66 |
| Metatranscriptomes | 0 |
| Isolates | 0.34 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.38 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 96.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10024406 | 3300002459 | Bacteria | 1254 |
| 2 | rootH1_10200657 | 3300003323 | Bacteria | 8741 |
| 3 | rootH1_10402054 | 3300003323 | Bacteria | 1222 |
| 4 | Ga0065704_10111241 | 3300005289 | Unclassified | 1961 |
| 5 | Ga0065712_10020465 | 3300005290 | Bacteria | 1319 |
| 6 | Ga0065712_10083934 | 3300005290 | Bacteria | 2800 |
| 7 | Ga0065712_10132749 | 3300005290 | Bacteria | 1519 |
| 8 | Ga0065715_10285187 | 3300005293 | Unclassified | 1076 |
| 9 | Ga0065715_10317153 | 3300005293 | Bacteria | 1007 |
| 10 | Ga0065707_10201075 | 3300005295 | Bacteria | 1308 |
| 11 | Ga0070676_10026898 | 3300005328 | Bacteria | 3258 |
| 12 | Ga0070683_100011799 | 3300005329 | Bacteria | 7569 |
| 13 | Ga0070683_100716875 | 3300005329 | Bacteria | 958 |
| 14 | Ga0070690_100213942 | 3300005330 | Bacteria | 1347 |
| 15 | Ga0070690_100674032 | 3300005330 | Bacteria | 792 |
| 16 | Ga0070670_100038326 | 3300005331 | Bacteria | 4122 |
| 17 | Ga0070670_100108872 | 3300005331 | Bacteria | 2387 |
| 18 | Ga0070670_100261657 | 3300005331 | Bacteria | 1508 |
| 19 | Ga0070670_100977058 | 3300005331 | Bacteria | 769 |
| 20 | Ga0068869_100205855 | 3300005334 | Unclassified | 1553 |
| 21 | Ga0070680_100040567 | 3300005336 | Bacteria | 3770 |
| 22 | Ga0068868_100404401 | 3300005338 | Bacteria | 1179 |
| 23 | Ga0070689_100247352 | 3300005340 | Bacteria | 1470 |
| 24 | Ga0070689_100294961 | 3300005340 | Bacteria | 1348 |
| 25 | Ga0070692_10437380 | 3300005345 | Bacteria | 834 |
| 26 | Ga0070668_100544310 | 3300005347 | Unclassified | 1010 |
| 27 | Ga0070669_100030940 | 3300005353 | Bacteria | 3864 |
| 28 | Ga0070669_100048237 | 3300005353 | Bacteria | 3108 |
| 29 | Ga0070669_100363164 | 3300005353 | Unclassified | 1178 |
| 30 | Ga0070669_100640276 | 3300005353 | Unclassified | 894 |
| 31 | Ga0070675_100081285 | 3300005354 | Bacteria | 2702 |
| 32 | Ga0070675_100215798 | 3300005354 | Bacteria | 1669 |
| 33 | Ga0070673_100294754 | 3300005364 | Unclassified | 1426 |
| 34 | Ga0070673_100469081 | 3300005364 | Bacteria | 1135 |
| 35 | Ga0070673_100629834 | 3300005364 | Bacteria | 980 |
| 36 | Ga0070688_100004079 | 3300005365 | Bacteria | 7578 |
| 37 | Ga0070688_100291510 | 3300005365 | Bacteria | 1176 |
| 38 | Ga0070659_100159195 | 3300005366 | Bacteria | 1845 |
| 39 | Ga0070667_100011123 | 3300005367 | Bacteria | 7444 |
| 40 | Ga0070667_100098695 | 3300005367 | Bacteria | 2520 |
| 41 | Ga0070667_100823744 | 3300005367 | Bacteria | 862 |
| 42 | Ga0070701_10724043 | 3300005438 | Bacteria | 671 |
| 43 | Ga0070700_100255309 | 3300005441 | Bacteria | 1260 |
| 44 | Ga0070663_100036139 | 3300005455 | Bacteria | 3432 |
| 45 | Ga0070678_100131546 | 3300005456 | Unclassified | 1989 |
| 46 | Ga0070662_100358833 | 3300005457 | Unclassified | 1195 |
| 47 | Ga0068867_100159882 | 3300005459 | Bacteria | 1776 |
| 48 | Ga0068867_100221456 | 3300005459 | Bacteria | 1525 |
| 49 | Ga0070685_10003838 | 3300005466 | Bacteria | 7602 |
| 50 | Ga0070685_10008491 | 3300005466 | Bacteria | 5283 |
| 51 | Ga0070685_10229249 | 3300005466 | Bacteria | 1221 |
| 52 | Ga0070698_100002783 | 3300005471 | Bacteria | 19250 |
| 53 | Ga0070698_100010172 | 3300005471 | Bacteria | 10049 |
| 54 | Ga0070698_100010416 | 3300005471 | Bacteria | 9928 |
| 55 | Ga0070698_100369181 | 3300005471 | Bacteria | 1367 |
| 56 | Ga0070679_100065170 | 3300005530 | Bacteria | 3631 |
| 57 | Ga0070679_100269912 | 3300005530 | Bacteria | 1655 |
| 58 | Ga0070684_100076700 | 3300005535 | Bacteria | 2950 |
| 59 | Ga0070684_100234528 | 3300005535 | Bacteria | 1676 |
| 60 | Ga0068853_100084111 | 3300005539 | Bacteria | 2788 |
| 61 | Ga0068853_100201432 | 3300005539 | Bacteria | 1812 |
| 62 | Ga0068853_100212902 | 3300005539 | Bacteria | 1762 |
| 63 | Ga0070672_100050673 | 3300005543 | Bacteria | 3235 |
| 64 | Ga0070686_100064405 | 3300005544 | Bacteria | 2378 |
| 65 | Ga0070664_100006035 | 3300005564 | Bacteria | 9794 |
| 66 | Ga0070664_100504205 | 3300005564 | Bacteria | 1116 |
| 67 | Ga0070664_101044132 | 3300005564 | Bacteria | 769 |
| 68 | Ga0068857_100031357 | 3300005577 | Bacteria | 4696 |
| 69 | Ga0068857_100042607 | 3300005577 | Bacteria | 4028 |
| 70 | Ga0068857_100158172 | 3300005577 | Bacteria | 2055 |
| 71 | Ga0068857_100225488 | 3300005577 | Bacteria | 1713 |
| 72 | Ga0068854_100816830 | 3300005578 | Unclassified | 814 |
| 73 | Ga0068852_100163728 | 3300005616 | Bacteria | 2079 |
| 74 | Ga0068852_100367984 | 3300005616 | Unclassified | 1408 |
| 75 | Ga0068852_100438886 | 3300005616 | Bacteria | 1290 |
| 76 | Ga0068852_100734093 | 3300005616 | Unclassified | 999 |
| 77 | Ga0068852_101303131 | 3300005616 | Bacteria | 748 |
| 78 | Ga0068859_100026207 | 3300005617 | Bacteria | 5847 |
| 79 | Ga0068859_100067439 | 3300005617 | Bacteria | 3612 |
| 80 | Ga0068859_100077436 | 3300005617 | Bacteria | 3366 |
| 81 | Ga0068859_100914366 | 3300005617 | Bacteria | 962 |
| 82 | Ga0068864_100011571 | 3300005618 | Bacteria | 7285 |
| 83 | Ga0068864_100028898 | 3300005618 | Bacteria | 4692 |
| 84 | Ga0068864_100045464 | 3300005618 | Bacteria | 3766 |
| 85 | Ga0068864_100458060 | 3300005618 | Bacteria | 1221 |
| 86 | Ga0068861_100006815 | 3300005719 | Bacteria | 7802 |
| 87 | Ga0068861_100079777 | 3300005719 | Unclassified | 2559 |
| 88 | Ga0068861_100602557 | 3300005719 | Bacteria | 1008 |
| 89 | Ga0068851_10194318 | 3300005834 | Bacteria | 1130 |
| 90 | Ga0068870_10161133 | 3300005840 | Unclassified | 1330 |
| 91 | Ga0068863_100014565 | 3300005841 | Bacteria | 7570 |
| 92 | Ga0068863_100017654 | 3300005841 | Bacteria | 6833 |
| 93 | Ga0068863_100167445 | 3300005841 | Bacteria | 2107 |
| 94 | Ga0068863_100219975 | 3300005841 | Bacteria | 1829 |
| 95 | Ga0068858_100069455 | 3300005842 | Bacteria | 3266 |
| 96 | Ga0068860_100099699 | 3300005843 | Bacteria | 2770 |
| 97 | Ga0068862_100015255 | 3300005844 | Bacteria | 6381 |
| 98 | Ga0068862_100299016 | 3300005844 | Bacteria | 1480 |
| 99 | Ga0068862_100395088 | 3300005844 | Unclassified | 1292 |
| 100 | Ga0068862_100747394 | 3300005844 | Bacteria | 951 |
| 101 | Ga0068862_101257843 | 3300005844 | Unclassified | 740 |
| 102 | Ga0070715_10246218 | 3300006163 | Unclassified | 932 |
| 103 | Ga0075366_10017390 | 3300006195 | Bacteria | 4138 |
| 104 | Ga0097621_100042194 | 3300006237 | Bacteria | 3674 |
| 105 | Ga0068871_100034981 | 3300006358 | Bacteria | 3989 |
| 106 | Ga0075428_100725621 | 3300006844 | Unclassified | 1058 |
| 107 | Ga0075428_100757935 | 3300006844 | Bacteria | 1033 |
| 108 | Ga0075428_101439336 | 3300006844 | Unclassified | 723 |
| 109 | Ga0075430_100018743 | 3300006846 | Bacteria | 5889 |
| 110 | Ga0075431_100309249 | 3300006847 | Unclassified | 1595 |
| 111 | Ga0075429_100007833 | 3300006880 | Bacteria | 9278 |
| 112 | Ga0068865_100039115 | 3300006881 | Bacteria | 3215 |
| 113 | Ga0097620_100026206 | 3300006931 | Bacteria | 5847 |
| 114 | Ga0097620_100067442 | 3300006931 | Bacteria | 3612 |
| 115 | Ga0097620_100077435 | 3300006931 | Bacteria | 3366 |
| 116 | Ga0097620_100914503 | 3300006931 | Bacteria | 962 |
| 117 | Ga0111539_10078829 | 3300009094 | Bacteria | 3874 |
| 118 | Ga0111539_10129635 | 3300009094 | Bacteria | 2953 |
| 119 | Ga0111539_10376909 | 3300009094 | Bacteria | 1652 |
| 120 | Ga0111539_10918575 | 3300009094 | Bacteria | 1018 |
| 121 | Ga0105247_10001441 | 3300009101 | Bacteria | 17229 |
| 122 | Ga0114129_10083808 | 3300009147 | Bacteria | 4426 |
| 123 | Ga0105242_10007012 | 3300009176 | Bacteria | 8700 |
| 124 | Ga0105242_10040956 | 3300009176 | Bacteria | 3734 |
| 125 | Ga0105242_10409259 | 3300009176 | Bacteria | 1268 |
| 126 | Ga0105242_10572719 | 3300009176 | Bacteria | 1086 |
| 127 | Ga0105242_11320267 | 3300009176 | Bacteria | 746 |
| 128 | Ga0105242_11493969 | 3300009176 | Bacteria | 706 |
| 129 | Ga0105237_10099799 | 3300009545 | Bacteria | 2894 |
| 130 | Ga0105249_10015813 | 3300009553 | Bacteria | 6686 |
| 131 | Ga0105249_10022815 | 3300009553 | Bacteria | 5611 |
| 132 | Ga0105249_10135075 | 3300009553 | Unclassified | 2359 |
| 133 | Ga0105249_10327892 | 3300009553 | Bacteria | 1544 |
| 134 | Ga0105249_10328277 | 3300009553 | Bacteria | 1543 |
| 135 | Ga0105249_10403295 | 3300009553 | Bacteria | 1398 |
| 136 | Ga0105249_11176267 | 3300009553 | Bacteria | 838 |
| 137 | Ga0105249_11659240 | 3300009553 | Unclassified | 712 |
| 138 | Ga0105246_10171152 | 3300011119 | Bacteria | 1664 |
| 139 | Ga0157371_10024202 | 3300013102 | Bacteria | 4436 |
| 140 | Ga0157370_10005549 | 3300013104 | Bacteria | 14145 |
| 141 | Ga0157370_10607387 | 3300013104 | Bacteria | 1001 |
| 142 | Ga0157369_10063024 | 3300013105 | Bacteria | 3995 |
| 143 | Ga0157369_10090429 | 3300013105 | Bacteria | 3268 |
| 144 | Ga0157369_10537859 | 3300013105 | Unclassified | 1208 |
| 145 | Ga0157374_10050379 | 3300013296 | Bacteria | 3870 |
| 146 | Ga0157374_10070149 | 3300013296 | Bacteria | 3301 |
| 147 | Ga0157378_10016875 | 3300013297 | Bacteria | 6399 |
| 148 | Ga0157378_10108130 | 3300013297 | Unclassified | 2546 |
| 149 | Ga0157378_10559701 | 3300013297 | Unclassified | 1150 |
| 150 | Ga0163162_10107310 | 3300013306 | Bacteria | 2888 |
| 151 | Ga0163162_10151780 | 3300013306 | Bacteria | 2435 |
| 152 | Ga0157372_10063438 | 3300013307 | Bacteria | 4143 |
| 153 | Ga0157372_10266979 | 3300013307 | Bacteria | 1988 |
| 154 | Ga0157372_10585971 | 3300013307 | Bacteria | 1300 |
| 155 | Ga0157372_10706813 | 3300013307 | Bacteria | 1173 |
| 156 | Ga0157372_10729633 | 3300013307 | Bacteria | 1152 |
| 157 | Ga0157372_10954640 | 3300013307 | Bacteria | 994 |
| 158 | Ga0157375_10095874 | 3300013308 | Bacteria | 3038 |
| 159 | Ga0157375_10127069 | 3300013308 | Bacteria | 2666 |
| 160 | Ga0157375_10279785 | 3300013308 | Bacteria | 1832 |
| 161 | Ga0157375_11317219 | 3300013308 | Unclassified | 849 |
| 162 | Ga0163163_10060937 | 3300014325 | Bacteria | 3738 |
| 163 | Ga0163163_10195332 | 3300014325 | Bacteria | 2071 |
| 164 | Ga0163163_10208067 | 3300014325 | Bacteria | 2005 |
| 165 | Ga0163163_10208290 | 3300014325 | Unclassified | 2004 |
| 166 | Ga0163163_10522510 | 3300014325 | Bacteria | 1249 |
| 167 | Ga0157380_10006312 | 3300014326 | Bacteria | 8330 |
| 168 | Ga0157380_10014572 | 3300014326 | Bacteria | 5755 |
| 169 | Ga0157380_10244781 | 3300014326 | Bacteria | 1619 |
| 170 | Ga0157379_10073255 | 3300014968 | Bacteria | 3065 |
| 171 | Ga0157376_10141784 | 3300014969 | Bacteria | 2157 |
| 172 | Ga0163161_10056126 | 3300017792 | Bacteria | 2860 |
| 173 | Ga0213876_10009118 | 3300021384 | Bacteria | 5341 |
| 174 | Ga0207697_10025602 | 3300025315 | Unclassified | 2411 |
| 175 | Ga0207697_10142640 | 3300025315 | Unclassified | 1040 |
| 176 | Ga0207656_10109969 | 3300025321 | Bacteria | 1272 |
| 177 | Ga0207710_10000326 | 3300025900 | Bacteria | 36470 |
| 178 | Ga0207647_10003273 | 3300025904 | Bacteria | 12167 |
| 179 | Ga0207685_10120629 | 3300025905 | Bacteria | 1150 |
| 180 | Ga0207645_10479008 | 3300025907 | Unclassified | 842 |
| 181 | Ga0207643_10026040 | 3300025908 | Bacteria | 3236 |
| 182 | Ga0207705_10287674 | 3300025909 | Bacteria | 1259 |
| 183 | Ga0207671_10075778 | 3300025914 | Bacteria | 2516 |
| 184 | Ga0207660_10665662 | 3300025917 | Bacteria | 849 |
| 185 | Ga0207662_10043507 | 3300025918 | Bacteria | 2649 |
| 186 | Ga0207662_10112057 | 3300025918 | Bacteria | 1702 |
| 187 | Ga0207662_10584811 | 3300025918 | Unclassified | 776 |
| 188 | Ga0207652_10019095 | 3300025921 | Bacteria | 5632 |
| 189 | Ga0207652_10233993 | 3300025921 | Bacteria | 1656 |
| 190 | Ga0207646_10470458 | 3300025922 | Unclassified | 1133 |
| 191 | Ga0207681_10353734 | 3300025923 | Unclassified | 1176 |
| 192 | Ga0207681_10372222 | 3300025923 | Bacteria | 1148 |
| 193 | Ga0207681_10388018 | 3300025923 | Unclassified | 1125 |
| 194 | Ga0207650_10046818 | 3300025925 | Bacteria | 3185 |
| 195 | Ga0207650_10220011 | 3300025925 | Bacteria | 1528 |
| 196 | Ga0207650_10340414 | 3300025925 | Bacteria | 1232 |
| 197 | Ga0207650_10560210 | 3300025925 | Bacteria | 959 |
| 198 | Ga0207659_10104651 | 3300025926 | Unclassified | 2140 |
| 199 | Ga0207644_10400669 | 3300025931 | Bacteria | 1122 |
| 200 | Ga0207690_10033567 | 3300025932 | Bacteria | 3300 |
| 201 | Ga0207686_10002599 | 3300025934 | Bacteria | 9795 |
| 202 | Ga0207686_10090247 | 3300025934 | Bacteria | 2021 |
| 203 | Ga0207686_10195797 | 3300025934 | Unclassified | 1444 |
| 204 | Ga0207670_10034138 | 3300025936 | Bacteria | 3284 |
| 205 | Ga0207670_10160957 | 3300025936 | Bacteria | 1675 |
| 206 | Ga0207691_10023513 | 3300025940 | Bacteria | 5803 |
| 207 | Ga0207691_10077243 | 3300025940 | Bacteria | 3000 |
| 208 | Ga0207689_10196877 | 3300025942 | Unclassified | 1663 |
| 209 | Ga0207689_10446124 | 3300025942 | Bacteria | 1081 |
| 210 | Ga0207679_10406614 | 3300025945 | Bacteria | 1198 |
| 211 | Ga0207651_10282074 | 3300025960 | Bacteria | 1373 |
| 212 | Ga0207651_10414734 | 3300025960 | Bacteria | 1148 |
| 213 | Ga0207651_10441380 | 3300025960 | Unclassified | 1115 |
| 214 | Ga0207712_10004285 | 3300025961 | Bacteria | 9002 |
| 215 | Ga0207712_10006820 | 3300025961 | Bacteria | 7206 |
| 216 | Ga0207712_10060814 | 3300025961 | Unclassified | 2679 |
| 217 | Ga0207712_10104783 | 3300025961 | Bacteria | 2110 |
| 218 | Ga0207668_10288128 | 3300025972 | Unclassified | 1350 |
| 219 | Ga0207640_10605379 | 3300025981 | Bacteria | 928 |
| 220 | Ga0207658_10020814 | 3300025986 | Bacteria | 4544 |
| 221 | Ga0207658_10071297 | 3300025986 | Bacteria | 2631 |
| 222 | Ga0207658_10607924 | 3300025986 | Bacteria | 983 |
| 223 | Ga0207703_10019247 | 3300026035 | Bacteria | 5332 |
| 224 | Ga0207639_10023235 | 3300026041 | Bacteria | 4476 |
| 225 | Ga0207678_10091710 | 3300026067 | Bacteria | 2597 |
| 226 | Ga0207678_10227163 | 3300026067 | Bacteria | 1598 |
| 227 | Ga0207708_10360996 | 3300026075 | Unclassified | 1194 |
| 228 | Ga0207641_10001198 | 3300026088 | Bacteria | 25980 |
| 229 | Ga0207641_10074101 | 3300026088 | Bacteria | 2935 |
| 230 | Ga0207641_10210178 | 3300026088 | Bacteria | 1799 |
| 231 | Ga0207641_10254123 | 3300026088 | Bacteria | 1642 |
| 232 | Ga0207648_10034587 | 3300026089 | Bacteria | 4453 |
| 233 | Ga0207648_10876899 | 3300026089 | Bacteria | 837 |
| 234 | Ga0207676_10008331 | 3300026095 | Bacteria | 7369 |
| 235 | Ga0207676_10016005 | 3300026095 | Bacteria | 5427 |
| 236 | Ga0207676_10059421 | 3300026095 | Bacteria | 3019 |
| 237 | Ga0207674_10011558 | 3300026116 | Bacteria | 9916 |
| 238 | Ga0207674_10052457 | 3300026116 | Bacteria | 4159 |
| 239 | Ga0207674_10131704 | 3300026116 | Unclassified | 2463 |
| 240 | Ga0207674_10312051 | 3300026116 | Bacteria | 1522 |
| 241 | Ga0207674_10566545 | 3300026116 | Bacteria | 1097 |
| 242 | Ga0207674_10587069 | 3300026116 | Bacteria | 1076 |
| 243 | Ga0207675_100000971 | 3300026118 | Bacteria | 28493 |
| 244 | Ga0207675_100005986 | 3300026118 | Bacteria | 11578 |
| 245 | Ga0207675_100961906 | 3300026118 | Bacteria | 871 |
| 246 | Ga0207698_10235739 | 3300026142 | Bacteria | 1664 |
| 247 | Ga0207698_10548968 | 3300026142 | Bacteria | 1132 |
| 248 | Ga0207428_10222012 | 3300027907 | Unclassified | 1416 |
| 249 | Ga0268265_10682148 | 3300028380 | Bacteria | 991 |
| 250 | Ga0268265_11394825 | 3300028380 | Bacteria | 703 |
| 251 | Ga0307410_10673299 | 3300031852 | Unclassified | 870 |
| 252 | Ga0307407_10491925 | 3300031903 | Unclassified | 898 |
| 253 | Ga0373937_1109135 | 3300036401 | Unclassified | 740 |
| 254 | Ga0436365_0096822 | 3300039437 | Bacteria | 1142 |
| 255 | Ga0436365_0181465 | 3300039437 | Bacteria | 30838 |
| 256 | Ga0436365_0944366 | 3300039437 | Bacteria | 2917 |
| 257 | Ga0439441_002825 | 3300042001 | Bacteria | 2486 |
| 258 | Ga0439443_037078 | 3300042003 | Unclassified | 822 |
| 259 | Ga0439457_071935 | 3300042014 | Bacteria | 789 |
| 260 | Ga0453684_0088550 | 3300044712 | Bacteria | 3833 |
| 261 | Ga0453684_0204002 | 3300044712 | Bacteria | 2303 |
| 262 | Ga0466959_0112676 | 3300045049 | Bacteria | 1940 |
| 263 | Ga0451576_0197771 | 3300045051 | Bacteria | 2100 |
| 264 | Ga0495629_0210210 | 3300046459 | Bacteria | 1344 |
| 265 | Ga0495580_0408194 | 3300046472 | Bacteria | 915 |
| 266 | Ga0495662_0219699 | 3300046476 | Unclassified | 937 |
| 267 | Ga0495630_0179308 | 3300046517 | Unclassified | 1615 |
| 268 | Ga0495598_0037005 | 3300046537 | Bacteria | 1406 |
| 269 | Ga0495621_0047946 | 3300046539 | Bacteria | 1520 |
| 270 | Ga0495667_0169516 | 3300046559 | Unclassified | 1403 |
| 271 | Ga0495657_0460083 | 3300046675 | Bacteria | 744 |
| 272 | Ga0495658_0046739 | 3300046683 | Bacteria | 2435 |
| 273 | Ga0495600_0156570 | 3300046809 | Unclassified | 1474 |
| 274 | Ga0495674_0070845 | 3300047319 | Bacteria | 3012 |
| 275 | Ga0495674_0213417 | 3300047319 | Bacteria | 1598 |
| 276 | Ga0495672_0020228 | 3300047320 | Bacteria | 4367 |
| 277 | Ga0495686_0016060 | 3300047472 | Bacteria | 5088 |
| 278 | Ga0495686_0308639 | 3300047472 | Bacteria | 871 |
| 279 | Ga0495602_0288804 | 3300048088 | Unclassified | 1205 |
| 280 | Ga0501037_0088581 | 3300049573 | Bacteria | 2240 |
| 281 | Ga0501044_0230406 | 3300049823 | Bacteria | 1800 |
| 282 | nmdc:mga0k408_11492_c1 | 3300050493 | Bacteria | 4824 |
| 283 | nmdc:mga0k408_56786_c1 | 3300050493 | Bacteria | 2272 |
| 284 | nmdc:mga05p37_35535_c1 | 3300050507 | Bacteria | 3495 |
| 285 | nmdc:mga09592_4183_c1 | 3300050508 | Bacteria | 11657 |
| 286 | nmdc:mga06r32_365488_c1 | 3300050510 | Unclassified | 1426 |
| 287 | nmdc:mga08y16_888628_c1 | 3300050511 | Unclassified | 878 |
| 288 | Ga0495619_0096254 | 3300053085 | Unclassified | 2010 |
| 289 | Ga0500611_000001 | 3300053727 | Bacteria | 385744 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046675 | Ga0495657_0460083 | Ga0495657_0460083_32_586 | 175 |
| 2 | 3300005364 | Ga0070673_100629834 | Ga0070673_1006298341 | 195 |
| 3 | 3300005564 | Ga0070664_101044132 | Ga0070664_1010441321 | 195 |
| 4 | 3300025945 | Ga0207679_10406614 | Ga0207679_104066142 | 195 |
| 5 | 3300013296 | Ga0157374_10070149 | Ga0157374_100701494 | 198 |
| 6 | 3300005289 | Ga0065704_10111241 | Ga0065704_101112413 | 199 |
| 7 | 3300005293 | Ga0065715_10285187 | Ga0065715_102851872 | 199 |
| 8 | 3300005328 | Ga0070676_10026898 | Ga0070676_100268981 | 199 |
| 9 | 3300005331 | Ga0070670_100038326 | Ga0070670_1000383262 | 199 |
| 10 | 3300005345 | Ga0070692_10437380 | Ga0070692_104373801 | 199 |
| 11 | 3300005347 | Ga0070668_100544310 | Ga0070668_1005443101 | 199 |
| 12 | 3300005353 | Ga0070669_100048237 | Ga0070669_1000482371 | 199 |
| 13 | 3300005354 | Ga0070675_100081285 | Ga0070675_1000812853 | 199 |
| 14 | 3300005364 | Ga0070673_100469081 | Ga0070673_1004690812 | 199 |
| 15 | 3300005441 | Ga0070700_100255309 | Ga0070700_1002553091 | 199 |
| 16 | 3300005457 | Ga0070662_100358833 | Ga0070662_1003588331 | 199 |
| 17 | 3300005543 | Ga0070672_100050673 | Ga0070672_1000506733 | 199 |
| 18 | 3300005577 | Ga0068857_100031357 | Ga0068857_1000313575 | 199 |
| 19 | 3300005578 | Ga0068854_100816830 | Ga0068854_1008168301 | 199 |
| 20 | 3300005617 | Ga0068859_100067439 | Ga0068859_1000674392 | 199 |
| 21 | 3300005719 | Ga0068861_100079777 | Ga0068861_1000797773 | 199 |
| 22 | 3300005844 | Ga0068862_100015255 | Ga0068862_1000152552 | 199 |
| 23 | 3300006844 | Ga0075428_101439336 | Ga0075428_1014393361 | 199 |
| 24 | 3300006931 | Ga0097620_100067442 | Ga0097620_1000674423 | 199 |
| 25 | 3300009094 | Ga0111539_10078829 | Ga0111539_100788292 | 199 |
| 26 | 3300009553 | Ga0105249_10135075 | Ga0105249_101350753 | 199 |
| 27 | 3300013306 | Ga0163162_10107310 | Ga0163162_101073103 | 199 |
| 28 | 3300013308 | Ga0157375_10127069 | Ga0157375_101270693 | 199 |
| 29 | 3300014326 | Ga0157380_10014572 | Ga0157380_100145727 | 199 |
| 30 | 3300025315 | Ga0207697_10025602 | Ga0207697_100256021 | 199 |
| 31 | 3300025907 | Ga0207645_10479008 | Ga0207645_104790082 | 199 |
| 32 | 3300025908 | Ga0207643_10026040 | Ga0207643_100260401 | 199 |
| 33 | 3300025918 | Ga0207662_10584811 | Ga0207662_105848111 | 199 |
| 34 | 3300025925 | Ga0207650_10046818 | Ga0207650_100468182 | 199 |
| 35 | 3300025926 | Ga0207659_10104651 | Ga0207659_101046511 | 199 |
| 36 | 3300025940 | Ga0207691_10077243 | Ga0207691_100772431 | 199 |
| 37 | 3300025960 | Ga0207651_10414734 | Ga0207651_104147342 | 199 |
| 38 | 3300025961 | Ga0207712_10060814 | Ga0207712_100608143 | 199 |
| 39 | 3300026075 | Ga0207708_10360996 | Ga0207708_103609961 | 199 |
| 40 | 3300026116 | Ga0207674_10011558 | Ga0207674_1001155811 | 199 |
| 41 | 3300026118 | Ga0207675_100005986 | Ga0207675_1000059861 | 199 |
| 42 | 3300013105 | Ga0157369_10063024 | Ga0157369_100630244 | 205 |
| 43 | iso_pu_bacteria | 2977232053 | 2977235228 | 205 |
| 44 | 3300003323 | rootH1_10200657 | rootH1_102006575 | 207 |
| 45 | 3300025315 | Ga0207697_10142640 | Ga0207697_101426402 | 207 |
| 46 | 3300005367 | Ga0070667_100098695 | Ga0070667_1000986951 | 209 |
| 47 | 3300013307 | Ga0157372_10954640 | Ga0157372_109546402 | 209 |
| 48 | 3300025986 | Ga0207658_10071297 | Ga0207658_100712971 | 209 |
| 49 | 3300031852 | Ga0307410_10673299 | Ga0307410_106732991 | 209 |
| 50 | 3300031903 | Ga0307407_10491925 | Ga0307407_104919251 | 209 |
| 51 | 3300039437 | Ga0436365_0944366 | Ga0436365_0944366_1627_2256 | 209 |
| 52 | 3300005329 | Ga0070683_100011799 | Ga0070683_1000117993 | 210 |
| 53 | 3300005331 | Ga0070670_100108872 | Ga0070670_1001088724 | 210 |
| 54 | 3300005331 | Ga0070670_100977058 | Ga0070670_1009770581 | 210 |
| 55 | 3300005336 | Ga0070680_100040567 | Ga0070680_1000405676 | 210 |
| 56 | 3300005338 | Ga0068868_100404401 | Ga0068868_1004044011 | 210 |
| 57 | 3300005366 | Ga0070659_100159195 | Ga0070659_1001591952 | 210 |
| 58 | 3300005367 | Ga0070667_100011123 | Ga0070667_1000111237 | 210 |
| 59 | 3300005530 | Ga0070679_100065170 | Ga0070679_1000651704 | 210 |
| 60 | 3300005530 | Ga0070679_100269912 | Ga0070679_1002699121 | 210 |
| 61 | 3300005535 | Ga0070684_100076700 | Ga0070684_1000767002 | 210 |
| 62 | 3300005539 | Ga0068853_100201432 | Ga0068853_1002014322 | 210 |
| 63 | 3300005539 | Ga0068853_100212902 | Ga0068853_1002129022 | 210 |
| 64 | 3300005564 | Ga0070664_100006035 | Ga0070664_10000603511 | 210 |
| 65 | 3300005616 | Ga0068852_100367984 | Ga0068852_1003679842 | 210 |
| 66 | 3300005617 | Ga0068859_100026207 | Ga0068859_1000262074 | 210 |
| 67 | 3300005834 | Ga0068851_10194318 | Ga0068851_101943182 | 210 |
| 68 | 3300006931 | Ga0097620_100026206 | Ga0097620_1000262064 | 210 |
| 69 | 3300009176 | Ga0105242_11493969 | Ga0105242_114939691 | 210 |
| 70 | 3300009545 | Ga0105237_10099799 | Ga0105237_100997992 | 210 |
| 71 | 3300013102 | Ga0157371_10024202 | Ga0157371_100242023 | 210 |
| 72 | 3300013104 | Ga0157370_10607387 | Ga0157370_106073871 | 210 |
| 73 | 3300013105 | Ga0157369_10537859 | Ga0157369_105378592 | 210 |
| 74 | 3300013297 | Ga0157378_10016875 | Ga0157378_100168753 | 210 |
| 75 | 3300013297 | Ga0157378_10108130 | Ga0157378_101081302 | 210 |
| 76 | 3300013307 | Ga0157372_10266979 | Ga0157372_102669792 | 210 |
| 77 | 3300013308 | Ga0157375_10279785 | Ga0157375_102797852 | 210 |
| 78 | 3300014325 | Ga0163163_10060937 | Ga0163163_100609372 | 210 |
| 79 | 3300025904 | Ga0207647_10003273 | Ga0207647_100032733 | 210 |
| 80 | 3300025914 | Ga0207671_10075778 | Ga0207671_100757782 | 210 |
| 81 | 3300025917 | Ga0207660_10665662 | Ga0207660_106656621 | 210 |
| 82 | 3300025921 | Ga0207652_10019095 | Ga0207652_100190954 | 210 |
| 83 | 3300025921 | Ga0207652_10233993 | Ga0207652_102339933 | 210 |
| 84 | 3300025925 | Ga0207650_10560210 | Ga0207650_105602101 | 210 |
| 85 | 3300025932 | Ga0207690_10033567 | Ga0207690_100335672 | 210 |
| 86 | 3300025986 | Ga0207658_10020814 | Ga0207658_100208147 | 210 |
| 87 | 3300026116 | Ga0207674_10052457 | Ga0207674_100524572 | 210 |
| 88 | 3300026142 | Ga0207698_10548968 | Ga0207698_105489682 | 210 |
| 89 | 3300036401 | Ga0373937_1109135 | Ga0373937_1109135_45_713 | 210 |
| 90 | 3300042014 | Ga0439457_071935 | Ga0439457_071935_91_732 | 210 |
| 91 | 3300044712 | Ga0453684_0088550 | Ga0453684_0088550_271_903 | 210 |
| 92 | 3300045049 | Ga0466959_0112676 | Ga0466959_0112676_735_1370 | 210 |
| 93 | 3300045051 | Ga0451576_0197771 | Ga0451576_0197771_417_1049 | 210 |
| 94 | 3300046459 | Ga0495629_0210210 | Ga0495629_0210210_91_759 | 210 |
| 95 | 3300046472 | Ga0495580_0408194 | Ga0495580_0408194_54_722 | 210 |
| 96 | 3300046476 | Ga0495662_0219699 | Ga0495662_0219699_177_845 | 210 |
| 97 | 3300046517 | Ga0495630_0179308 | Ga0495630_0179308_193_861 | 210 |
| 98 | 3300046559 | Ga0495667_0169516 | Ga0495667_0169516_503_1171 | 210 |
| 99 | 3300046683 | Ga0495658_0046739 | Ga0495658_0046739_766_1434 | 210 |
| 100 | 3300046809 | Ga0495600_0156570 | Ga0495600_0156570_767_1435 | 210 |
| 101 | 3300047319 | Ga0495674_0070845 | Ga0495674_0070845_2201_2869 | 210 |
| 102 | 3300047320 | Ga0495672_0020228 | Ga0495672_0020228_1539_2171 | 210 |
| 103 | 3300048088 | Ga0495602_0288804 | Ga0495602_0288804_241_909 | 210 |
| 104 | 3300053085 | Ga0495619_0096254 | Ga0495619_0096254_1281_1949 | 210 |
| 105 | 3300005334 | Ga0068869_100205855 | Ga0068869_1002058552 | 211 |
| 106 | 3300005367 | Ga0070667_100823744 | Ga0070667_1008237441 | 211 |
| 107 | 3300005459 | Ga0068867_100221456 | Ga0068867_1002214561 | 211 |
| 108 | 3300009147 | Ga0114129_10083808 | Ga0114129_100838085 | 211 |
| 109 | 3300011119 | Ga0105246_10171152 | Ga0105246_101711522 | 211 |
| 110 | 3300013307 | Ga0157372_10585971 | Ga0157372_105859712 | 211 |
| 111 | 3300025942 | Ga0207689_10196877 | Ga0207689_101968772 | 211 |
| 112 | 3300026067 | Ga0207678_10227163 | Ga0207678_102271632 | 211 |
| 113 | 3300047472 | Ga0495686_0308639 | Ga0495686_0308639_60_695 | 211 |
| 114 | 3300050507 | nmdc:mga05p37_35535_c1 | nmdc:mga05p37_35535_c1_2835_3470 | 211 |
| 115 | 3300002459 | JGI24751J29686_10024406 | JGI24751J29686_100244062 | 212 |
| 116 | 3300003323 | rootH1_10402054 | rootH1_104020542 | 212 |
| 117 | 3300005290 | Ga0065712_10020465 | Ga0065712_100204652 | 212 |
| 118 | 3300005290 | Ga0065712_10083934 | Ga0065712_100839342 | 212 |
| 119 | 3300005290 | Ga0065712_10132749 | Ga0065712_101327491 | 212 |
| 120 | 3300005293 | Ga0065715_10317153 | Ga0065715_103171531 | 212 |
| 121 | 3300005295 | Ga0065707_10201075 | Ga0065707_102010752 | 212 |
| 122 | 3300005329 | Ga0070683_100716875 | Ga0070683_1007168751 | 212 |
| 123 | 3300005330 | Ga0070690_100213942 | Ga0070690_1002139422 | 212 |
| 124 | 3300005330 | Ga0070690_100674032 | Ga0070690_1006740321 | 212 |
| 125 | 3300005331 | Ga0070670_100261657 | Ga0070670_1002616572 | 212 |
| 126 | 3300005340 | Ga0070689_100247352 | Ga0070689_1002473522 | 212 |
| 127 | 3300005340 | Ga0070689_100294961 | Ga0070689_1002949612 | 212 |
| 128 | 3300005353 | Ga0070669_100030940 | Ga0070669_1000309403 | 212 |
| 129 | 3300005353 | Ga0070669_100363164 | Ga0070669_1003631642 | 212 |
| 130 | 3300005353 | Ga0070669_100640276 | Ga0070669_1006402762 | 212 |
| 131 | 3300005354 | Ga0070675_100215798 | Ga0070675_1002157982 | 212 |
| 132 | 3300005364 | Ga0070673_100294754 | Ga0070673_1002947542 | 212 |
| 133 | 3300005365 | Ga0070688_100004079 | Ga0070688_1000040796 | 212 |
| 134 | 3300005365 | Ga0070688_100291510 | Ga0070688_1002915101 | 212 |
| 135 | 3300005438 | Ga0070701_10724043 | Ga0070701_107240431 | 212 |
| 136 | 3300005455 | Ga0070663_100036139 | Ga0070663_1000361394 | 212 |
| 137 | 3300005456 | Ga0070678_100131546 | Ga0070678_1001315462 | 212 |
| 138 | 3300005459 | Ga0068867_100159882 | Ga0068867_1001598822 | 212 |
| 139 | 3300005466 | Ga0070685_10003838 | Ga0070685_100038386 | 212 |
| 140 | 3300005466 | Ga0070685_10008491 | Ga0070685_100084915 | 212 |
| 141 | 3300005466 | Ga0070685_10229249 | Ga0070685_102292492 | 212 |
| 142 | 3300005471 | Ga0070698_100002783 | Ga0070698_1000027839 | 212 |
| 143 | 3300005471 | Ga0070698_100010172 | Ga0070698_1000101723 | 212 |
| 144 | 3300005471 | Ga0070698_100010416 | Ga0070698_1000104164 | 212 |
| 145 | 3300005471 | Ga0070698_100369181 | Ga0070698_1003691812 | 212 |
| 146 | 3300005535 | Ga0070684_100234528 | Ga0070684_1002345282 | 212 |
| 147 | 3300005539 | Ga0068853_100084111 | Ga0068853_1000841112 | 212 |
| 148 | 3300005544 | Ga0070686_100064405 | Ga0070686_1000644052 | 212 |
| 149 | 3300005564 | Ga0070664_100504205 | Ga0070664_1005042052 | 212 |
| 150 | 3300005577 | Ga0068857_100042607 | Ga0068857_1000426072 | 212 |
| 151 | 3300005577 | Ga0068857_100158172 | Ga0068857_1001581722 | 212 |
| 152 | 3300005577 | Ga0068857_100225488 | Ga0068857_1002254882 | 212 |
| 153 | 3300005616 | Ga0068852_100163728 | Ga0068852_1001637283 | 212 |
| 154 | 3300005616 | Ga0068852_100438886 | Ga0068852_1004388862 | 212 |
| 155 | 3300005616 | Ga0068852_100734093 | Ga0068852_1007340931 | 212 |
| 156 | 3300005616 | Ga0068852_101303131 | Ga0068852_1013031312 | 212 |
| 157 | 3300005617 | Ga0068859_100077436 | Ga0068859_1000774361 | 212 |
| 158 | 3300005617 | Ga0068859_100914366 | Ga0068859_1009143662 | 212 |
| 159 | 3300005618 | Ga0068864_100011571 | Ga0068864_1000115716 | 212 |
| 160 | 3300005618 | Ga0068864_100028898 | Ga0068864_1000288983 | 212 |
| 161 | 3300005618 | Ga0068864_100045464 | Ga0068864_1000454643 | 212 |
| 162 | 3300005618 | Ga0068864_100458060 | Ga0068864_1004580601 | 212 |
| 163 | 3300005719 | Ga0068861_100006815 | Ga0068861_1000068152 | 212 |
| 164 | 3300005719 | Ga0068861_100602557 | Ga0068861_1006025571 | 212 |
| 165 | 3300005840 | Ga0068870_10161133 | Ga0068870_101611332 | 212 |
| 166 | 3300005841 | Ga0068863_100014565 | Ga0068863_1000145653 | 212 |
| 167 | 3300005841 | Ga0068863_100017654 | Ga0068863_10001765410 | 212 |
| 168 | 3300005841 | Ga0068863_100167445 | Ga0068863_1001674452 | 212 |
| 169 | 3300005841 | Ga0068863_100219975 | Ga0068863_1002199752 | 212 |
| 170 | 3300005842 | Ga0068858_100069455 | Ga0068858_1000694553 | 212 |
| 171 | 3300005843 | Ga0068860_100099699 | Ga0068860_1000996992 | 212 |
| 172 | 3300005844 | Ga0068862_100299016 | Ga0068862_1002990161 | 212 |
| 173 | 3300005844 | Ga0068862_100395088 | Ga0068862_1003950882 | 212 |
| 174 | 3300005844 | Ga0068862_100747394 | Ga0068862_1007473942 | 212 |
| 175 | 3300005844 | Ga0068862_101257843 | Ga0068862_1012578431 | 212 |
| 176 | 3300006163 | Ga0070715_10246218 | Ga0070715_102462182 | 212 |
| 177 | 3300006195 | Ga0075366_10017390 | Ga0075366_100173904 | 212 |
| 178 | 3300006237 | Ga0097621_100042194 | Ga0097621_1000421942 | 212 |
| 179 | 3300006358 | Ga0068871_100034981 | Ga0068871_1000349815 | 212 |
| 180 | 3300006844 | Ga0075428_100725621 | Ga0075428_1007256212 | 212 |
| 181 | 3300006844 | Ga0075428_100757935 | Ga0075428_1007579352 | 212 |
| 182 | 3300006846 | Ga0075430_100018743 | Ga0075430_1000187437 | 212 |
| 183 | 3300006847 | Ga0075431_100309249 | Ga0075431_1003092492 | 212 |
| 184 | 3300006880 | Ga0075429_100007833 | Ga0075429_1000078337 | 212 |
| 185 | 3300006881 | Ga0068865_100039115 | Ga0068865_1000391153 | 212 |
| 186 | 3300006931 | Ga0097620_100077435 | Ga0097620_1000774351 | 212 |
| 187 | 3300006931 | Ga0097620_100914503 | Ga0097620_1009145032 | 212 |
| 188 | 3300009094 | Ga0111539_10129635 | Ga0111539_101296352 | 212 |
| 189 | 3300009094 | Ga0111539_10376909 | Ga0111539_103769092 | 212 |
| 190 | 3300009094 | Ga0111539_10918575 | Ga0111539_109185751 | 212 |
| 191 | 3300009101 | Ga0105247_10001441 | Ga0105247_100014412 | 212 |
| 192 | 3300009176 | Ga0105242_10007012 | Ga0105242_100070124 | 212 |
| 193 | 3300009176 | Ga0105242_10040956 | Ga0105242_100409564 | 212 |
| 194 | 3300009176 | Ga0105242_10409259 | Ga0105242_104092592 | 212 |
| 195 | 3300009176 | Ga0105242_10572719 | Ga0105242_105727192 | 212 |
| 196 | 3300009176 | Ga0105242_11320267 | Ga0105242_113202671 | 212 |
| 197 | 3300009553 | Ga0105249_10015813 | Ga0105249_100158137 | 212 |
| 198 | 3300009553 | Ga0105249_10022815 | Ga0105249_100228153 | 212 |
| 199 | 3300009553 | Ga0105249_10327892 | Ga0105249_103278922 | 212 |
| 200 | 3300009553 | Ga0105249_10328277 | Ga0105249_103282771 | 212 |
| 201 | 3300009553 | Ga0105249_10403295 | Ga0105249_104032952 | 212 |
| 202 | 3300009553 | Ga0105249_11176267 | Ga0105249_111762671 | 212 |
| 203 | 3300009553 | Ga0105249_11659240 | Ga0105249_116592401 | 212 |
| 204 | 3300013104 | Ga0157370_10005549 | Ga0157370_1000554911 | 212 |
| 205 | 3300013105 | Ga0157369_10090429 | Ga0157369_100904293 | 212 |
| 206 | 3300013296 | Ga0157374_10050379 | Ga0157374_100503792 | 212 |
| 207 | 3300013297 | Ga0157378_10559701 | Ga0157378_105597011 | 212 |
| 208 | 3300013306 | Ga0163162_10151780 | Ga0163162_101517802 | 212 |
| 209 | 3300013307 | Ga0157372_10063438 | Ga0157372_100634382 | 212 |
| 210 | 3300013307 | Ga0157372_10706813 | Ga0157372_107068131 | 212 |
| 211 | 3300013307 | Ga0157372_10729633 | Ga0157372_107296332 | 212 |
| 212 | 3300013308 | Ga0157375_10095874 | Ga0157375_100958742 | 212 |
| 213 | 3300013308 | Ga0157375_11317219 | Ga0157375_113172191 | 212 |
| 214 | 3300014325 | Ga0163163_10195332 | Ga0163163_101953323 | 212 |
| 215 | 3300014325 | Ga0163163_10208067 | Ga0163163_102080672 | 212 |
| 216 | 3300014325 | Ga0163163_10208290 | Ga0163163_102082903 | 212 |
| 217 | 3300014325 | Ga0163163_10522510 | Ga0163163_105225101 | 212 |
| 218 | 3300014326 | Ga0157380_10006312 | Ga0157380_100063125 | 212 |
| 219 | 3300014326 | Ga0157380_10244781 | Ga0157380_102447812 | 212 |
| 220 | 3300014968 | Ga0157379_10073255 | Ga0157379_100732552 | 212 |
| 221 | 3300014969 | Ga0157376_10141784 | Ga0157376_101417843 | 212 |
| 222 | 3300017792 | Ga0163161_10056126 | Ga0163161_100561263 | 212 |
| 223 | 3300021384 | Ga0213876_10009118 | Ga0213876_100091183 | 212 |
| 224 | 3300025321 | Ga0207656_10109969 | Ga0207656_101099691 | 212 |
| 225 | 3300025900 | Ga0207710_10000326 | Ga0207710_1000032611 | 212 |
| 226 | 3300025905 | Ga0207685_10120629 | Ga0207685_101206292 | 212 |
| 227 | 3300025909 | Ga0207705_10287674 | Ga0207705_102876741 | 212 |
| 228 | 3300025918 | Ga0207662_10043507 | Ga0207662_100435072 | 212 |
| 229 | 3300025918 | Ga0207662_10112057 | Ga0207662_101120572 | 212 |
| 230 | 3300025922 | Ga0207646_10470458 | Ga0207646_104704582 | 212 |
| 231 | 3300025923 | Ga0207681_10353734 | Ga0207681_103537342 | 212 |
| 232 | 3300025923 | Ga0207681_10372222 | Ga0207681_103722222 | 212 |
| 233 | 3300025923 | Ga0207681_10388018 | Ga0207681_103880182 | 212 |
| 234 | 3300025925 | Ga0207650_10220011 | Ga0207650_102200112 | 212 |
| 235 | 3300025925 | Ga0207650_10340414 | Ga0207650_103404142 | 212 |
| 236 | 3300025931 | Ga0207644_10400669 | Ga0207644_104006692 | 212 |
| 237 | 3300025934 | Ga0207686_10002599 | Ga0207686_100025998 | 212 |
| 238 | 3300025934 | Ga0207686_10090247 | Ga0207686_100902473 | 212 |
| 239 | 3300025934 | Ga0207686_10195797 | Ga0207686_101957972 | 212 |
| 240 | 3300025936 | Ga0207670_10034138 | Ga0207670_100341382 | 212 |
| 241 | 3300025936 | Ga0207670_10160957 | Ga0207670_101609572 | 212 |
| 242 | 3300025940 | Ga0207691_10023513 | Ga0207691_100235133 | 212 |
| 243 | 3300025942 | Ga0207689_10446124 | Ga0207689_104461242 | 212 |
| 244 | 3300025960 | Ga0207651_10282074 | Ga0207651_102820742 | 212 |
| 245 | 3300025960 | Ga0207651_10441380 | Ga0207651_104413802 | 212 |
| 246 | 3300025961 | Ga0207712_10004285 | Ga0207712_100042856 | 212 |
| 247 | 3300025961 | Ga0207712_10006820 | Ga0207712_100068205 | 212 |
| 248 | 3300025961 | Ga0207712_10104783 | Ga0207712_101047832 | 212 |
| 249 | 3300025972 | Ga0207668_10288128 | Ga0207668_102881282 | 212 |
| 250 | 3300025981 | Ga0207640_10605379 | Ga0207640_106053791 | 212 |
| 251 | 3300025986 | Ga0207658_10607924 | Ga0207658_106079241 | 212 |
| 252 | 3300026035 | Ga0207703_10019247 | Ga0207703_100192472 | 212 |
| 253 | 3300026041 | Ga0207639_10023235 | Ga0207639_100232355 | 212 |
| 254 | 3300026067 | Ga0207678_10091710 | Ga0207678_100917103 | 212 |
| 255 | 3300026088 | Ga0207641_10001198 | Ga0207641_100011986 | 212 |
| 256 | 3300026088 | Ga0207641_10074101 | Ga0207641_100741012 | 212 |
| 257 | 3300026088 | Ga0207641_10210178 | Ga0207641_102101781 | 212 |
| 258 | 3300026088 | Ga0207641_10254123 | Ga0207641_102541232 | 212 |
| 259 | 3300026089 | Ga0207648_10034587 | Ga0207648_100345872 | 212 |
| 260 | 3300026089 | Ga0207648_10876899 | Ga0207648_108768992 | 212 |
| 261 | 3300026095 | Ga0207676_10008331 | Ga0207676_100083318 | 212 |
| 262 | 3300026095 | Ga0207676_10016005 | Ga0207676_100160053 | 212 |
| 263 | 3300026095 | Ga0207676_10059421 | Ga0207676_100594212 | 212 |
| 264 | 3300026116 | Ga0207674_10131704 | Ga0207674_101317043 | 212 |
| 265 | 3300026116 | Ga0207674_10312051 | Ga0207674_103120512 | 212 |
| 266 | 3300026116 | Ga0207674_10566545 | Ga0207674_105665452 | 212 |
| 267 | 3300026116 | Ga0207674_10587069 | Ga0207674_105870691 | 212 |
| 268 | 3300026118 | Ga0207675_100000971 | Ga0207675_10000097125 | 212 |
| 269 | 3300026118 | Ga0207675_100961906 | Ga0207675_1009619061 | 212 |
| 270 | 3300026142 | Ga0207698_10235739 | Ga0207698_102357392 | 212 |
| 271 | 3300027907 | Ga0207428_10222012 | Ga0207428_102220121 | 212 |
| 272 | 3300028380 | Ga0268265_10682148 | Ga0268265_106821482 | 212 |
| 273 | 3300028380 | Ga0268265_11394825 | Ga0268265_113948251 | 212 |
| 274 | 3300039437 | Ga0436365_0096822 | Ga0436365_0096822_24_662 | 212 |
| 275 | 3300039437 | Ga0436365_0181465 | Ga0436365_0181465_2834_3550 | 212 |
| 276 | 3300042001 | Ga0439441_002825 | Ga0439441_002825_819_1457 | 212 |
| 277 | 3300042003 | Ga0439443_037078 | Ga0439443_037078_54_692 | 212 |
| 278 | 3300044712 | Ga0453684_0204002 | Ga0453684_0204002_674_1312 | 212 |
| 279 | 3300046537 | Ga0495598_0037005 | Ga0495598_0037005_634_1272 | 212 |
| 280 | 3300046539 | Ga0495621_0047946 | Ga0495621_0047946_194_832 | 212 |
| 281 | 3300047319 | Ga0495674_0213417 | Ga0495674_0213417_608_1246 | 212 |
| 282 | 3300047472 | Ga0495686_0016060 | Ga0495686_0016060_4155_4793 | 212 |
| 283 | 3300049573 | Ga0501037_0088581 | Ga0501037_0088581_540_1178 | 212 |
| 284 | 3300049823 | Ga0501044_0230406 | Ga0501044_0230406_702_1340 | 212 |
| 285 | 3300050493 | nmdc:mga0k408_11492_c1 | nmdc:mga0k408_11492_c1_3684_4322 | 212 |
| 286 | 3300050493 | nmdc:mga0k408_56786_c1 | nmdc:mga0k408_56786_c1_1094_1732 | 212 |
| 287 | 3300050508 | nmdc:mga09592_4183_c1 | nmdc:mga09592_4183_c1_7350_7988 | 212 |
| 288 | 3300050510 | nmdc:mga06r32_365488_c1 | nmdc:mga06r32_365488_c1_614_1252 | 212 |
| 289 | 3300050511 | nmdc:mga08y16_888628_c1 | nmdc:mga08y16_888628_c1_63_737 | 212 |
| 290 | 3300053727 | Ga0500611_000001 | Ga0500611_000001_312281_312919 | 212 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4b21-assembly1.cif.gz_A | unprecedented sculpting of dna at abasic sites by dna glycosylase homolog mag2 | 0.9182 | 8 | 199 |
| 3s6i-assembly1.cif.gz_A | schizosaccaromyces pombe 3-methyladenine dna glycosylase (mag1) in complex with abasic-dna. | 0.903 | 13 | 199 |
| 4ejz-assembly2.cif.gz_B | structure of mbogg1 in complex with low affinity dna ligand | 0.8778 | 10 | 207 |
| 1n3c-assembly1.cif.gz_A | structural and biochemical exploration of a critical amino acid in human 8-oxoguanine glycosylase | 0.8627 | 11 | 204 |
| 2noh-assembly1.cif.gz_A | structure of catalytically inactive q315a human 8-oxoguanine glycosylase complexed to 8-oxoguanine dna | 0.8597 | 10 | 204 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_B4FZ58_120_231_1.10.340.30 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.9429 | 42 | 150 | 1.10.340.30 |
| 4ejzB02 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.9305 | 43 | 150 | 1.10.340.30 |
| 4b24A02 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.9297 | 43 | 150 | 1.10.340.30 |
| 2h56B02 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.9223 | 39 | 141 | 1.10.340.30 |
| 2yg8A02 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.9182 | 43 | 145 | 1.10.340.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-G8T8U7-F1-model_v4 | DNA-3-methyladenine glycosylase II (EC 3.2.2.21) | 0.9944 | 2 | 210 |
GO:0005737
GO:0006285 GO:0006307 GO:0008725 GO:0032131 GO:0032993 GO:0043916 |
| AF-A0A4Q3RRN0-F1-model_v4 | DNA-3-methyladenine glycosylase II (EC 3.2.2.21) | 0.9926 | 3 | 210 |
GO:0005737
GO:0006285 GO:0006307 GO:0008725 GO:0032131 GO:0032993 GO:0043916 |
| AF-G8T8U7-F1-model_v4 | DNA-3-methyladenine glycosylase II (EC 3.2.2.21) | 0.9897 | 2 | 210 |
GO:0005737
GO:0006285 GO:0006307 GO:0008725 GO:0032131 GO:0032993 GO:0043916 |
| AF-A0A2W2B4X4-F1-model_v4 | DNA-3-methyladenine glycosylase II (EC 3.2.2.21) | 0.9886 | 1 | 208 |
GO:0005737
GO:0006285 GO:0006307 GO:0008725 GO:0032131 GO:0032993 GO:0043916 |
| AF-M3HXD7-F1-model_v4 | DNA-3-methyladenine glycosylase II (EC 3.2.2.21) | 0.9872 | 1 | 170 |
GO:0005737
GO:0006285 GO:0006307 GO:0008725 GO:0032131 GO:0032993 GO:0043916 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar