F389679
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 290 | 217 | 288 | 176 |
Family's Representative Sequence
| Representative Sequence | 3300005937|Ga0081455_10171415|Ga0081455_101714152 |
| Length | 184 |
| Sequence | MAKFTVNVNPMRFDPYKNFKFRVKWGANGYVAGISKVSALKRTTEMVEHREGGDPSSSHKSPGRTKYEPITMERGVTHDPEFEAWANKVWNFGNAQAEADQRQKEVSLKDFRRNLTIDVFNEAGQKVISYKVYRAWVSEFTAQADLDANANAILIQSIKIEHEGWERDTSVKEPAEPQFDDVGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 2 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 3 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 4 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 46 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 51 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 52 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 53 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 54 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 55 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 56 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 57 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 58 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 59 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 60 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 61 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 79 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 80 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 82 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 83 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 84 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 85 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 132 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 133 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 134 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 135 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 136 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 137 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 138 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 139 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 140 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 141 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 142 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 143 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 144 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 145 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 146 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 147 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 148 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 149 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 150 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 151 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 152 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 153 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 154 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 155 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 156 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 157 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 158 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 184 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 185 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 186 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 187 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 188 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 189 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 190 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 191 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 192 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 193 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 194 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 195 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 196 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 197 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 198 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 199 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 200 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 201 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 205 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 206 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 207 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 208 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 209 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 210 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 211 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 212 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 213 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 215 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 217 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.97 |
| Metatranscriptomes | 0.34 |
| Isolates | 0.69 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.97 |
| Nodule | 0 |
| Rhizoplane | 7.59 |
| Rhizosphere | 78.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25150J39212_1019197 | 3300002774 | Bacteria | 1075 |
| 2 | JGI25151J46595_10087266 | 3300003187 | Bacteria | 881 |
| 3 | Ga0058862_10092682 | 3300004803 | Bacteria | 1372 |
| 4 | Ga0065712_10416286 | 3300005290 | Bacteria | 702 |
| 5 | Ga0065712_10434610 | 3300005290 | Bacteria | 697 |
| 6 | Ga0065715_10160347 | 3300005293 | Bacteria | 1635 |
| 7 | Ga0065707_10165032 | 3300005295 | Bacteria | 1523 |
| 8 | Ga0065707_10276175 | 3300005295 | Bacteria | 1059 |
| 9 | Ga0070683_100151415 | 3300005329 | Bacteria | 2199 |
| 10 | Ga0070690_100031372 | 3300005330 | Bacteria | 3310 |
| 11 | Ga0070670_100122007 | 3300005331 | Bacteria | 2248 |
| 12 | Ga0068869_100202478 | 3300005334 | Bacteria | 1566 |
| 13 | Ga0070666_10959106 | 3300005335 | Bacteria | 633 |
| 14 | Ga0070680_100032210 | 3300005336 | Bacteria | 4218 |
| 15 | Ga0070682_100285294 | 3300005337 | Bacteria | 1205 |
| 16 | Ga0070660_100051062 | 3300005339 | Bacteria | 3183 |
| 17 | Ga0070689_100294416 | 3300005340 | Bacteria | 1350 |
| 18 | Ga0070687_100001854 | 3300005343 | Bacteria | 7662 |
| 19 | Ga0070675_100006200 | 3300005354 | Bacteria | 9172 |
| 20 | Ga0070675_100089931 | 3300005354 | Bacteria | 2571 |
| 21 | Ga0070675_100275081 | 3300005354 | Bacteria | 1478 |
| 22 | Ga0070675_100630254 | 3300005354 | Bacteria | 974 |
| 23 | Ga0070671_100334296 | 3300005355 | Bacteria | 1291 |
| 24 | Ga0070671_100490971 | 3300005355 | Bacteria | 1056 |
| 25 | Ga0070673_100028388 | 3300005364 | Bacteria | 4161 |
| 26 | Ga0070673_100334218 | 3300005364 | Bacteria | 1341 |
| 27 | Ga0070688_100687993 | 3300005365 | Bacteria | 791 |
| 28 | Ga0070667_100081114 | 3300005367 | Bacteria | 2776 |
| 29 | Ga0070709_10463297 | 3300005434 | Bacteria | 957 |
| 30 | Ga0070709_10909620 | 3300005434 | Bacteria | 696 |
| 31 | Ga0070713_100002953 | 3300005436 | Bacteria | 11155 |
| 32 | Ga0070708_100000411 | 3300005445 | Bacteria | 32166 |
| 33 | Ga0070708_100003137 | 3300005445 | Bacteria | 12871 |
| 34 | Ga0070708_100112488 | 3300005445 | Bacteria | 2504 |
| 35 | Ga0070678_100125389 | 3300005456 | Bacteria | 2032 |
| 36 | Ga0070678_100289082 | 3300005456 | Bacteria | 1389 |
| 37 | Ga0070662_100187006 | 3300005457 | Bacteria | 1635 |
| 38 | Ga0070681_10057250 | 3300005458 | Bacteria | 3878 |
| 39 | Ga0070685_10049682 | 3300005466 | Bacteria | 2420 |
| 40 | Ga0070707_100000677 | 3300005468 | Bacteria | 33786 |
| 41 | Ga0070707_100066751 | 3300005468 | Bacteria | 3458 |
| 42 | Ga0070698_100077884 | 3300005471 | Bacteria | 3314 |
| 43 | Ga0070679_100002001 | 3300005530 | Bacteria | 18303 |
| 44 | Ga0070679_100012044 | 3300005530 | Bacteria | 8255 |
| 45 | Ga0070684_100118093 | 3300005535 | Bacteria | 2383 |
| 46 | Ga0068853_100000009 | 3300005539 | Bacteria | 257819 |
| 47 | Ga0068853_100007383 | 3300005539 | Bacteria | 8794 |
| 48 | Ga0070672_100102472 | 3300005543 | Bacteria | 2323 |
| 49 | Ga0070695_100033356 | 3300005545 | Bacteria | 3221 |
| 50 | Ga0070665_101268907 | 3300005548 | Bacteria | 747 |
| 51 | Ga0070704_100033062 | 3300005549 | Bacteria | 3495 |
| 52 | Ga0070664_100027312 | 3300005564 | Bacteria | 4742 |
| 53 | Ga0068857_100282697 | 3300005577 | Bacteria | 1526 |
| 54 | Ga0070702_100139959 | 3300005615 | Bacteria | 1540 |
| 55 | Ga0068852_100019057 | 3300005616 | Bacteria | 5421 |
| 56 | Ga0068852_100154001 | 3300005616 | Bacteria | 2140 |
| 57 | Ga0068852_101340364 | 3300005616 | Bacteria | 737 |
| 58 | Ga0068859_100023810 | 3300005617 | Bacteria | 6145 |
| 59 | Ga0068864_100021997 | 3300005618 | Bacteria | 5345 |
| 60 | Ga0068864_100083757 | 3300005618 | Bacteria | 2801 |
| 61 | Ga0068864_100191963 | 3300005618 | Bacteria | 1873 |
| 62 | Ga0068864_100458865 | 3300005618 | Bacteria | 1219 |
| 63 | Ga0068866_10240552 | 3300005718 | Bacteria | 1102 |
| 64 | Ga0068870_10009089 | 3300005840 | Bacteria | 4500 |
| 65 | Ga0068863_100135759 | 3300005841 | Bacteria | 2350 |
| 66 | Ga0068860_100261477 | 3300005843 | Bacteria | 1687 |
| 67 | Ga0068860_100482748 | 3300005843 | Bacteria | 1235 |
| 68 | Ga0068860_100528612 | 3300005843 | Bacteria | 1180 |
| 69 | Ga0068862_100491074 | 3300005844 | Bacteria | 1164 |
| 70 | Ga0081455_10171415 | 3300005937 | Bacteria | 1653 |
| 71 | Ga0081540_1023814 | 3300005983 | Unclassified | 3568 |
| 72 | Ga0075368_10059431 | 3300006042 | Bacteria | 1529 |
| 73 | Ga0075363_100000314 | 3300006048 | Bacteria | 14304 |
| 74 | Ga0075363_100297996 | 3300006048 | Bacteria | 935 |
| 75 | Ga0075364_10008763 | 3300006051 | Bacteria | 6052 |
| 76 | Ga0075364_10046804 | 3300006051 | Bacteria | 2816 |
| 77 | Ga0075367_10038873 | 3300006178 | Bacteria | 2772 |
| 78 | Ga0075367_10049413 | 3300006178 | Bacteria | 2479 |
| 79 | Ga0075369_10057780 | 3300006186 | Bacteria | 1688 |
| 80 | Ga0075370_10026214 | 3300006353 | Bacteria | 3228 |
| 81 | Ga0068871_100643459 | 3300006358 | Bacteria | 967 |
| 82 | Ga0075428_100252967 | 3300006844 | Bacteria | 1898 |
| 83 | Ga0075434_100317678 | 3300006871 | Bacteria | 1578 |
| 84 | Ga0075429_100560152 | 3300006880 | Bacteria | 1001 |
| 85 | Ga0097620_100023812 | 3300006931 | Bacteria | 6145 |
| 86 | Ga0105240_10199038 | 3300009093 | Bacteria | 2349 |
| 87 | Ga0114129_10000891 | 3300009147 | Bacteria | 38929 |
| 88 | Ga0114129_10551936 | 3300009147 | Bacteria | 1498 |
| 89 | Ga0105248_10017682 | 3300009177 | Bacteria | 7864 |
| 90 | Ga0105248_10049017 | 3300009177 | Bacteria | 4738 |
| 91 | Ga0105248_10167936 | 3300009177 | Bacteria | 2473 |
| 92 | Ga0105248_10837798 | 3300009177 | Bacteria | 1038 |
| 93 | Ga0105237_10009263 | 3300009545 | Bacteria | 10554 |
| 94 | Ga0105238_10008521 | 3300009551 | Bacteria | 10262 |
| 95 | Ga0105238_10030331 | 3300009551 | Bacteria | 5503 |
| 96 | Ga0105238_11021347 | 3300009551 | Bacteria | 848 |
| 97 | Ga0105238_11250845 | 3300009551 | Bacteria | 767 |
| 98 | Ga0105249_10024114 | 3300009553 | Bacteria | 5465 |
| 99 | Ga0105249_10603487 | 3300009553 | Bacteria | 1152 |
| 100 | Ga0105239_10005781 | 3300010375 | Bacteria | 14427 |
| 101 | Ga0105246_10710969 | 3300011119 | Bacteria | 882 |
| 102 | Ga0157369_10375591 | 3300013105 | Bacteria | 1476 |
| 103 | Ga0157374_10701607 | 3300013296 | Bacteria | 1025 |
| 104 | Ga0157378_10405227 | 3300013297 | Bacteria | 1345 |
| 105 | Ga0157378_10648199 | 3300013297 | Bacteria | 1071 |
| 106 | Ga0163162_10484503 | 3300013306 | Bacteria | 1368 |
| 107 | Ga0163162_11490113 | 3300013306 | Bacteria | 771 |
| 108 | Ga0157375_10034085 | 3300013308 | Bacteria | 4846 |
| 109 | Ga0157375_10181073 | 3300013308 | Bacteria | 2259 |
| 110 | Ga0163163_10110399 | 3300014325 | Bacteria | 2778 |
| 111 | Ga0163163_10162970 | 3300014325 | Bacteria | 2276 |
| 112 | Ga0157377_10021819 | 3300014745 | Bacteria | 3374 |
| 113 | Ga0213876_10011276 | 3300021384 | Bacteria | 4774 |
| 114 | Ga0213871_10055436 | 3300021441 | Bacteria | 1095 |
| 115 | Ga0209437_110066 | 3300025233 | Bacteria | 1455 |
| 116 | Ga0207425_1000534 | 3300025245 | Bacteria | 22988 |
| 117 | Ga0209646_1000054 | 3300025246 | Bacteria | 279447 |
| 118 | Ga0209646_1005424 | 3300025246 | Bacteria | 2224 |
| 119 | Ga0209026_1000089 | 3300025250 | Bacteria | 175907 |
| 120 | Ga0209759_1000539 | 3300025256 | Bacteria | 39826 |
| 121 | Ga0209233_1021304 | 3300025261 | Bacteria | 1682 |
| 122 | Ga0209025_1008868 | 3300025294 | Bacteria | 7123 |
| 123 | Ga0209758_1000590 | 3300025297 | Bacteria | 56572 |
| 124 | Ga0207656_10225725 | 3300025321 | Bacteria | 911 |
| 125 | Ga0207692_10286696 | 3300025898 | Bacteria | 998 |
| 126 | Ga0207642_10200385 | 3300025899 | Bacteria | 1102 |
| 127 | Ga0207688_10070365 | 3300025901 | Bacteria | 1984 |
| 128 | Ga0207643_10004659 | 3300025908 | Bacteria | 7360 |
| 129 | Ga0207707_10016782 | 3300025912 | Bacteria | 6379 |
| 130 | Ga0207707_10227737 | 3300025912 | Bacteria | 1622 |
| 131 | Ga0207671_10017154 | 3300025914 | Bacteria | 5595 |
| 132 | Ga0207660_10002229 | 3300025917 | Bacteria | 12819 |
| 133 | Ga0207662_10000342 | 3300025918 | Bacteria | 21071 |
| 134 | Ga0207657_10052342 | 3300025919 | Bacteria | 3544 |
| 135 | Ga0207652_10019544 | 3300025921 | Bacteria | 5572 |
| 136 | Ga0207646_10000550 | 3300025922 | Bacteria | 49383 |
| 137 | Ga0207646_10055719 | 3300025922 | Bacteria | 3534 |
| 138 | Ga0207681_10125448 | 3300025923 | Bacteria | 1889 |
| 139 | Ga0207694_10005521 | 3300025924 | Bacteria | 9700 |
| 140 | Ga0207694_10084654 | 3300025924 | Bacteria | 2494 |
| 141 | Ga0207650_10098155 | 3300025925 | Bacteria | 2250 |
| 142 | Ga0207659_10017926 | 3300025926 | Bacteria | 4633 |
| 143 | Ga0207659_10033216 | 3300025926 | Bacteria | 3549 |
| 144 | Ga0207687_10692448 | 3300025927 | Bacteria | 864 |
| 145 | Ga0207700_10017821 | 3300025928 | Bacteria | 4753 |
| 146 | Ga0207644_10287566 | 3300025931 | Bacteria | 1321 |
| 147 | Ga0207644_10485444 | 3300025931 | Bacteria | 1018 |
| 148 | Ga0207706_10137826 | 3300025933 | Bacteria | 2147 |
| 149 | Ga0207686_10323542 | 3300025934 | Bacteria | 1153 |
| 150 | Ga0207670_10032849 | 3300025936 | Bacteria | 3340 |
| 151 | Ga0207704_10333504 | 3300025938 | Bacteria | 1175 |
| 152 | Ga0207691_10004882 | 3300025940 | Bacteria | 12964 |
| 153 | Ga0207711_10017994 | 3300025941 | Bacteria | 5873 |
| 154 | Ga0207711_10168145 | 3300025941 | Bacteria | 1988 |
| 155 | Ga0207689_10144769 | 3300025942 | Bacteria | 1958 |
| 156 | Ga0207661_10759486 | 3300025944 | Bacteria | 893 |
| 157 | Ga0207679_10020043 | 3300025945 | Bacteria | 4507 |
| 158 | Ga0207667_11242129 | 3300025949 | Bacteria | 723 |
| 159 | Ga0207651_10055388 | 3300025960 | Bacteria | 2723 |
| 160 | Ga0207651_10175094 | 3300025960 | Bacteria | 1696 |
| 161 | Ga0207712_10733459 | 3300025961 | Bacteria | 864 |
| 162 | Ga0207668_10651406 | 3300025972 | Bacteria | 922 |
| 163 | Ga0207658_10137527 | 3300025986 | Bacteria | 1972 |
| 164 | Ga0207677_11168329 | 3300026023 | Bacteria | 704 |
| 165 | Ga0207703_10451410 | 3300026035 | Bacteria | 1201 |
| 166 | Ga0207703_10746374 | 3300026035 | Bacteria | 932 |
| 167 | Ga0207639_10000004 | 3300026041 | Bacteria | 698784 |
| 168 | Ga0207639_10090673 | 3300026041 | Bacteria | 2445 |
| 169 | Ga0207639_10702016 | 3300026041 | Bacteria | 939 |
| 170 | Ga0207639_11210236 | 3300026041 | Bacteria | 709 |
| 171 | Ga0207641_10219347 | 3300026088 | Bacteria | 1763 |
| 172 | Ga0207641_10408736 | 3300026088 | Bacteria | 1305 |
| 173 | Ga0207676_10000011 | 3300026095 | Bacteria | 382648 |
| 174 | Ga0207676_10017441 | 3300026095 | Bacteria | 5203 |
| 175 | Ga0207676_10085491 | 3300026095 | Bacteria | 2574 |
| 176 | Ga0207676_10190599 | 3300026095 | Bacteria | 1804 |
| 177 | Ga0207674_10004580 | 3300026116 | Bacteria | 16602 |
| 178 | Ga0207683_10330647 | 3300026121 | Bacteria | 1397 |
| 179 | Ga0209813_10038895 | 3300027866 | Bacteria | 1439 |
| 180 | Ga0268265_10215781 | 3300028380 | Bacteria | 1675 |
| 181 | Ga0268265_11197092 | 3300028380 | Bacteria | 757 |
| 182 | Ga0268265_11917998 | 3300028380 | Bacteria | 599 |
| 183 | Ga0268264_10343880 | 3300028381 | Bacteria | 1418 |
| 184 | Ga0268264_10646415 | 3300028381 | Bacteria | 1046 |
| 185 | Ga0268264_10954586 | 3300028381 | Bacteria | 863 |
| 186 | Ga0265320_10065554 | 3300031240 | Bacteria | 1723 |
| 187 | Ga0265327_10001222 | 3300031251 | Bacteria | 34564 |
| 188 | Ga0316576_10324370 | 3300031727 | Bacteria | 1148 |
| 189 | Ga0316578_10248959 | 3300031728 | Bacteria | 1066 |
| 190 | Ga0373959_0000020 | 3300034820 | Bacteria | 38620 |
| 191 | Ga0373953_0106145 | 3300035117 | Bacteria | 1185 |
| 192 | Ga0373956_0007418 | 3300035119 | Bacteria | 4416 |
| 193 | Ga0373957_0017864 | 3300035120 | Bacteria | 2477 |
| 194 | Ga0373955_0002192 | 3300035172 | Bacteria | 8468 |
| 195 | Ga0373935_0228589 | 3300035692 | Bacteria | 1295 |
| 196 | Ga0373947_0192961 | 3300035725 | Bacteria | 1330 |
| 197 | Ga0373937_0043553 | 3300036401 | Bacteria | 4098 |
| 198 | Ga0316584_0093523 | 3300036712 | Bacteria | 2251 |
| 199 | Ga0373925_0306128 | 3300037068 | Bacteria | 1284 |
| 200 | Ga0400483_269938 | 3300039062 | Bacteria | 1105 |
| 201 | Ga0436365_0952225 | 3300039437 | Bacteria | 4751 |
| 202 | Ga0436360_0518507 | 3300039438 | Bacteria | 2508 |
| 203 | Ga0436360_0869737 | 3300039438 | Bacteria | 829 |
| 204 | Ga0436361_1098405 | 3300039447 | Bacteria | 1675 |
| 205 | Ga0451793_0400247 | 3300041452 | Bacteria | 1373 |
| 206 | Ga0466965_0394865 | 3300044683 | Bacteria | 763 |
| 207 | Ga0466961_0030442 | 3300044693 | Bacteria | 3469 |
| 208 | Ga0466963_0034373 | 3300044694 | Bacteria | 3298 |
| 209 | Ga0466964_0000227 | 3300044706 | Bacteria | 16118 |
| 210 | Ga0466957_0016088 | 3300044842 | Bacteria | 4371 |
| 211 | Ga0466957_0081611 | 3300044842 | Bacteria | 2014 |
| 212 | Ga0466959_0029417 | 3300045049 | Bacteria | 4070 |
| 213 | Ga0466958_0015584 | 3300045836 | Bacteria | 4359 |
| 214 | Ga0466958_0126469 | 3300045836 | Bacteria | 1603 |
| 215 | Ga0466967_0129198 | 3300045976 | Bacteria | 2344 |
| 216 | Ga0495603_0037996 | 3300046455 | Bacteria | 2888 |
| 217 | Ga0495664_0234812 | 3300046477 | Bacteria | 1109 |
| 218 | Ga0495616_0000012 | 3300046513 | Bacteria | 211342 |
| 219 | Ga0495620_0012383 | 3300046515 | Bacteria | 4409 |
| 220 | Ga0495628_0190759 | 3300046516 | Bacteria | 1547 |
| 221 | Ga0495628_0207065 | 3300046516 | Bacteria | 1476 |
| 222 | Ga0495631_0001885 | 3300046518 | Bacteria | 12352 |
| 223 | Ga0495648_0115272 | 3300046524 | Bacteria | 1454 |
| 224 | Ga0495663_0208824 | 3300046525 | Bacteria | 683 |
| 225 | Ga0495652_0011827 | 3300046529 | Bacteria | 7887 |
| 226 | Ga0495654_0036447 | 3300046530 | Bacteria | 2471 |
| 227 | Ga0495587_0050157 | 3300046536 | Bacteria | 2469 |
| 228 | Ga0495621_0010023 | 3300046539 | Bacteria | 2891 |
| 229 | Ga0495645_0000320 | 3300046543 | Bacteria | 34167 |
| 230 | Ga0495645_0208258 | 3300046543 | Bacteria | 1322 |
| 231 | Ga0495667_0023001 | 3300046559 | Bacteria | 4199 |
| 232 | Ga0495661_0120890 | 3300046665 | Bacteria | 1447 |
| 233 | Ga0495588_0365032 | 3300046674 | Bacteria | 758 |
| 234 | Ga0495599_0040973 | 3300046678 | Bacteria | 2908 |
| 235 | Ga0495670_0098674 | 3300046691 | Bacteria | 1502 |
| 236 | Ga0495600_0027871 | 3300046809 | Bacteria | 3652 |
| 237 | Ga0495604_0568416 | 3300047317 | Bacteria | 730 |
| 238 | Ga0495674_0385710 | 3300047319 | Bacteria | 1133 |
| 239 | Ga0495680_0207219 | 3300047322 | Bacteria | 1405 |
| 240 | Ga0495675_0012677 | 3300047444 | Bacteria | 5306 |
| 241 | Ga0495685_114778 | 3300047447 | Bacteria | 885 |
| 242 | Ga0495684_0048595 | 3300047471 | Bacteria | 3244 |
| 243 | Ga0495684_0530770 | 3300047471 | Bacteria | 804 |
| 244 | Ga0496100_0015929 | 3300048903 | Bacteria | 4402 |
| 245 | Ga0496101_0000257 | 3300048904 | Bacteria | 37750 |
| 246 | Ga0496102_0026513 | 3300048905 | Bacteria | 5170 |
| 247 | Ga0496104_0000393 | 3300048907 | Bacteria | 38237 |
| 248 | Ga0496104_0151579 | 3300048907 | Bacteria | 2225 |
| 249 | Ga0496105_0011329 | 3300048908 | Bacteria | 7041 |
| 250 | Ga0496106_0001338 | 3300048909 | Bacteria | 18479 |
| 251 | Ga0496107_0000276 | 3300048910 | Bacteria | 27176 |
| 252 | Ga0496108_0068157 | 3300048911 | Bacteria | 3002 |
| 253 | Ga0496108_0106915 | 3300048911 | Bacteria | 2389 |
| 254 | Ga0496109_0201046 | 3300048912 | Bacteria | 1873 |
| 255 | Ga0496109_0333180 | 3300048912 | Bacteria | 1433 |
| 256 | Ga0496110_0184910 | 3300048913 | Bacteria | 1892 |
| 257 | Ga0496110_0392352 | 3300048913 | Bacteria | 1265 |
| 258 | Ga0496112_0285279 | 3300048915 | Bacteria | 1597 |
| 259 | Ga0496112_0409410 | 3300048915 | Bacteria | 1295 |
| 260 | Ga0496113_0056761 | 3300048916 | Bacteria | 2941 |
| 261 | Ga0496113_0109740 | 3300048916 | Bacteria | 2146 |
| 262 | Ga0496114_0000446 | 3300048917 | Bacteria | 30334 |
| 263 | Ga0496114_0236926 | 3300048917 | Bacteria | 1604 |
| 264 | Ga0496115_0049147 | 3300048918 | Bacteria | 3375 |
| 265 | Ga0496119_0480751 | 3300048922 | Bacteria | 581 |
| 266 | Ga0496121_0039787 | 3300048924 | Bacteria | 4136 |
| 267 | Ga0496124_0015161 | 3300048927 | Bacteria | 7404 |
| 268 | Ga0496126_0007450 | 3300048929 | Bacteria | 11999 |
| 269 | Ga0496126_0093860 | 3300048929 | Bacteria | 2634 |
| 270 | Ga0501073_0011056 | 3300049589 | Bacteria | 6602 |
| 271 | Ga0501073_0127262 | 3300049589 | Bacteria | 1765 |
| 272 | Ga0501074_0466119 | 3300049590 | Bacteria | 895 |
| 273 | Ga0501077_0282266 | 3300049593 | Bacteria | 1057 |
| 274 | nmdc:mga03n38_236738_c1 | 3300050490 | Bacteria | 959 |
| 275 | nmdc:mga03n38_7074_c1 | 3300050490 | Bacteria | 3944 |
| 276 | nmdc:mga00v17_961_c2 | 3300050491 | Bacteria | 14991 |
| 277 | nmdc:mga0yw44_1951_c1 | 3300050492 | Bacteria | 8547 |
| 278 | nmdc:mga06z11_3987_c1 | 3300050494 | Bacteria | 5761 |
| 279 | nmdc:mga06z11_74559_c1 | 3300050494 | Bacteria | 1804 |
| 280 | nmdc:mga04h51_66440_c1 | 3300050495 | Bacteria | 1249 |
| 281 | nmdc:mga07m45_2892_c1 | 3300050496 | Bacteria | 6620 |
| 282 | nmdc:mga05p37_22724_c1 | 3300050507 | Bacteria | 7607 |
| 283 | nmdc:mga09592_867987_c1 | 3300050508 | Bacteria | 760 |
| 284 | nmdc:mga0n895_297446_c1 | 3300050512 | Bacteria | 1636 |
| 285 | nmdc:mga0rr50_1092003_c1 | 3300050513 | Unclassified | 679 |
| 286 | nmdc:mga0sz30_27979_c1 | 3300050516 | Bacteria | 2317 |
| 287 | Ga0495601_0513710 | 3300053077 | Bacteria | 772 |
| 288 | Ga0495595_0270405 | 3300053084 | Bacteria | 852 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048922 | Ga0496119_0480751 | Ga0496119_0480751_30_521 | 155 |
| 2 | 3300005545 | Ga0070695_100033356 | Ga0070695_1000333563 | 157 |
| 3 | 3300046513 | Ga0495616_0000012 | Ga0495616_0000012_115471_115980 | 157 |
| 4 | 3300046518 | Ga0495631_0001885 | Ga0495631_0001885_7118_7627 | 157 |
| 5 | 3300046524 | Ga0495648_0115272 | Ga0495648_0115272_497_1006 | 157 |
| 6 | 3300046530 | Ga0495654_0036447 | Ga0495654_0036447_1005_1514 | 157 |
| 7 | 3300046665 | Ga0495661_0120890 | Ga0495661_0120890_109_618 | 157 |
| 8 | 3300046674 | Ga0495588_0365032 | Ga0495588_0365032_235_744 | 157 |
| 9 | 3300046691 | Ga0495670_0098674 | Ga0495670_0098674_361_870 | 157 |
| 10 | 3300005290 | Ga0065712_10416286 | Ga0065712_104162861 | 161 |
| 11 | 3300005295 | Ga0065707_10165032 | Ga0065707_101650322 | 161 |
| 12 | 3300005618 | Ga0068864_100458865 | Ga0068864_1004588652 | 161 |
| 13 | 3300005843 | Ga0068860_100261477 | Ga0068860_1002614772 | 161 |
| 14 | 3300006880 | Ga0075429_100560152 | Ga0075429_1005601522 | 161 |
| 15 | 3300009551 | Ga0105238_11250845 | Ga0105238_112508452 | 161 |
| 16 | 3300028381 | Ga0268264_10343880 | Ga0268264_103438802 | 161 |
| 17 | 3300049593 | Ga0501077_0282266 | Ga0501077_0282266_152_673 | 161 |
| 18 | 3300050508 | nmdc:mga09592_867987_c1 | nmdc:mga09592_867987_c1_55_576 | 161 |
| 19 | 3300005335 | Ga0070666_10959106 | Ga0070666_109591061 | 166 |
| 20 | 3300005354 | Ga0070675_100089931 | Ga0070675_1000899314 | 166 |
| 21 | 3300005445 | Ga0070708_100003137 | Ga0070708_1000031372 | 166 |
| 22 | 3300005456 | Ga0070678_100289082 | Ga0070678_1002890822 | 166 |
| 23 | 3300005466 | Ga0070685_10049682 | Ga0070685_100496822 | 166 |
| 24 | 3300005468 | Ga0070707_100066751 | Ga0070707_1000667513 | 166 |
| 25 | 3300005471 | Ga0070698_100077884 | Ga0070698_1000778842 | 166 |
| 26 | 3300005548 | Ga0070665_101268907 | Ga0070665_1012689071 | 166 |
| 27 | 3300005615 | Ga0070702_100139959 | Ga0070702_1001399592 | 166 |
| 28 | 3300005718 | Ga0068866_10240552 | Ga0068866_102405522 | 166 |
| 29 | 3300005841 | Ga0068863_100135759 | Ga0068863_1001357593 | 166 |
| 30 | 3300005843 | Ga0068860_100482748 | Ga0068860_1004827482 | 166 |
| 31 | 3300006358 | Ga0068871_100643459 | Ga0068871_1006434592 | 166 |
| 32 | 3300009177 | Ga0105248_10017682 | Ga0105248_100176827 | 166 |
| 33 | 3300013297 | Ga0157378_10405227 | Ga0157378_104052272 | 166 |
| 34 | 3300013308 | Ga0157375_10034085 | Ga0157375_100340855 | 166 |
| 35 | 3300025899 | Ga0207642_10200385 | Ga0207642_102003852 | 166 |
| 36 | 3300025922 | Ga0207646_10055719 | Ga0207646_100557193 | 166 |
| 37 | 3300025926 | Ga0207659_10033216 | Ga0207659_100332162 | 166 |
| 38 | 3300025934 | Ga0207686_10323542 | Ga0207686_103235422 | 166 |
| 39 | 3300025938 | Ga0207704_10333504 | Ga0207704_103335042 | 166 |
| 40 | 3300025941 | Ga0207711_10017994 | Ga0207711_100179942 | 166 |
| 41 | 3300026088 | Ga0207641_10219347 | Ga0207641_102193472 | 166 |
| 42 | 3300026121 | Ga0207683_10330647 | Ga0207683_103306472 | 166 |
| 43 | 3300028381 | Ga0268264_10954586 | Ga0268264_109545862 | 166 |
| 44 | 3300046477 | Ga0495664_0234812 | Ga0495664_0234812_406_906 | 166 |
| 45 | 3300048903 | Ga0496100_0015929 | Ga0496100_0015929_1058_1558 | 166 |
| 46 | 3300048904 | Ga0496101_0000257 | Ga0496101_0000257_10284_10784 | 166 |
| 47 | 3300048907 | Ga0496104_0000393 | Ga0496104_0000393_17807_18307 | 166 |
| 48 | 3300048908 | Ga0496105_0011329 | Ga0496105_0011329_2165_2665 | 166 |
| 49 | 3300048909 | Ga0496106_0001338 | Ga0496106_0001338_10284_10784 | 166 |
| 50 | 3300048910 | Ga0496107_0000276 | Ga0496107_0000276_20774_21274 | 166 |
| 51 | 3300048912 | Ga0496109_0333180 | Ga0496109_0333180_601_1101 | 166 |
| 52 | 3300048917 | Ga0496114_0000446 | Ga0496114_0000446_23908_24408 | 166 |
| 53 | 3300048917 | Ga0496114_0236926 | Ga0496114_0236926_386_886 | 166 |
| 54 | 3300048918 | Ga0496115_0049147 | Ga0496115_0049147_432_932 | 166 |
| 55 | 3300031240 | Ga0265320_10065554 | Ga0265320_100655541 | 167 |
| 56 | 3300046455 | Ga0495603_0037996 | Ga0495603_0037996_1352_1861 | 167 |
| 57 | iso_pu_bacteria | 2643221644 | 2644243699 | 167 |
| 58 | 3300005354 | Ga0070675_100275081 | Ga0070675_1002750812 | 169 |
| 59 | 3300014745 | Ga0157377_10021819 | Ga0157377_100218193 | 170 |
| 60 | 3300021384 | Ga0213876_10011276 | Ga0213876_100112762 | 170 |
| 61 | 3300026035 | Ga0207703_10451410 | Ga0207703_104514102 | 170 |
| 62 | 3300026041 | Ga0207639_11210236 | Ga0207639_112102361 | 170 |
| 63 | 3300026095 | Ga0207676_10000011 | Ga0207676_10000011149 | 170 |
| 64 | 3300039437 | Ga0436365_0952225 | Ga0436365_0952225_449_1057 | 170 |
| 65 | 3300046515 | Ga0495620_0012383 | Ga0495620_0012383_3072_3587 | 170 |
| 66 | 3300005616 | Ga0068852_101340364 | Ga0068852_1013403641 | 171 |
| 67 | 3300028380 | Ga0268265_11917998 | Ga0268265_119179981 | 171 |
| 68 | 3300039062 | Ga0400483_269938 | Ga0400483_269938_195_710 | 171 |
| 69 | 3300044683 | Ga0466965_0394865 | Ga0466965_0394865_175_723 | 171 |
| 70 | 3300044693 | Ga0466961_0030442 | Ga0466961_0030442_664_1185 | 171 |
| 71 | 3300044694 | Ga0466963_0034373 | Ga0466963_0034373_860_1381 | 171 |
| 72 | 3300044842 | Ga0466957_0081611 | Ga0466957_0081611_1065_1586 | 171 |
| 73 | 3300045049 | Ga0466959_0029417 | Ga0466959_0029417_31_552 | 171 |
| 74 | 3300045836 | Ga0466958_0015584 | Ga0466958_0015584_219_740 | 171 |
| 75 | iso_pu_bacteria | 8004640170 | 8004641057 | 171 |
| 76 | 3300004803 | Ga0058862_10092682 | Ga0058862_100926822 | 172 |
| 77 | 3300005539 | Ga0068853_100000009 | Ga0068853_10000000978 | 172 |
| 78 | 3300005983 | Ga0081540_1023814 | Ga0081540_10238142 | 172 |
| 79 | 3300006844 | Ga0075428_100252967 | Ga0075428_1002529672 | 172 |
| 80 | 3300009147 | Ga0114129_10551936 | Ga0114129_105519363 | 172 |
| 81 | 3300026041 | Ga0207639_10000004 | Ga0207639_10000004340 | 172 |
| 82 | 3300005355 | Ga0070671_100490971 | Ga0070671_1004909712 | 173 |
| 83 | 3300005434 | Ga0070709_10463297 | Ga0070709_104632972 | 173 |
| 84 | 3300009177 | Ga0105248_10837798 | Ga0105248_108377982 | 173 |
| 85 | 3300031727 | Ga0316576_10324370 | Ga0316576_103243702 | 173 |
| 86 | 3300031728 | Ga0316578_10248959 | Ga0316578_102489592 | 173 |
| 87 | 3300034820 | Ga0373959_0000020 | Ga0373959_0000020_34771_35325 | 173 |
| 88 | 3300035692 | Ga0373935_0228589 | Ga0373935_0228589_525_1046 | 173 |
| 89 | 3300035725 | Ga0373947_0192961 | Ga0373947_0192961_197_718 | 173 |
| 90 | 3300036712 | Ga0316584_0093523 | Ga0316584_0093523_1285_1806 | 173 |
| 91 | 3300037068 | Ga0373925_0306128 | Ga0373925_0306128_567_1088 | 173 |
| 92 | 3300049589 | Ga0501073_0127262 | Ga0501073_0127262_436_957 | 173 |
| 93 | 3300005539 | Ga0068853_100007383 | Ga0068853_1000073834 | 174 |
| 94 | 3300005616 | Ga0068852_100019057 | Ga0068852_1000190572 | 174 |
| 95 | 3300005616 | Ga0068852_100154001 | Ga0068852_1001540011 | 174 |
| 96 | 3300009093 | Ga0105240_10199038 | Ga0105240_101990383 | 174 |
| 97 | 3300009545 | Ga0105237_10009263 | Ga0105237_100092634 | 174 |
| 98 | 3300009551 | Ga0105238_10008521 | Ga0105238_1000852110 | 174 |
| 99 | 3300009551 | Ga0105238_10030331 | Ga0105238_100303314 | 174 |
| 100 | 3300010375 | Ga0105239_10005781 | Ga0105239_1000578111 | 174 |
| 101 | 3300013105 | Ga0157369_10375591 | Ga0157369_103755911 | 174 |
| 102 | 3300025246 | Ga0209646_1005424 | Ga0209646_10054242 | 174 |
| 103 | 3300025250 | Ga0209026_1000089 | Ga0209026_1000089179 | 174 |
| 104 | 3300025256 | Ga0209759_1000539 | Ga0209759_100053939 | 174 |
| 105 | 3300025261 | Ga0209233_1021304 | Ga0209233_10213042 | 174 |
| 106 | 3300025914 | Ga0207671_10017154 | Ga0207671_100171544 | 174 |
| 107 | 3300025924 | Ga0207694_10005521 | Ga0207694_1000552110 | 174 |
| 108 | 3300025924 | Ga0207694_10084654 | Ga0207694_100846542 | 174 |
| 109 | 3300025944 | Ga0207661_10759486 | Ga0207661_107594862 | 174 |
| 110 | 3300025949 | Ga0207667_11242129 | Ga0207667_112421291 | 174 |
| 111 | 3300026041 | Ga0207639_10090673 | Ga0207639_100906732 | 174 |
| 112 | 3300041452 | Ga0451793_0400247 | Ga0451793_0400247_722_1246 | 174 |
| 113 | 3300044706 | Ga0466964_0000227 | Ga0466964_0000227_10825_11349 | 174 |
| 114 | 3300045976 | Ga0466967_0129198 | Ga0466967_0129198_558_1082 | 174 |
| 115 | 3300048929 | Ga0496126_0093860 | Ga0496126_0093860_1290_1814 | 174 |
| 116 | 3300002774 | JGI25150J39212_1019197 | JGI25150J39212_10191971 | 175 |
| 117 | 3300003187 | JGI25151J46595_10087266 | JGI25151J46595_100872662 | 175 |
| 118 | 3300005290 | Ga0065712_10434610 | Ga0065712_104346101 | 175 |
| 119 | 3300005293 | Ga0065715_10160347 | Ga0065715_101603472 | 175 |
| 120 | 3300005295 | Ga0065707_10276175 | Ga0065707_102761752 | 175 |
| 121 | 3300005329 | Ga0070683_100151415 | Ga0070683_1001514153 | 175 |
| 122 | 3300005330 | Ga0070690_100031372 | Ga0070690_1000313722 | 175 |
| 123 | 3300005331 | Ga0070670_100122007 | Ga0070670_1001220072 | 175 |
| 124 | 3300005334 | Ga0068869_100202478 | Ga0068869_1002024781 | 175 |
| 125 | 3300005336 | Ga0070680_100032210 | Ga0070680_1000322104 | 175 |
| 126 | 3300005337 | Ga0070682_100285294 | Ga0070682_1002852942 | 175 |
| 127 | 3300005339 | Ga0070660_100051062 | Ga0070660_1000510622 | 175 |
| 128 | 3300005340 | Ga0070689_100294416 | Ga0070689_1002944161 | 175 |
| 129 | 3300005343 | Ga0070687_100001854 | Ga0070687_1000018543 | 175 |
| 130 | 3300005354 | Ga0070675_100006200 | Ga0070675_1000062005 | 175 |
| 131 | 3300005354 | Ga0070675_100630254 | Ga0070675_1006302542 | 175 |
| 132 | 3300005355 | Ga0070671_100334296 | Ga0070671_1003342962 | 175 |
| 133 | 3300005364 | Ga0070673_100028388 | Ga0070673_1000283884 | 175 |
| 134 | 3300005364 | Ga0070673_100334218 | Ga0070673_1003342182 | 175 |
| 135 | 3300005365 | Ga0070688_100687993 | Ga0070688_1006879932 | 175 |
| 136 | 3300005367 | Ga0070667_100081114 | Ga0070667_1000811142 | 175 |
| 137 | 3300005434 | Ga0070709_10909620 | Ga0070709_109096201 | 175 |
| 138 | 3300005436 | Ga0070713_100002953 | Ga0070713_1000029533 | 175 |
| 139 | 3300005445 | Ga0070708_100000411 | Ga0070708_1000004114 | 175 |
| 140 | 3300005445 | Ga0070708_100112488 | Ga0070708_1001124883 | 175 |
| 141 | 3300005456 | Ga0070678_100125389 | Ga0070678_1001253892 | 175 |
| 142 | 3300005457 | Ga0070662_100187006 | Ga0070662_1001870062 | 175 |
| 143 | 3300005458 | Ga0070681_10057250 | Ga0070681_100572502 | 175 |
| 144 | 3300005468 | Ga0070707_100000677 | Ga0070707_10000067723 | 175 |
| 145 | 3300005530 | Ga0070679_100002001 | Ga0070679_10000200113 | 175 |
| 146 | 3300005530 | Ga0070679_100012044 | Ga0070679_1000120442 | 175 |
| 147 | 3300005535 | Ga0070684_100118093 | Ga0070684_1001180932 | 175 |
| 148 | 3300005543 | Ga0070672_100102472 | Ga0070672_1001024722 | 175 |
| 149 | 3300005549 | Ga0070704_100033062 | Ga0070704_1000330623 | 175 |
| 150 | 3300005564 | Ga0070664_100027312 | Ga0070664_1000273122 | 175 |
| 151 | 3300005577 | Ga0068857_100282697 | Ga0068857_1002826972 | 175 |
| 152 | 3300005617 | Ga0068859_100023810 | Ga0068859_1000238105 | 175 |
| 153 | 3300005618 | Ga0068864_100021997 | Ga0068864_1000219972 | 175 |
| 154 | 3300005618 | Ga0068864_100083757 | Ga0068864_1000837572 | 175 |
| 155 | 3300005618 | Ga0068864_100191963 | Ga0068864_1001919632 | 175 |
| 156 | 3300005840 | Ga0068870_10009089 | Ga0068870_100090894 | 175 |
| 157 | 3300005843 | Ga0068860_100528612 | Ga0068860_1005286122 | 175 |
| 158 | 3300005844 | Ga0068862_100491074 | Ga0068862_1004910742 | 175 |
| 159 | 3300005937 | Ga0081455_10171415 | Ga0081455_101714152 | 175 |
| 160 | 3300006042 | Ga0075368_10059431 | Ga0075368_100594312 | 175 |
| 161 | 3300006048 | Ga0075363_100000314 | Ga0075363_1000003146 | 175 |
| 162 | 3300006048 | Ga0075363_100297996 | Ga0075363_1002979962 | 175 |
| 163 | 3300006051 | Ga0075364_10008763 | Ga0075364_100087632 | 175 |
| 164 | 3300006051 | Ga0075364_10046804 | Ga0075364_100468042 | 175 |
| 165 | 3300006178 | Ga0075367_10038873 | Ga0075367_100388732 | 175 |
| 166 | 3300006178 | Ga0075367_10049413 | Ga0075367_100494132 | 175 |
| 167 | 3300006186 | Ga0075369_10057780 | Ga0075369_100577802 | 175 |
| 168 | 3300006353 | Ga0075370_10026214 | Ga0075370_100262142 | 175 |
| 169 | 3300006871 | Ga0075434_100317678 | Ga0075434_1003176782 | 175 |
| 170 | 3300006931 | Ga0097620_100023812 | Ga0097620_1000238123 | 175 |
| 171 | 3300009147 | Ga0114129_10000891 | Ga0114129_1000089117 | 175 |
| 172 | 3300009177 | Ga0105248_10049017 | Ga0105248_100490175 | 175 |
| 173 | 3300009177 | Ga0105248_10167936 | Ga0105248_101679362 | 175 |
| 174 | 3300009551 | Ga0105238_11021347 | Ga0105238_110213472 | 175 |
| 175 | 3300009553 | Ga0105249_10024114 | Ga0105249_100241145 | 175 |
| 176 | 3300009553 | Ga0105249_10603487 | Ga0105249_106034872 | 175 |
| 177 | 3300011119 | Ga0105246_10710969 | Ga0105246_107109692 | 175 |
| 178 | 3300013296 | Ga0157374_10701607 | Ga0157374_107016072 | 175 |
| 179 | 3300013297 | Ga0157378_10648199 | Ga0157378_106481991 | 175 |
| 180 | 3300013306 | Ga0163162_10484503 | Ga0163162_104845032 | 175 |
| 181 | 3300013306 | Ga0163162_11490113 | Ga0163162_114901132 | 175 |
| 182 | 3300013308 | Ga0157375_10181073 | Ga0157375_101810732 | 175 |
| 183 | 3300014325 | Ga0163163_10110399 | Ga0163163_101103992 | 175 |
| 184 | 3300014325 | Ga0163163_10162970 | Ga0163163_101629702 | 175 |
| 185 | 3300021441 | Ga0213871_10055436 | Ga0213871_100554362 | 175 |
| 186 | 3300025233 | Ga0209437_110066 | Ga0209437_1100662 | 175 |
| 187 | 3300025245 | Ga0207425_1000534 | Ga0207425_100053414 | 175 |
| 188 | 3300025246 | Ga0209646_1000054 | Ga0209646_100005467 | 175 |
| 189 | 3300025294 | Ga0209025_1008868 | Ga0209025_10088684 | 175 |
| 190 | 3300025297 | Ga0209758_1000590 | Ga0209758_100059022 | 175 |
| 191 | 3300025321 | Ga0207656_10225725 | Ga0207656_102257252 | 175 |
| 192 | 3300025898 | Ga0207692_10286696 | Ga0207692_102866962 | 175 |
| 193 | 3300025901 | Ga0207688_10070365 | Ga0207688_100703652 | 175 |
| 194 | 3300025908 | Ga0207643_10004659 | Ga0207643_100046592 | 175 |
| 195 | 3300025912 | Ga0207707_10016782 | Ga0207707_100167824 | 175 |
| 196 | 3300025912 | Ga0207707_10227737 | Ga0207707_102277372 | 175 |
| 197 | 3300025917 | Ga0207660_10002229 | Ga0207660_100022292 | 175 |
| 198 | 3300025918 | Ga0207662_10000342 | Ga0207662_100003425 | 175 |
| 199 | 3300025919 | Ga0207657_10052342 | Ga0207657_100523423 | 175 |
| 200 | 3300025921 | Ga0207652_10019544 | Ga0207652_100195442 | 175 |
| 201 | 3300025922 | Ga0207646_10000550 | Ga0207646_1000055026 | 175 |
| 202 | 3300025923 | Ga0207681_10125448 | Ga0207681_101254482 | 175 |
| 203 | 3300025925 | Ga0207650_10098155 | Ga0207650_100981552 | 175 |
| 204 | 3300025926 | Ga0207659_10017926 | Ga0207659_100179263 | 175 |
| 205 | 3300025927 | Ga0207687_10692448 | Ga0207687_106924482 | 175 |
| 206 | 3300025928 | Ga0207700_10017821 | Ga0207700_100178212 | 175 |
| 207 | 3300025931 | Ga0207644_10287566 | Ga0207644_102875662 | 175 |
| 208 | 3300025931 | Ga0207644_10485444 | Ga0207644_104854442 | 175 |
| 209 | 3300025933 | Ga0207706_10137826 | Ga0207706_101378262 | 175 |
| 210 | 3300025936 | Ga0207670_10032849 | Ga0207670_100328492 | 175 |
| 211 | 3300025940 | Ga0207691_10004882 | Ga0207691_100048829 | 175 |
| 212 | 3300025941 | Ga0207711_10168145 | Ga0207711_101681452 | 175 |
| 213 | 3300025942 | Ga0207689_10144769 | Ga0207689_101447693 | 175 |
| 214 | 3300025945 | Ga0207679_10020043 | Ga0207679_100200434 | 175 |
| 215 | 3300025960 | Ga0207651_10055388 | Ga0207651_100553882 | 175 |
| 216 | 3300025960 | Ga0207651_10175094 | Ga0207651_101750942 | 175 |
| 217 | 3300025961 | Ga0207712_10733459 | Ga0207712_107334592 | 175 |
| 218 | 3300025972 | Ga0207668_10651406 | Ga0207668_106514062 | 175 |
| 219 | 3300025986 | Ga0207658_10137527 | Ga0207658_101375272 | 175 |
| 220 | 3300026023 | Ga0207677_11168329 | Ga0207677_111683292 | 175 |
| 221 | 3300026035 | Ga0207703_10746374 | Ga0207703_107463742 | 175 |
| 222 | 3300026041 | Ga0207639_10702016 | Ga0207639_107020162 | 175 |
| 223 | 3300026088 | Ga0207641_10408736 | Ga0207641_104087361 | 175 |
| 224 | 3300026095 | Ga0207676_10017441 | Ga0207676_100174412 | 175 |
| 225 | 3300026095 | Ga0207676_10085491 | Ga0207676_100854913 | 175 |
| 226 | 3300026095 | Ga0207676_10190599 | Ga0207676_101905993 | 175 |
| 227 | 3300026116 | Ga0207674_10004580 | Ga0207674_1000458012 | 175 |
| 228 | 3300027866 | Ga0209813_10038895 | Ga0209813_100388952 | 175 |
| 229 | 3300028380 | Ga0268265_10215781 | Ga0268265_102157812 | 175 |
| 230 | 3300028380 | Ga0268265_11197092 | Ga0268265_111970921 | 175 |
| 231 | 3300028381 | Ga0268264_10646415 | Ga0268264_106464152 | 175 |
| 232 | 3300031251 | Ga0265327_10001222 | Ga0265327_1000122214 | 175 |
| 233 | 3300035117 | Ga0373953_0106145 | Ga0373953_0106145_305_853 | 175 |
| 234 | 3300035119 | Ga0373956_0007418 | Ga0373956_0007418_448_996 | 175 |
| 235 | 3300035120 | Ga0373957_0017864 | Ga0373957_0017864_191_739 | 175 |
| 236 | 3300035172 | Ga0373955_0002192 | Ga0373955_0002192_6856_7404 | 175 |
| 237 | 3300036401 | Ga0373937_0043553 | Ga0373937_0043553_1194_1742 | 175 |
| 238 | 3300039438 | Ga0436360_0518507 | Ga0436360_0518507_1392_1919 | 175 |
| 239 | 3300039438 | Ga0436360_0869737 | Ga0436360_0869737_222_749 | 175 |
| 240 | 3300039447 | Ga0436361_1098405 | Ga0436361_1098405_647_1174 | 175 |
| 241 | 3300044842 | Ga0466957_0016088 | Ga0466957_0016088_3180_3707 | 175 |
| 242 | 3300045836 | Ga0466958_0126469 | Ga0466958_0126469_549_1076 | 175 |
| 243 | 3300046516 | Ga0495628_0190759 | Ga0495628_0190759_108_635 | 175 |
| 244 | 3300046516 | Ga0495628_0207065 | Ga0495628_0207065_850_1398 | 175 |
| 245 | 3300046525 | Ga0495663_0208824 | Ga0495663_0208824_116_664 | 175 |
| 246 | 3300046529 | Ga0495652_0011827 | Ga0495652_0011827_5629_6177 | 175 |
| 247 | 3300046536 | Ga0495587_0050157 | Ga0495587_0050157_1577_2125 | 175 |
| 248 | 3300046539 | Ga0495621_0010023 | Ga0495621_0010023_224_772 | 175 |
| 249 | 3300046543 | Ga0495645_0000320 | Ga0495645_0000320_23346_23894 | 175 |
| 250 | 3300046543 | Ga0495645_0208258 | Ga0495645_0208258_350_898 | 175 |
| 251 | 3300046559 | Ga0495667_0023001 | Ga0495667_0023001_3300_3848 | 175 |
| 252 | 3300046678 | Ga0495599_0040973 | Ga0495599_0040973_1613_2161 | 175 |
| 253 | 3300046809 | Ga0495600_0027871 | Ga0495600_0027871_295_843 | 175 |
| 254 | 3300047317 | Ga0495604_0568416 | Ga0495604_0568416_93_641 | 175 |
| 255 | 3300047319 | Ga0495674_0385710 | Ga0495674_0385710_532_1080 | 175 |
| 256 | 3300047322 | Ga0495680_0207219 | Ga0495680_0207219_352_900 | 175 |
| 257 | 3300047444 | Ga0495675_0012677 | Ga0495675_0012677_2266_2814 | 175 |
| 258 | 3300047447 | Ga0495685_114778 | Ga0495685_114778_208_756 | 175 |
| 259 | 3300047471 | Ga0495684_0048595 | Ga0495684_0048595_2088_2615 | 175 |
| 260 | 3300047471 | Ga0495684_0530770 | Ga0495684_0530770_16_564 | 175 |
| 261 | 3300048905 | Ga0496102_0026513 | Ga0496102_0026513_2311_2859 | 175 |
| 262 | 3300048907 | Ga0496104_0151579 | Ga0496104_0151579_889_1422 | 175 |
| 263 | 3300048911 | Ga0496108_0068157 | Ga0496108_0068157_1412_1960 | 175 |
| 264 | 3300048911 | Ga0496108_0106915 | Ga0496108_0106915_1060_1593 | 175 |
| 265 | 3300048912 | Ga0496109_0201046 | Ga0496109_0201046_600_1133 | 175 |
| 266 | 3300048913 | Ga0496110_0184910 | Ga0496110_0184910_424_957 | 175 |
| 267 | 3300048913 | Ga0496110_0392352 | Ga0496110_0392352_17_565 | 175 |
| 268 | 3300048915 | Ga0496112_0285279 | Ga0496112_0285279_450_983 | 175 |
| 269 | 3300048915 | Ga0496112_0409410 | Ga0496112_0409410_119_667 | 175 |
| 270 | 3300048916 | Ga0496113_0056761 | Ga0496113_0056761_2330_2878 | 175 |
| 271 | 3300048916 | Ga0496113_0109740 | Ga0496113_0109740_996_1529 | 175 |
| 272 | 3300048924 | Ga0496121_0039787 | Ga0496121_0039787_591_1142 | 175 |
| 273 | 3300048927 | Ga0496124_0015161 | Ga0496124_0015161_3853_4404 | 175 |
| 274 | 3300048929 | Ga0496126_0007450 | Ga0496126_0007450_3103_3648 | 175 |
| 275 | 3300049589 | Ga0501073_0011056 | Ga0501073_0011056_5661_6215 | 175 |
| 276 | 3300049590 | Ga0501074_0466119 | Ga0501074_0466119_239_793 | 175 |
| 277 | 3300050490 | nmdc:mga03n38_236738_c1 | nmdc:mga03n38_236738_c1_357_908 | 175 |
| 278 | 3300050490 | nmdc:mga03n38_7074_c1 | nmdc:mga03n38_7074_c1_1096_1641 | 175 |
| 279 | 3300050491 | nmdc:mga00v17_961_c2 | nmdc:mga00v17_961_c2_3490_4035 | 175 |
| 280 | 3300050492 | nmdc:mga0yw44_1951_c1 | nmdc:mga0yw44_1951_c1_7090_7635 | 175 |
| 281 | 3300050494 | nmdc:mga06z11_3987_c1 | nmdc:mga06z11_3987_c1_200_745 | 175 |
| 282 | 3300050494 | nmdc:mga06z11_74559_c1 | nmdc:mga06z11_74559_c1_343_894 | 175 |
| 283 | 3300050495 | nmdc:mga04h51_66440_c1 | nmdc:mga04h51_66440_c1_595_1140 | 175 |
| 284 | 3300050496 | nmdc:mga07m45_2892_c1 | nmdc:mga07m45_2892_c1_858_1403 | 175 |
| 285 | 3300050507 | nmdc:mga05p37_22724_c1 | nmdc:mga05p37_22724_c1_1000_1527 | 175 |
| 286 | 3300050512 | nmdc:mga0n895_297446_c1 | nmdc:mga0n895_297446_c1_897_1445 | 175 |
| 287 | 3300050513 | nmdc:mga0rr50_1092003_c1 | nmdc:mga0rr50_1092003_c1_23_574 | 175 |
| 288 | 3300050516 | nmdc:mga0sz30_27979_c1 | nmdc:mga0sz30_27979_c1_1066_1611 | 175 |
| 289 | 3300053077 | Ga0495601_0513710 | Ga0495601_0513710_109_657 | 175 |
| 290 | 3300053084 | Ga0495595_0270405 | Ga0495595_0270405_16_564 | 175 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5xeu-assembly1.cif.gz_C | crystal structure of hcp2 from salmonella typhimurium | 0.6988 | 64 | 160 |
| 7aeb-assembly1.cif.gz_Y | cryo-em structure of an extracellular contractile injection system in marine bacterium algoriphagus machipongonensis, the baseplate complex in extended state applied 6-fold symmetry. | 0.6706 | 17 | 159 |
| 6rap-assembly1.cif.gz_A | cryo-em structure of the anti-feeding prophage cap (afp tube terminating cap) | 0.6672 | 16 | 159 |
| 6j0n-assembly1.cif.gz_n | cryo-em structure of an extracellular contractile injection system, baseplate in extended state, refined in c6 symmetry | 0.6655 | 18 | 158 |
| 6j0f-assembly1.cif.gz_a | cryo-em structure of an extracellular contractile injection system, pvc sheath/tube terminator in extended state | 0.6618 | 16 | 159 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q09318_3_304_3.40.630.170 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase; | 0.8016 | 105 | 125 | 3.40.630.170 |
| 1lrzA01 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.6707 | 103 | 138 | 3.40.630.30 |
| af_P9WFU7_308_607_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.6703 | 104 | 124 | 3.40.630.30 |
| 4w64B00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like | 0.5669 | 16 | 158 | 2.30.110.20 |
| af_P46855_3_149_2.30.110.20 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like | 0.5644 | 38 | 162 | 2.30.110.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C0E4N7-F1-model_v4 | Phage tail protein | 0.8295 | 17 | 161 |
GO:0005198
|
| AF-A0A2H3LAJ6-F1-model_v4 | Phage tail protein | 0.8196 | 19 | 159 |
GO:0005198
|
| AF-A0A661XWU2-F1-model_v4 | Phage tail protein | 0.812 | 19 | 159 |
GO:0005198
|
| AF-A0A3C0E4N7-F1-model_v4 | Phage tail protein | 0.7972 | 17 | 161 |
GO:0005198
|
| AF-A0A413W1T0-F1-model_v4 | deleted | 0.7915 | 19 | 159 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar