F389684

General Info

Members Datasets Scaffolds Average Seq Length
290 160 580 89

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10013842|Ga0075365_100138425
Length 102
Sequence MGLMIDPPAVPSRGRLWSHLASDTSYDELHAFARELGIPERGFDRDHYDVPAEYYDTVVGLGVQEVSSRELVTRLVAAGLRRRKAQEIHRVPGESGASPLKD

Samples

Sample ID Description Type Environment
1 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
45 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
66 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
68 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
69 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
70 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
71 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
72 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
73 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
76 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
77 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
84 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
85 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
86 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
87 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
88 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
89 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
90 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
91 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
92 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
93 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
94 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
95 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
96 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
97 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
98 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
99 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
100 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
101 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
102 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
103 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
104 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
105 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
106 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
107 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
108 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
109 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
110 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
111 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
112 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
113 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
114 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
115 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
116 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
130 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
131 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
132 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
133 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
134 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
135 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
136 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
137 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
138 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
139 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
140 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
142 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
143 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
144 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
145 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
146 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
147 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
150 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
151 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
152 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
153 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
154 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
155 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
156 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
157 2643221561 Nocardioides sp. Root151 Isolate Unclassified
158 2643221696 Nocardioides sp. Root140 Isolate Unclassified
159 2739367898 Nocardioides sp. CF479 Isolate Unclassified
160 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.62
Metatranscriptomes 0
Isolates 1.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.21
Nodule 0
Rhizoplane 4.14
Rhizosphere 64.83
Stem 0
Stem Tuber 0
Unclassified 0.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075365_10013842 3300006038 Bacteria 4839
2 Ga0070658_10337010 3300005327 Bacteria 1290
3 Ga0070683_100039569 3300005329 Bacteria 4330
4 Ga0070683_100096559 3300005329 Bacteria 2780
5 Ga0070683_100981784 3300005329 Bacteria 811
6 Ga0068868_100975991 3300005338 Bacteria 774
7 Ga0070660_100789647 3300005339 Bacteria 798
8 Ga0070689_102136546 3300005340 Bacteria 513
9 Ga0070668_102154802 3300005347 Bacteria 515
10 Ga0070659_101061605 3300005366 Bacteria 713
11 Ga0070667_100042882 3300005367 Bacteria 3796
12 Ga0070708_100172293 3300005445 Bacteria 2021
13 Ga0070663_100033278 3300005455 Bacteria 3560
14 Ga0070707_100031430 3300005468 Bacteria 5058
15 Ga0070698_100000212 3300005471 Bacteria 56550
16 Ga0070679_100675871 3300005530 Bacteria 975
17 Ga0070684_101085172 3300005535 Bacteria 752
18 Ga0070697_101525686 3300005536 Bacteria 597
19 Ga0068853_100838751 3300005539 Bacteria 881
20 Ga0070672_100468361 3300005543 Bacteria 1087
21 Ga0070664_100057331 3300005564 Bacteria 3311
22 Ga0070664_100588531 3300005564 Bacteria 1031
23 Ga0070664_100656261 3300005564 Bacteria 975
24 Ga0068852_101243880 3300005616 Bacteria 766
25 Ga0068864_100818798 3300005618 Bacteria 916
26 Ga0068866_10770962 3300005718 Bacteria 666
27 Ga0068861_100277506 3300005719 Bacteria 1442
28 Ga0068870_10947452 3300005840 Bacteria 611
29 Ga0075365_10017692 3300006038 Bacteria 4368
30 Ga0075365_10134180 3300006038 Bacteria 1715
31 Ga0075365_10170368 3300006038 Bacteria 1519
32 Ga0075365_10413862 3300006038 Bacteria 952
33 Ga0075365_10451319 3300006038 Bacteria 908
34 Ga0075365_10745843 3300006038 Bacteria 691
35 Ga0075368_10012198 3300006042 Bacteria 3138
36 Ga0075368_10026403 3300006042 Bacteria 2233
37 Ga0075368_10203966 3300006042 Bacteria 837
38 Ga0075368_10349839 3300006042 Bacteria 643
39 Ga0075368_10513390 3300006042 Bacteria 536
40 Ga0075363_100001511 3300006048 Bacteria 8880
41 Ga0075363_100021929 3300006048 Bacteria 3224
42 Ga0075363_100040035 3300006048 Bacteria 2469
43 Ga0075363_100074409 3300006048 Bacteria 1849
44 Ga0075363_100160998 3300006048 Bacteria 1271
45 Ga0075364_10105937 3300006051 Bacteria 1873
46 Ga0075364_10117697 3300006051 Bacteria 1777
47 Ga0075364_10197423 3300006051 Bacteria 1363
48 Ga0075364_10200986 3300006051 Bacteria 1351
49 Ga0075367_10079804 3300006178 Bacteria 1978
50 Ga0075367_10085807 3300006178 Bacteria 1910
51 Ga0075367_10101266 3300006178 Bacteria 1761
52 Ga0075367_10136107 3300006178 Bacteria 1520
53 Ga0075367_10216348 3300006178 Bacteria 1199
54 Ga0075370_10049284 3300006353 Bacteria 2387
55 Ga0075370_10154484 3300006353 Bacteria 1345
56 Ga0075370_10265809 3300006353 Bacteria 1018
57 Ga0075370_10510594 3300006353 Bacteria 726
58 Ga0075428_100180414 3300006844 Bacteria 2286
59 Ga0111539_10013583 3300009094 Bacteria 10181
60 Ga0111539_12136781 3300009094 Bacteria 650
61 Ga0105245_11898485 3300009098 Bacteria 649
62 Ga0105243_10450288 3300009148 Bacteria 1208
63 Ga0105242_11586302 3300009176 Bacteria 688
64 Ga0105248_12127249 3300009177 Bacteria 638
65 Ga0105238_12745536 3300009551 Bacteria 529
66 Ga0105239_10114878 3300010375 Bacteria 2986
67 Ga0105246_11166099 3300011119 Bacteria 707
68 Ga0157369_11496708 3300013105 Bacteria 687
69 Ga0157374_11936202 3300013296 Bacteria 615
70 Ga0163162_13480526 3300013306 Bacteria 501
71 Ga0157375_10086476 3300013308 Bacteria 3186
72 Ga0163163_10231509 3300014325 Bacteria 1897
73 Ga0163163_11806462 3300014325 Bacteria 672
74 Ga0163161_10121654 3300017792 Bacteria 1962
75 Ga0207643_10313621 3300025908 Bacteria 978
76 Ga0207705_10238843 3300025909 Bacteria 1384
77 Ga0207654_10530450 3300025911 Bacteria 834
78 Ga0207657_10141193 3300025919 Bacteria 1968
79 Ga0207657_10282098 3300025919 Unclassified 1318
80 Ga0207652_11345669 3300025921 Bacteria 617
81 Ga0207646_10927767 3300025922 Bacteria 771
82 Ga0207706_10061149 3300025933 Bacteria 3317
83 Ga0207709_11145915 3300025935 Bacteria 640
84 Ga0207670_11015385 3300025936 Bacteria 698
85 Ga0207704_11254922 3300025938 Bacteria 633
86 Ga0207691_11531149 3300025940 Bacteria 544
87 Ga0207661_10037788 3300025944 Bacteria 3779
88 Ga0207661_10065881 3300025944 Bacteria 2941
89 Ga0207661_10715348 3300025944 Bacteria 921
90 Ga0207679_10039660 3300025945 Bacteria 3365
91 Ga0207640_10273034 3300025981 Bacteria 1324
92 Ga0207658_10045872 3300025986 Bacteria 3188
93 Ga0207677_10123331 3300026023 Bacteria 1953
94 Ga0207639_11318156 3300026041 Bacteria 678
95 Ga0207678_10050887 3300026067 Bacteria 3578
96 Ga0207674_11449473 3300026116 Unclassified 656
97 Ga0207675_100315518 3300026118 Bacteria 1525
98 Ga0209813_10315206 3300027866 Bacteria 611
99 Ga0268266_10001692 3300028379 Bacteria 25320
100 Ga0307408_102508888 3300031548 Bacteria 501
101 Ga0307405_10783798 3300031731 Bacteria 797
102 Ga0307413_11327770 3300031824 Bacteria 630
103 Ga0307410_10404294 3300031852 Bacteria 1104
104 Ga0307410_10651603 3300031852 Bacteria 883
105 Ga0307410_10682268 3300031852 Bacteria 864
106 Ga0307406_10369502 3300031901 Bacteria 1127
107 Ga0307406_10553682 3300031901 Bacteria 941
108 Ga0307407_10202224 3300031903 Bacteria 1332
109 Ga0307407_10241670 3300031903 Bacteria 1232
110 Ga0307407_10352115 3300031903 Bacteria 1043
111 Ga0307412_10341546 3300031911 Bacteria 1199
112 Ga0307412_12159067 3300031911 Bacteria 518
113 Ga0307409_100082796 3300031995 Bacteria 2599
114 Ga0307409_101470094 3300031995 Bacteria 708
115 Ga0307409_102195040 3300031995 Bacteria 582
116 Ga0307409_102769079 3300031995 Bacteria 518
117 Ga0307416_100243262 3300032002 Bacteria 1745
118 Ga0307416_101646349 3300032002 Bacteria 747
119 Ga0307416_102785832 3300032002 Bacteria 585
120 Ga0307414_10450353 3300032004 Bacteria 1129
121 Ga0307411_10279088 3300032005 Bacteria 1329
122 Ga0307411_10881478 3300032005 Bacteria 794
123 Ga0307411_11132994 3300032005 Bacteria 707
124 Ga0307415_100755043 3300032126 Bacteria 883
125 Ga0307415_101962705 3300032126 Bacteria 569
126 Ga0373931_0223860 3300035691 Bacteria 1134
127 Ga0395900_1502750 3300037418 Bacteria 586
128 Ga0395898_0074637 3300037466 Bacteria 3275
129 Ga0395901_0048078 3300038443 Bacteria 4430
130 Ga0436365_1606392 3300039437 Bacteria 924
131 Ga0451791_1129268 3300041451 Bacteria 706
132 Ga0451791_1412988 3300041451 Bacteria 907
133 Ga0451797_0040318 3300041453 Bacteria 1384
134 Ga0451800_1555774 3300041459 Bacteria 654
135 Ga0451833_0290654 3300041491 Bacteria 536
136 Ga0451833_1460417 3300041491 Bacteria 514
137 Ga0451837_1030905 3300041494 Bacteria 1118
138 Ga0451839_1618385 3300041496 Bacteria 688
139 Ga0451841_0952380 3300041498 Bacteria 675
140 Ga0451851_1018760 3300041507 Bacteria 504
141 Ga0451843_1398705 3300041509 Bacteria 2011
142 Ga0451853_2450136 3300041512 Bacteria 675
143 Ga0451853_4012235 3300041512 Bacteria 641
144 Ga0466969_0288635 3300044656 Bacteria 742
145 Ga0466972_0068612 3300044658 Bacteria 1694
146 Ga0466966_0030171 3300044684 Bacteria 3522
147 Ga0466966_0086713 3300044684 Bacteria 1946
148 Ga0466961_0001588 3300044693 Bacteria 14082
149 Ga0466961_0122507 3300044693 Bacteria 1632
150 Ga0466961_0401225 3300044693 Bacteria 832
151 Ga0466963_0007128 3300044694 Bacteria 6661
152 Ga0466963_0013136 3300044694 Bacteria 5080
153 Ga0466963_0028244 3300044694 Bacteria 3600
154 Ga0466963_0133660 3300044694 Bacteria 1715
155 Ga0466963_0211551 3300044694 Bacteria 1357
156 Ga0466963_0707952 3300044694 Bacteria 711
157 Ga0466964_0051335 3300044706 Bacteria 1693
158 Ga0466964_0226053 3300044706 Bacteria 911
159 Ga0466964_0279220 3300044706 Bacteria 834
160 Ga0466971_0451524 3300044719 Bacteria 630
161 Ga0466968_0232155 3300044735 Bacteria 872
162 Ga0466968_0295986 3300044735 Bacteria 777
163 Ga0466957_0187331 3300044842 Bacteria 1354
164 Ga0466957_0961832 3300044842 Bacteria 612
165 Ga0466960_0033447 3300044901 Bacteria 2389
166 Ga0466960_0102423 3300044901 Bacteria 1476
167 Ga0466960_0240241 3300044901 Bacteria 1003
168 Ga0466960_0768801 3300044901 Bacteria 581
169 Ga0466959_0512023 3300045049 Bacteria 811
170 Ga0466958_0471204 3300045836 Bacteria 814
171 Ga0466967_0006252 3300045976 Bacteria 8399
172 Ga0466967_0143109 3300045976 Bacteria 2228
173 Ga0466967_0180461 3300045976 Bacteria 1991
174 Ga0466967_0302078 3300045976 Bacteria 1540
175 Ga0466967_0378239 3300045976 Bacteria 1374
176 Ga0466967_0935128 3300045976 Bacteria 862
177 Ga0495653_0032020 3300046463 Bacteria 4178
178 Ga0495677_0315838 3300047445 Bacteria 615
179 Ga0496102_0647754 3300048905 Bacteria 980
180 Ga0496105_0634111 3300048908 Bacteria 826
181 Ga0496107_0124861 3300048910 Bacteria 1898
182 Ga0496109_1040009 3300048912 Bacteria 756
183 Ga0496109_1274563 3300048912 Bacteria 671
184 Ga0496110_0255911 3300048913 Bacteria 1594
185 Ga0496111_0800843 3300048914 Bacteria 682
186 Ga0496114_0336117 3300048917 Bacteria 1335
187 Ga0501032_0021305 3300049569 Bacteria 4507
188 Ga0501033_0016255 3300049570 Bacteria 5636
189 Ga0501033_0328679 3300049570 Bacteria 1073
190 Ga0501034_0078435 3300049571 Bacteria 3307
191 Ga0501034_0794488 3300049571 Bacteria 839
192 Ga0501036_0010876 3300049572 Bacteria 7519
193 Ga0501036_0215449 3300049572 Bacteria 1613
194 Ga0501037_0000627 3300049573 Bacteria 27381
195 Ga0501038_0013480 3300049574 Bacteria 7452
196 Ga0501039_0057782 3300049575 Bacteria 3004
197 Ga0501039_0174367 3300049575 Bacteria 1691
198 Ga0501040_0372666 3300049576 Bacteria 1024
199 Ga0501040_0913355 3300049576 Bacteria 636
200 Ga0501042_0023404 3300049578 Bacteria 4323
201 Ga0501042_0562189 3300049578 Bacteria 829
202 Ga0501042_0578045 3300049578 Bacteria 817
203 Ga0501043_0007390 3300049579 Bacteria 8717
204 Ga0501043_0663908 3300049579 Bacteria 764
205 Ga0501046_0000919 3300049580 Bacteria 28877
206 Ga0501046_0003412 3300049580 Bacteria 14588
207 Ga0501047_0013113 3300049581 Bacteria 7849
208 Ga0501047_0650919 3300049581 Bacteria 873
209 Ga0501048_0018189 3300049582 Bacteria 5170
210 Ga0501048_0215009 3300049582 Bacteria 1363
211 Ga0501067_0020455 3300049583 Bacteria 3664
212 Ga0501067_0076061 3300049583 Bacteria 1860
213 Ga0501067_0115178 3300049583 Bacteria 1495
214 Ga0501068_0664532 3300049584 Bacteria 681
215 Ga0501068_1137698 3300049584 Bacteria 517
216 Ga0501069_0086657 3300049585 Bacteria 1768
217 Ga0501069_0196924 3300049585 Bacteria 1167
218 Ga0501069_0490982 3300049585 Bacteria 732
219 Ga0501069_0603009 3300049585 Bacteria 659
220 Ga0501070_0158954 3300049586 Bacteria 1863
221 Ga0501070_0228140 3300049586 Bacteria 1526
222 Ga0501071_1241231 3300049587 Bacteria 576
223 Ga0501073_0062106 3300049589 Bacteria 2606
224 Ga0501073_0805150 3300049589 Bacteria 647
225 Ga0501074_0973976 3300049590 Bacteria 596
226 Ga0501076_1428294 3300049592 Bacteria 568
227 Ga0501079_0298587 3300049741 Bacteria 1260
228 Ga0501079_0534245 3300049741 Bacteria 922
229 Ga0501080_0018090 3300049742 Bacteria 6524
230 Ga0501083_0605260 3300049744 Bacteria 713
231 Ga0501035_0023525 3300049822 Bacteria 5652
232 Ga0501035_0957244 3300049822 Bacteria 675
233 Ga0501044_0304528 3300049823 Bacteria 1521
234 Ga0501044_0413376 3300049823 Bacteria 1260
235 nmdc:mga03n38_119008_c1 3300050490 Bacteria 1296
236 nmdc:mga03n38_18958_c1 3300050490 Bacteria 2724
237 nmdc:mga03n38_465913_c1 3300050490 Bacteria 705
238 nmdc:mga03n38_490390_c1 3300050490 Bacteria 688
239 nmdc:mga03n38_63443_c1 3300050490 Bacteria 1688
240 nmdc:mga03n38_802127_c1 3300050490 Bacteria 548
241 nmdc:mga03n38_827033_c1 3300050490 Bacteria 540
242 nmdc:mga03n38_83879_c1 3300050490 Bacteria 1503
243 nmdc:mga00v17_119457_c1 3300050491 Bacteria 1677
244 nmdc:mga00v17_154573_c1 3300050491 Bacteria 1475
245 nmdc:mga00v17_170984_c1 3300050491 Bacteria 1401
246 nmdc:mga00v17_256504_c1 3300050491 Bacteria 1134
247 nmdc:mga00v17_45071_c1 3300050491 Bacteria 2663
248 nmdc:mga00v17_587518_c1 3300050491 Bacteria 719
249 nmdc:mga00v17_844286_c1 3300050491 Bacteria 582
250 nmdc:mga0yw44_1008901_c1 3300050492 Bacteria 563
251 nmdc:mga0yw44_1029604_c1 3300050492 Bacteria 557
252 nmdc:mga0yw44_108307_c1 3300050492 Bacteria 1778
253 nmdc:mga0yw44_119053_c1 3300050492 Bacteria 1700
254 nmdc:mga0yw44_178619_c1 3300050492 Bacteria 1396
255 nmdc:mga0yw44_331720_c1 3300050492 Bacteria 1022
256 nmdc:mga0yw44_35934_c1 3300050492 Bacteria 2916
257 nmdc:mga0yw44_365974_c1 3300050492 Bacteria 972
258 nmdc:mga0yw44_384555_c1 3300050492 Bacteria 948
259 nmdc:mga0yw44_407854_c1 3300050492 Bacteria 919
260 nmdc:mga0yw44_70917_c1 3300050492 Bacteria 2162
261 nmdc:mga0yw44_78481_c1 3300050492 Bacteria 2065
262 nmdc:mga0yw44_80377_c1 3300050492 Bacteria 2042
263 nmdc:mga06z11_365254_c1 3300050494 Bacteria 866
264 nmdc:mga06z11_48479_c1 3300050494 Bacteria 2162
265 nmdc:mga06z11_567474_c1 3300050494 Bacteria 690
266 nmdc:mga06z11_568722_c1 3300050494 Bacteria 689
267 nmdc:mga06z11_676330_c1 3300050494 Bacteria 629
268 nmdc:mga04h51_188066_c1 3300050495 Bacteria 807
269 nmdc:mga04h51_193285_c1 3300050495 Bacteria 797
270 nmdc:mga04h51_349844_c1 3300050495 Bacteria 611
271 nmdc:mga04h51_87690_c1 3300050495 Bacteria 1115
272 nmdc:mga07m45_24364_c1 3300050496 Bacteria 2288
273 nmdc:mga07m45_552591_c1 3300050496 Bacteria 666
274 nmdc:mga07m45_575447_c1 3300050496 Bacteria 651
275 nmdc:mga07m45_76409_c1 3300050496 Bacteria 1909
276 nmdc:mga08y16_224550_c1 3300050511 Bacteria 1944
277 Ga0500644_0001106 3300053088 Bacteria 7945
278 Ga0500641_0225514 3300053096 Bacteria 793
279 Ga0500554_053233 3300053102 Bacteria 1280
280 Ga0500573_0035842 3300053140 Bacteria 2864
281 Ga0501084_0301562 3300054114 Bacteria 1353
282 Ga0501082_0978964 3300060353 Bacteria 740
283 Ga0501082_1877119 3300060353 Bacteria 522
284 Ga0466962_0178758 3300061719 Bacteria 1034
285 Ga0530510_0561011 3300061734 Bacteria 868
286 Ga0530510_1300440 3300061734 Bacteria 558
287 2643827606 2643221561 Bacteria 4984412
288 2644534848 2643221696 Bacteria 5431823
289 2740169276 2739367898 Bacteria 4367674
290 2774396337 2773857762 Bacteria 5971770
291 Ga0075365_10013842
292 Ga0070658_10337010
293 Ga0070683_100039569
294 Ga0070683_100096559
295 Ga0070683_100981784
296 Ga0068868_100975991
297 Ga0070660_100789647
298 Ga0070689_102136546
299 Ga0070668_102154802
300 Ga0070659_101061605
301 Ga0070667_100042882
302 Ga0070708_100172293
303 Ga0070663_100033278
304 Ga0070707_100031430
305 Ga0070698_100000212
306 Ga0070679_100675871
307 Ga0070684_101085172
308 Ga0070697_101525686
309 Ga0068853_100838751
310 Ga0070672_100468361
311 Ga0070664_100057331
312 Ga0070664_100588531
313 Ga0070664_100656261
314 Ga0068852_101243880
315 Ga0068864_100818798
316 Ga0068866_10770962
317 Ga0068861_100277506
318 Ga0068870_10947452
319 Ga0075365_10017692
320 Ga0075365_10134180
321 Ga0075365_10170368
322 Ga0075365_10413862
323 Ga0075365_10451319
324 Ga0075365_10745843
325 Ga0075368_10012198
326 Ga0075368_10026403
327 Ga0075368_10203966
328 Ga0075368_10349839
329 Ga0075368_10513390
330 Ga0075363_100001511
331 Ga0075363_100021929
332 Ga0075363_100040035
333 Ga0075363_100074409
334 Ga0075363_100160998
335 Ga0075364_10105937
336 Ga0075364_10117697
337 Ga0075364_10197423
338 Ga0075364_10200986
339 Ga0075367_10079804
340 Ga0075367_10085807
341 Ga0075367_10101266
342 Ga0075367_10136107
343 Ga0075367_10216348
344 Ga0075370_10049284
345 Ga0075370_10154484
346 Ga0075370_10265809
347 Ga0075370_10510594
348 Ga0075428_100180414
349 Ga0111539_10013583
350 Ga0111539_12136781
351 Ga0105245_11898485
352 Ga0105243_10450288
353 Ga0105242_11586302
354 Ga0105248_12127249
355 Ga0105238_12745536
356 Ga0105239_10114878
357 Ga0105246_11166099
358 Ga0157369_11496708
359 Ga0157374_11936202
360 Ga0163162_13480526
361 Ga0157375_10086476
362 Ga0163163_10231509
363 Ga0163163_11806462
364 Ga0163161_10121654
365 Ga0207643_10313621
366 Ga0207705_10238843
367 Ga0207654_10530450
368 Ga0207657_10141193
369 Ga0207657_10282098
370 Ga0207652_11345669
371 Ga0207646_10927767
372 Ga0207706_10061149
373 Ga0207709_11145915
374 Ga0207670_11015385
375 Ga0207704_11254922
376 Ga0207691_11531149
377 Ga0207661_10037788
378 Ga0207661_10065881
379 Ga0207661_10715348
380 Ga0207679_10039660
381 Ga0207640_10273034
382 Ga0207658_10045872
383 Ga0207677_10123331
384 Ga0207639_11318156
385 Ga0207678_10050887
386 Ga0207674_11449473
387 Ga0207675_100315518
388 Ga0209813_10315206
389 Ga0268266_10001692
390 Ga0307408_102508888
391 Ga0307405_10783798
392 Ga0307413_11327770
393 Ga0307410_10404294
394 Ga0307410_10651603
395 Ga0307410_10682268
396 Ga0307406_10369502
397 Ga0307406_10553682
398 Ga0307407_10202224
399 Ga0307407_10241670
400 Ga0307407_10352115
401 Ga0307412_10341546
402 Ga0307412_12159067
403 Ga0307409_100082796
404 Ga0307409_101470094
405 Ga0307409_102195040
406 Ga0307409_102769079
407 Ga0307416_100243262
408 Ga0307416_101646349
409 Ga0307416_102785832
410 Ga0307414_10450353
411 Ga0307411_10279088
412 Ga0307411_10881478
413 Ga0307411_11132994
414 Ga0307415_100755043
415 Ga0307415_101962705
416 Ga0373931_0223860
417 Ga0395900_1502750
418 Ga0395898_0074637
419 Ga0395901_0048078
420 Ga0436365_1606392
421 Ga0451791_1129268
422 Ga0451791_1412988
423 Ga0451797_0040318
424 Ga0451800_1555774
425 Ga0451833_0290654
426 Ga0451833_1460417
427 Ga0451837_1030905
428 Ga0451839_1618385
429 Ga0451841_0952380
430 Ga0451851_1018760
431 Ga0451843_1398705
432 Ga0451853_2450136
433 Ga0451853_4012235
434 Ga0466969_0288635
435 Ga0466972_0068612
436 Ga0466966_0030171
437 Ga0466966_0086713
438 Ga0466961_0001588
439 Ga0466961_0122507
440 Ga0466961_0401225
441 Ga0466963_0007128
442 Ga0466963_0013136
443 Ga0466963_0028244
444 Ga0466963_0133660
445 Ga0466963_0211551
446 Ga0466963_0707952
447 Ga0466964_0051335
448 Ga0466964_0226053
449 Ga0466964_0279220
450 Ga0466971_0451524
451 Ga0466968_0232155
452 Ga0466968_0295986
453 Ga0466957_0187331
454 Ga0466957_0961832
455 Ga0466960_0033447
456 Ga0466960_0102423
457 Ga0466960_0240241
458 Ga0466960_0768801
459 Ga0466959_0512023
460 Ga0466958_0471204
461 Ga0466967_0006252
462 Ga0466967_0143109
463 Ga0466967_0180461
464 Ga0466967_0302078
465 Ga0466967_0378239
466 Ga0466967_0935128
467 Ga0495653_0032020
468 Ga0495677_0315838
469 Ga0496102_0647754
470 Ga0496105_0634111
471 Ga0496107_0124861
472 Ga0496109_1040009
473 Ga0496109_1274563
474 Ga0496110_0255911
475 Ga0496111_0800843
476 Ga0496114_0336117
477 Ga0501032_0021305
478 Ga0501033_0016255
479 Ga0501033_0328679
480 Ga0501034_0078435
481 Ga0501034_0794488
482 Ga0501036_0010876
483 Ga0501036_0215449
484 Ga0501037_0000627
485 Ga0501038_0013480
486 Ga0501039_0057782
487 Ga0501039_0174367
488 Ga0501040_0372666
489 Ga0501040_0913355
490 Ga0501042_0023404
491 Ga0501042_0562189
492 Ga0501042_0578045
493 Ga0501043_0007390
494 Ga0501043_0663908
495 Ga0501046_0000919
496 Ga0501046_0003412
497 Ga0501047_0013113
498 Ga0501047_0650919
499 Ga0501048_0018189
500 Ga0501048_0215009
501 Ga0501067_0020455
502 Ga0501067_0076061
503 Ga0501067_0115178
504 Ga0501068_0664532
505 Ga0501068_1137698
506 Ga0501069_0086657
507 Ga0501069_0196924
508 Ga0501069_0490982
509 Ga0501069_0603009
510 Ga0501070_0158954
511 Ga0501070_0228140
512 Ga0501071_1241231
513 Ga0501073_0062106
514 Ga0501073_0805150
515 Ga0501074_0973976
516 Ga0501076_1428294
517 Ga0501079_0298587
518 Ga0501079_0534245
519 Ga0501080_0018090
520 Ga0501083_0605260
521 Ga0501035_0023525
522 Ga0501035_0957244
523 Ga0501044_0304528
524 Ga0501044_0413376
525 nmdc:mga03n38_119008_c1
526 nmdc:mga03n38_18958_c1
527 nmdc:mga03n38_465913_c1
528 nmdc:mga03n38_490390_c1
529 nmdc:mga03n38_63443_c1
530 nmdc:mga03n38_802127_c1
531 nmdc:mga03n38_827033_c1
532 nmdc:mga03n38_83879_c1
533 nmdc:mga00v17_119457_c1
534 nmdc:mga00v17_154573_c1
535 nmdc:mga00v17_170984_c1
536 nmdc:mga00v17_256504_c1
537 nmdc:mga00v17_45071_c1
538 nmdc:mga00v17_587518_c1
539 nmdc:mga00v17_844286_c1
540 nmdc:mga0yw44_1008901_c1
541 nmdc:mga0yw44_1029604_c1
542 nmdc:mga0yw44_108307_c1
543 nmdc:mga0yw44_119053_c1
544 nmdc:mga0yw44_178619_c1
545 nmdc:mga0yw44_331720_c1
546 nmdc:mga0yw44_35934_c1
547 nmdc:mga0yw44_365974_c1
548 nmdc:mga0yw44_384555_c1
549 nmdc:mga0yw44_407854_c1
550 nmdc:mga0yw44_70917_c1
551 nmdc:mga0yw44_78481_c1
552 nmdc:mga0yw44_80377_c1
553 nmdc:mga06z11_365254_c1
554 nmdc:mga06z11_48479_c1
555 nmdc:mga06z11_567474_c1
556 nmdc:mga06z11_568722_c1
557 nmdc:mga06z11_676330_c1
558 nmdc:mga04h51_188066_c1
559 nmdc:mga04h51_193285_c1
560 nmdc:mga04h51_349844_c1
561 nmdc:mga04h51_87690_c1
562 nmdc:mga07m45_24364_c1
563 nmdc:mga07m45_552591_c1
564 nmdc:mga07m45_575447_c1
565 nmdc:mga07m45_76409_c1
566 nmdc:mga08y16_224550_c1
567 Ga0500644_0001106
568 Ga0500641_0225514
569 Ga0500554_053233
570 Ga0500573_0035842
571 Ga0501084_0301562
572 Ga0501082_0978964
573 Ga0501082_1877119
574 Ga0466962_0178758
575 Ga0530510_0561011
576 Ga0530510_1300440
577 2643827606
578 2644534848
579 2740169276
580 2774396337

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13223

DUF4031

Protein of unknown function (DUF4031)

3

78

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1d1r-assembly1.cif.gz_A nmr solution structure of the product of the e. coli ycih gene. 0.5663 3 68
3cq5-assembly1.cif.gz_B histidinol-phosphate aminotransferase from corynebacterium glutamicum in complex with pmp 0.4823 3 61
1d1r-assembly1.cif.gz_A nmr solution structure of the product of the e. coli ycih gene. 0.4777 3 68
4xgw-assembly2.cif.gz_B crystal structure of escherichia coli flavin trafficking protein, an fmn transferase, e169k mutant 0.4522 1 37
5btx-assembly2.cif.gz_B structure of the n-terminal domain of lpg1496 from legionella pneumophila in complex with nucleotide 0.4476 1 52
ID Description Score Start End Superfamily
af_Q9M2H6_6_133_2.60.210.10 Mainly Beta;Sandwich;Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A;Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 0.7018 1 27 2.60.210.10
af_A0A1X7YIP2_29_164_2.60.210.10 Mainly Beta;Sandwich;Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A;Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 0.6394 3 26 2.60.210.10
af_Q5A102_4_110_3.40.1170.10 Alpha Beta;3-Layer(aba) Sandwich;MutS, DNA mismatch repair protein, domain I;DNA repair protein MutS, domain I 0.6367 2 60 3.40.1170.10
af_A0A0P0XUZ3_1_113_2.60.210.10 Mainly Beta;Sandwich;Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A;Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 0.5992 3 22 2.60.210.10
af_Q9NAH4_107_185_3.30.780.10 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor Eif1;SUI1-like domain 0.5801 4 60 3.30.780.10
ID Description Score Start End GO Terms
AF-A0A6M1QZQ3-F1-model_v4 DUF4031 domain-containing protein 1.004 3 86 GO:0016020
AF-A0A239QRV2-F1-model_v4 Predicted metal-dependent phosphohydrolase, HD superfamily 1.003 1 83 GO:0016787
AF-A0A5D0TLW7-F1-model_v4 DUF4031 domain-containing protein 1.003 3 84
AF-A0A2S6ITA4-F1-model_v4 Uncharacterized protein DUF4031 1.002 1 85
AF-A0A7W0XUH8-F1-model_v4 DUF4031 domain-containing protein 1.002 1 84 GO:0016747

Map