F389679

General Info

Members Datasets Scaffolds Average Seq Length
290 217 288 176

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10171415|Ga0081455_101714152
Length 184
Sequence MAKFTVNVNPMRFDPYKNFKFRVKWGANGYVAGISKVSALKRTTEMVEHREGGDPSSSHKSPGRTKYEPITMERGVTHDPEFEAWANKVWNFGNAQAEADQRQKEVSLKDFRRNLTIDVFNEAGQKVISYKVYRAWVSEFTAQADLDANANAILIQSIKIEHEGWERDTSVKEPAEPQFDDVGA

Samples

Sample ID Description Type Environment
1 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
2 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
80 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
81 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
82 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
83 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
84 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
85 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
86 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
132 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
133 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
134 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
135 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
136 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
137 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
138 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
139 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
148 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
149 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
150 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
151 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
152 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
153 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
156 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
159 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
160 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
161 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
162 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
163 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
164 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
165 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
166 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
167 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
168 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
169 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
172 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
173 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
174 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
175 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
176 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
177 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
178 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
179 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
180 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
181 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
182 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
197 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
198 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
199 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
200 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
201 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
202 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
203 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
204 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
205 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
206 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
207 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
208 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
209 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
214 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
215 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
216 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
217 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.97
Metatranscriptomes 0.34
Isolates 0.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.97
Nodule 0
Rhizoplane 7.59
Rhizosphere 78.62
Stem 0
Stem Tuber 0
Unclassified 4.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25150J39212_1019197 3300002774 Bacteria 1075
2 JGI25151J46595_10087266 3300003187 Bacteria 881
3 Ga0058862_10092682 3300004803 Bacteria 1372
4 Ga0065712_10416286 3300005290 Bacteria 702
5 Ga0065712_10434610 3300005290 Bacteria 697
6 Ga0065715_10160347 3300005293 Bacteria 1635
7 Ga0065707_10165032 3300005295 Bacteria 1523
8 Ga0065707_10276175 3300005295 Bacteria 1059
9 Ga0070683_100151415 3300005329 Bacteria 2199
10 Ga0070690_100031372 3300005330 Bacteria 3310
11 Ga0070670_100122007 3300005331 Bacteria 2248
12 Ga0068869_100202478 3300005334 Bacteria 1566
13 Ga0070666_10959106 3300005335 Bacteria 633
14 Ga0070680_100032210 3300005336 Bacteria 4218
15 Ga0070682_100285294 3300005337 Bacteria 1205
16 Ga0070660_100051062 3300005339 Bacteria 3183
17 Ga0070689_100294416 3300005340 Bacteria 1350
18 Ga0070687_100001854 3300005343 Bacteria 7662
19 Ga0070675_100006200 3300005354 Bacteria 9172
20 Ga0070675_100089931 3300005354 Bacteria 2571
21 Ga0070675_100275081 3300005354 Bacteria 1478
22 Ga0070675_100630254 3300005354 Bacteria 974
23 Ga0070671_100334296 3300005355 Bacteria 1291
24 Ga0070671_100490971 3300005355 Bacteria 1056
25 Ga0070673_100028388 3300005364 Bacteria 4161
26 Ga0070673_100334218 3300005364 Bacteria 1341
27 Ga0070688_100687993 3300005365 Bacteria 791
28 Ga0070667_100081114 3300005367 Bacteria 2776
29 Ga0070709_10463297 3300005434 Bacteria 957
30 Ga0070709_10909620 3300005434 Bacteria 696
31 Ga0070713_100002953 3300005436 Bacteria 11155
32 Ga0070708_100000411 3300005445 Bacteria 32166
33 Ga0070708_100003137 3300005445 Bacteria 12871
34 Ga0070708_100112488 3300005445 Bacteria 2504
35 Ga0070678_100125389 3300005456 Bacteria 2032
36 Ga0070678_100289082 3300005456 Bacteria 1389
37 Ga0070662_100187006 3300005457 Bacteria 1635
38 Ga0070681_10057250 3300005458 Bacteria 3878
39 Ga0070685_10049682 3300005466 Bacteria 2420
40 Ga0070707_100000677 3300005468 Bacteria 33786
41 Ga0070707_100066751 3300005468 Bacteria 3458
42 Ga0070698_100077884 3300005471 Bacteria 3314
43 Ga0070679_100002001 3300005530 Bacteria 18303
44 Ga0070679_100012044 3300005530 Bacteria 8255
45 Ga0070684_100118093 3300005535 Bacteria 2383
46 Ga0068853_100000009 3300005539 Bacteria 257819
47 Ga0068853_100007383 3300005539 Bacteria 8794
48 Ga0070672_100102472 3300005543 Bacteria 2323
49 Ga0070695_100033356 3300005545 Bacteria 3221
50 Ga0070665_101268907 3300005548 Bacteria 747
51 Ga0070704_100033062 3300005549 Bacteria 3495
52 Ga0070664_100027312 3300005564 Bacteria 4742
53 Ga0068857_100282697 3300005577 Bacteria 1526
54 Ga0070702_100139959 3300005615 Bacteria 1540
55 Ga0068852_100019057 3300005616 Bacteria 5421
56 Ga0068852_100154001 3300005616 Bacteria 2140
57 Ga0068852_101340364 3300005616 Bacteria 737
58 Ga0068859_100023810 3300005617 Bacteria 6145
59 Ga0068864_100021997 3300005618 Bacteria 5345
60 Ga0068864_100083757 3300005618 Bacteria 2801
61 Ga0068864_100191963 3300005618 Bacteria 1873
62 Ga0068864_100458865 3300005618 Bacteria 1219
63 Ga0068866_10240552 3300005718 Bacteria 1102
64 Ga0068870_10009089 3300005840 Bacteria 4500
65 Ga0068863_100135759 3300005841 Bacteria 2350
66 Ga0068860_100261477 3300005843 Bacteria 1687
67 Ga0068860_100482748 3300005843 Bacteria 1235
68 Ga0068860_100528612 3300005843 Bacteria 1180
69 Ga0068862_100491074 3300005844 Bacteria 1164
70 Ga0081455_10171415 3300005937 Bacteria 1653
71 Ga0081540_1023814 3300005983 Unclassified 3568
72 Ga0075368_10059431 3300006042 Bacteria 1529
73 Ga0075363_100000314 3300006048 Bacteria 14304
74 Ga0075363_100297996 3300006048 Bacteria 935
75 Ga0075364_10008763 3300006051 Bacteria 6052
76 Ga0075364_10046804 3300006051 Bacteria 2816
77 Ga0075367_10038873 3300006178 Bacteria 2772
78 Ga0075367_10049413 3300006178 Bacteria 2479
79 Ga0075369_10057780 3300006186 Bacteria 1688
80 Ga0075370_10026214 3300006353 Bacteria 3228
81 Ga0068871_100643459 3300006358 Bacteria 967
82 Ga0075428_100252967 3300006844 Bacteria 1898
83 Ga0075434_100317678 3300006871 Bacteria 1578
84 Ga0075429_100560152 3300006880 Bacteria 1001
85 Ga0097620_100023812 3300006931 Bacteria 6145
86 Ga0105240_10199038 3300009093 Bacteria 2349
87 Ga0114129_10000891 3300009147 Bacteria 38929
88 Ga0114129_10551936 3300009147 Bacteria 1498
89 Ga0105248_10017682 3300009177 Bacteria 7864
90 Ga0105248_10049017 3300009177 Bacteria 4738
91 Ga0105248_10167936 3300009177 Bacteria 2473
92 Ga0105248_10837798 3300009177 Bacteria 1038
93 Ga0105237_10009263 3300009545 Bacteria 10554
94 Ga0105238_10008521 3300009551 Bacteria 10262
95 Ga0105238_10030331 3300009551 Bacteria 5503
96 Ga0105238_11021347 3300009551 Bacteria 848
97 Ga0105238_11250845 3300009551 Bacteria 767
98 Ga0105249_10024114 3300009553 Bacteria 5465
99 Ga0105249_10603487 3300009553 Bacteria 1152
100 Ga0105239_10005781 3300010375 Bacteria 14427
101 Ga0105246_10710969 3300011119 Bacteria 882
102 Ga0157369_10375591 3300013105 Bacteria 1476
103 Ga0157374_10701607 3300013296 Bacteria 1025
104 Ga0157378_10405227 3300013297 Bacteria 1345
105 Ga0157378_10648199 3300013297 Bacteria 1071
106 Ga0163162_10484503 3300013306 Bacteria 1368
107 Ga0163162_11490113 3300013306 Bacteria 771
108 Ga0157375_10034085 3300013308 Bacteria 4846
109 Ga0157375_10181073 3300013308 Bacteria 2259
110 Ga0163163_10110399 3300014325 Bacteria 2778
111 Ga0163163_10162970 3300014325 Bacteria 2276
112 Ga0157377_10021819 3300014745 Bacteria 3374
113 Ga0213876_10011276 3300021384 Bacteria 4774
114 Ga0213871_10055436 3300021441 Bacteria 1095
115 Ga0209437_110066 3300025233 Bacteria 1455
116 Ga0207425_1000534 3300025245 Bacteria 22988
117 Ga0209646_1000054 3300025246 Bacteria 279447
118 Ga0209646_1005424 3300025246 Bacteria 2224
119 Ga0209026_1000089 3300025250 Bacteria 175907
120 Ga0209759_1000539 3300025256 Bacteria 39826
121 Ga0209233_1021304 3300025261 Bacteria 1682
122 Ga0209025_1008868 3300025294 Bacteria 7123
123 Ga0209758_1000590 3300025297 Bacteria 56572
124 Ga0207656_10225725 3300025321 Bacteria 911
125 Ga0207692_10286696 3300025898 Bacteria 998
126 Ga0207642_10200385 3300025899 Bacteria 1102
127 Ga0207688_10070365 3300025901 Bacteria 1984
128 Ga0207643_10004659 3300025908 Bacteria 7360
129 Ga0207707_10016782 3300025912 Bacteria 6379
130 Ga0207707_10227737 3300025912 Bacteria 1622
131 Ga0207671_10017154 3300025914 Bacteria 5595
132 Ga0207660_10002229 3300025917 Bacteria 12819
133 Ga0207662_10000342 3300025918 Bacteria 21071
134 Ga0207657_10052342 3300025919 Bacteria 3544
135 Ga0207652_10019544 3300025921 Bacteria 5572
136 Ga0207646_10000550 3300025922 Bacteria 49383
137 Ga0207646_10055719 3300025922 Bacteria 3534
138 Ga0207681_10125448 3300025923 Bacteria 1889
139 Ga0207694_10005521 3300025924 Bacteria 9700
140 Ga0207694_10084654 3300025924 Bacteria 2494
141 Ga0207650_10098155 3300025925 Bacteria 2250
142 Ga0207659_10017926 3300025926 Bacteria 4633
143 Ga0207659_10033216 3300025926 Bacteria 3549
144 Ga0207687_10692448 3300025927 Bacteria 864
145 Ga0207700_10017821 3300025928 Bacteria 4753
146 Ga0207644_10287566 3300025931 Bacteria 1321
147 Ga0207644_10485444 3300025931 Bacteria 1018
148 Ga0207706_10137826 3300025933 Bacteria 2147
149 Ga0207686_10323542 3300025934 Bacteria 1153
150 Ga0207670_10032849 3300025936 Bacteria 3340
151 Ga0207704_10333504 3300025938 Bacteria 1175
152 Ga0207691_10004882 3300025940 Bacteria 12964
153 Ga0207711_10017994 3300025941 Bacteria 5873
154 Ga0207711_10168145 3300025941 Bacteria 1988
155 Ga0207689_10144769 3300025942 Bacteria 1958
156 Ga0207661_10759486 3300025944 Bacteria 893
157 Ga0207679_10020043 3300025945 Bacteria 4507
158 Ga0207667_11242129 3300025949 Bacteria 723
159 Ga0207651_10055388 3300025960 Bacteria 2723
160 Ga0207651_10175094 3300025960 Bacteria 1696
161 Ga0207712_10733459 3300025961 Bacteria 864
162 Ga0207668_10651406 3300025972 Bacteria 922
163 Ga0207658_10137527 3300025986 Bacteria 1972
164 Ga0207677_11168329 3300026023 Bacteria 704
165 Ga0207703_10451410 3300026035 Bacteria 1201
166 Ga0207703_10746374 3300026035 Bacteria 932
167 Ga0207639_10000004 3300026041 Bacteria 698784
168 Ga0207639_10090673 3300026041 Bacteria 2445
169 Ga0207639_10702016 3300026041 Bacteria 939
170 Ga0207639_11210236 3300026041 Bacteria 709
171 Ga0207641_10219347 3300026088 Bacteria 1763
172 Ga0207641_10408736 3300026088 Bacteria 1305
173 Ga0207676_10000011 3300026095 Bacteria 382648
174 Ga0207676_10017441 3300026095 Bacteria 5203
175 Ga0207676_10085491 3300026095 Bacteria 2574
176 Ga0207676_10190599 3300026095 Bacteria 1804
177 Ga0207674_10004580 3300026116 Bacteria 16602
178 Ga0207683_10330647 3300026121 Bacteria 1397
179 Ga0209813_10038895 3300027866 Bacteria 1439
180 Ga0268265_10215781 3300028380 Bacteria 1675
181 Ga0268265_11197092 3300028380 Bacteria 757
182 Ga0268265_11917998 3300028380 Bacteria 599
183 Ga0268264_10343880 3300028381 Bacteria 1418
184 Ga0268264_10646415 3300028381 Bacteria 1046
185 Ga0268264_10954586 3300028381 Bacteria 863
186 Ga0265320_10065554 3300031240 Bacteria 1723
187 Ga0265327_10001222 3300031251 Bacteria 34564
188 Ga0316576_10324370 3300031727 Bacteria 1148
189 Ga0316578_10248959 3300031728 Bacteria 1066
190 Ga0373959_0000020 3300034820 Bacteria 38620
191 Ga0373953_0106145 3300035117 Bacteria 1185
192 Ga0373956_0007418 3300035119 Bacteria 4416
193 Ga0373957_0017864 3300035120 Bacteria 2477
194 Ga0373955_0002192 3300035172 Bacteria 8468
195 Ga0373935_0228589 3300035692 Bacteria 1295
196 Ga0373947_0192961 3300035725 Bacteria 1330
197 Ga0373937_0043553 3300036401 Bacteria 4098
198 Ga0316584_0093523 3300036712 Bacteria 2251
199 Ga0373925_0306128 3300037068 Bacteria 1284
200 Ga0400483_269938 3300039062 Bacteria 1105
201 Ga0436365_0952225 3300039437 Bacteria 4751
202 Ga0436360_0518507 3300039438 Bacteria 2508
203 Ga0436360_0869737 3300039438 Bacteria 829
204 Ga0436361_1098405 3300039447 Bacteria 1675
205 Ga0451793_0400247 3300041452 Bacteria 1373
206 Ga0466965_0394865 3300044683 Bacteria 763
207 Ga0466961_0030442 3300044693 Bacteria 3469
208 Ga0466963_0034373 3300044694 Bacteria 3298
209 Ga0466964_0000227 3300044706 Bacteria 16118
210 Ga0466957_0016088 3300044842 Bacteria 4371
211 Ga0466957_0081611 3300044842 Bacteria 2014
212 Ga0466959_0029417 3300045049 Bacteria 4070
213 Ga0466958_0015584 3300045836 Bacteria 4359
214 Ga0466958_0126469 3300045836 Bacteria 1603
215 Ga0466967_0129198 3300045976 Bacteria 2344
216 Ga0495603_0037996 3300046455 Bacteria 2888
217 Ga0495664_0234812 3300046477 Bacteria 1109
218 Ga0495616_0000012 3300046513 Bacteria 211342
219 Ga0495620_0012383 3300046515 Bacteria 4409
220 Ga0495628_0190759 3300046516 Bacteria 1547
221 Ga0495628_0207065 3300046516 Bacteria 1476
222 Ga0495631_0001885 3300046518 Bacteria 12352
223 Ga0495648_0115272 3300046524 Bacteria 1454
224 Ga0495663_0208824 3300046525 Bacteria 683
225 Ga0495652_0011827 3300046529 Bacteria 7887
226 Ga0495654_0036447 3300046530 Bacteria 2471
227 Ga0495587_0050157 3300046536 Bacteria 2469
228 Ga0495621_0010023 3300046539 Bacteria 2891
229 Ga0495645_0000320 3300046543 Bacteria 34167
230 Ga0495645_0208258 3300046543 Bacteria 1322
231 Ga0495667_0023001 3300046559 Bacteria 4199
232 Ga0495661_0120890 3300046665 Bacteria 1447
233 Ga0495588_0365032 3300046674 Bacteria 758
234 Ga0495599_0040973 3300046678 Bacteria 2908
235 Ga0495670_0098674 3300046691 Bacteria 1502
236 Ga0495600_0027871 3300046809 Bacteria 3652
237 Ga0495604_0568416 3300047317 Bacteria 730
238 Ga0495674_0385710 3300047319 Bacteria 1133
239 Ga0495680_0207219 3300047322 Bacteria 1405
240 Ga0495675_0012677 3300047444 Bacteria 5306
241 Ga0495685_114778 3300047447 Bacteria 885
242 Ga0495684_0048595 3300047471 Bacteria 3244
243 Ga0495684_0530770 3300047471 Bacteria 804
244 Ga0496100_0015929 3300048903 Bacteria 4402
245 Ga0496101_0000257 3300048904 Bacteria 37750
246 Ga0496102_0026513 3300048905 Bacteria 5170
247 Ga0496104_0000393 3300048907 Bacteria 38237
248 Ga0496104_0151579 3300048907 Bacteria 2225
249 Ga0496105_0011329 3300048908 Bacteria 7041
250 Ga0496106_0001338 3300048909 Bacteria 18479
251 Ga0496107_0000276 3300048910 Bacteria 27176
252 Ga0496108_0068157 3300048911 Bacteria 3002
253 Ga0496108_0106915 3300048911 Bacteria 2389
254 Ga0496109_0201046 3300048912 Bacteria 1873
255 Ga0496109_0333180 3300048912 Bacteria 1433
256 Ga0496110_0184910 3300048913 Bacteria 1892
257 Ga0496110_0392352 3300048913 Bacteria 1265
258 Ga0496112_0285279 3300048915 Bacteria 1597
259 Ga0496112_0409410 3300048915 Bacteria 1295
260 Ga0496113_0056761 3300048916 Bacteria 2941
261 Ga0496113_0109740 3300048916 Bacteria 2146
262 Ga0496114_0000446 3300048917 Bacteria 30334
263 Ga0496114_0236926 3300048917 Bacteria 1604
264 Ga0496115_0049147 3300048918 Bacteria 3375
265 Ga0496119_0480751 3300048922 Bacteria 581
266 Ga0496121_0039787 3300048924 Bacteria 4136
267 Ga0496124_0015161 3300048927 Bacteria 7404
268 Ga0496126_0007450 3300048929 Bacteria 11999
269 Ga0496126_0093860 3300048929 Bacteria 2634
270 Ga0501073_0011056 3300049589 Bacteria 6602
271 Ga0501073_0127262 3300049589 Bacteria 1765
272 Ga0501074_0466119 3300049590 Bacteria 895
273 Ga0501077_0282266 3300049593 Bacteria 1057
274 nmdc:mga03n38_236738_c1 3300050490 Bacteria 959
275 nmdc:mga03n38_7074_c1 3300050490 Bacteria 3944
276 nmdc:mga00v17_961_c2 3300050491 Bacteria 14991
277 nmdc:mga0yw44_1951_c1 3300050492 Bacteria 8547
278 nmdc:mga06z11_3987_c1 3300050494 Bacteria 5761
279 nmdc:mga06z11_74559_c1 3300050494 Bacteria 1804
280 nmdc:mga04h51_66440_c1 3300050495 Bacteria 1249
281 nmdc:mga07m45_2892_c1 3300050496 Bacteria 6620
282 nmdc:mga05p37_22724_c1 3300050507 Bacteria 7607
283 nmdc:mga09592_867987_c1 3300050508 Bacteria 760
284 nmdc:mga0n895_297446_c1 3300050512 Bacteria 1636
285 nmdc:mga0rr50_1092003_c1 3300050513 Unclassified 679
286 nmdc:mga0sz30_27979_c1 3300050516 Bacteria 2317
287 Ga0495601_0513710 3300053077 Bacteria 772
288 Ga0495595_0270405 3300053084 Bacteria 852

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048922 Ga0496119_0480751 Ga0496119_0480751_30_521 155
2 3300005545 Ga0070695_100033356 Ga0070695_1000333563 157
3 3300046513 Ga0495616_0000012 Ga0495616_0000012_115471_115980 157
4 3300046518 Ga0495631_0001885 Ga0495631_0001885_7118_7627 157
5 3300046524 Ga0495648_0115272 Ga0495648_0115272_497_1006 157
6 3300046530 Ga0495654_0036447 Ga0495654_0036447_1005_1514 157
7 3300046665 Ga0495661_0120890 Ga0495661_0120890_109_618 157
8 3300046674 Ga0495588_0365032 Ga0495588_0365032_235_744 157
9 3300046691 Ga0495670_0098674 Ga0495670_0098674_361_870 157
10 3300005290 Ga0065712_10416286 Ga0065712_104162861 161
11 3300005295 Ga0065707_10165032 Ga0065707_101650322 161
12 3300005618 Ga0068864_100458865 Ga0068864_1004588652 161
13 3300005843 Ga0068860_100261477 Ga0068860_1002614772 161
14 3300006880 Ga0075429_100560152 Ga0075429_1005601522 161
15 3300009551 Ga0105238_11250845 Ga0105238_112508452 161
16 3300028381 Ga0268264_10343880 Ga0268264_103438802 161
17 3300049593 Ga0501077_0282266 Ga0501077_0282266_152_673 161
18 3300050508 nmdc:mga09592_867987_c1 nmdc:mga09592_867987_c1_55_576 161
19 3300005335 Ga0070666_10959106 Ga0070666_109591061 166
20 3300005354 Ga0070675_100089931 Ga0070675_1000899314 166
21 3300005445 Ga0070708_100003137 Ga0070708_1000031372 166
22 3300005456 Ga0070678_100289082 Ga0070678_1002890822 166
23 3300005466 Ga0070685_10049682 Ga0070685_100496822 166
24 3300005468 Ga0070707_100066751 Ga0070707_1000667513 166
25 3300005471 Ga0070698_100077884 Ga0070698_1000778842 166
26 3300005548 Ga0070665_101268907 Ga0070665_1012689071 166
27 3300005615 Ga0070702_100139959 Ga0070702_1001399592 166
28 3300005718 Ga0068866_10240552 Ga0068866_102405522 166
29 3300005841 Ga0068863_100135759 Ga0068863_1001357593 166
30 3300005843 Ga0068860_100482748 Ga0068860_1004827482 166
31 3300006358 Ga0068871_100643459 Ga0068871_1006434592 166
32 3300009177 Ga0105248_10017682 Ga0105248_100176827 166
33 3300013297 Ga0157378_10405227 Ga0157378_104052272 166
34 3300013308 Ga0157375_10034085 Ga0157375_100340855 166
35 3300025899 Ga0207642_10200385 Ga0207642_102003852 166
36 3300025922 Ga0207646_10055719 Ga0207646_100557193 166
37 3300025926 Ga0207659_10033216 Ga0207659_100332162 166
38 3300025934 Ga0207686_10323542 Ga0207686_103235422 166
39 3300025938 Ga0207704_10333504 Ga0207704_103335042 166
40 3300025941 Ga0207711_10017994 Ga0207711_100179942 166
41 3300026088 Ga0207641_10219347 Ga0207641_102193472 166
42 3300026121 Ga0207683_10330647 Ga0207683_103306472 166
43 3300028381 Ga0268264_10954586 Ga0268264_109545862 166
44 3300046477 Ga0495664_0234812 Ga0495664_0234812_406_906 166
45 3300048903 Ga0496100_0015929 Ga0496100_0015929_1058_1558 166
46 3300048904 Ga0496101_0000257 Ga0496101_0000257_10284_10784 166
47 3300048907 Ga0496104_0000393 Ga0496104_0000393_17807_18307 166
48 3300048908 Ga0496105_0011329 Ga0496105_0011329_2165_2665 166
49 3300048909 Ga0496106_0001338 Ga0496106_0001338_10284_10784 166
50 3300048910 Ga0496107_0000276 Ga0496107_0000276_20774_21274 166
51 3300048912 Ga0496109_0333180 Ga0496109_0333180_601_1101 166
52 3300048917 Ga0496114_0000446 Ga0496114_0000446_23908_24408 166
53 3300048917 Ga0496114_0236926 Ga0496114_0236926_386_886 166
54 3300048918 Ga0496115_0049147 Ga0496115_0049147_432_932 166
55 3300031240 Ga0265320_10065554 Ga0265320_100655541 167
56 3300046455 Ga0495603_0037996 Ga0495603_0037996_1352_1861 167
57 iso_pu_bacteria 2643221644 2644243699 167
58 3300005354 Ga0070675_100275081 Ga0070675_1002750812 169
59 3300014745 Ga0157377_10021819 Ga0157377_100218193 170
60 3300021384 Ga0213876_10011276 Ga0213876_100112762 170
61 3300026035 Ga0207703_10451410 Ga0207703_104514102 170
62 3300026041 Ga0207639_11210236 Ga0207639_112102361 170
63 3300026095 Ga0207676_10000011 Ga0207676_10000011149 170
64 3300039437 Ga0436365_0952225 Ga0436365_0952225_449_1057 170
65 3300046515 Ga0495620_0012383 Ga0495620_0012383_3072_3587 170
66 3300005616 Ga0068852_101340364 Ga0068852_1013403641 171
67 3300028380 Ga0268265_11917998 Ga0268265_119179981 171
68 3300039062 Ga0400483_269938 Ga0400483_269938_195_710 171
69 3300044683 Ga0466965_0394865 Ga0466965_0394865_175_723 171
70 3300044693 Ga0466961_0030442 Ga0466961_0030442_664_1185 171
71 3300044694 Ga0466963_0034373 Ga0466963_0034373_860_1381 171
72 3300044842 Ga0466957_0081611 Ga0466957_0081611_1065_1586 171
73 3300045049 Ga0466959_0029417 Ga0466959_0029417_31_552 171
74 3300045836 Ga0466958_0015584 Ga0466958_0015584_219_740 171
75 iso_pu_bacteria 8004640170 8004641057 171
76 3300004803 Ga0058862_10092682 Ga0058862_100926822 172
77 3300005539 Ga0068853_100000009 Ga0068853_10000000978 172
78 3300005983 Ga0081540_1023814 Ga0081540_10238142 172
79 3300006844 Ga0075428_100252967 Ga0075428_1002529672 172
80 3300009147 Ga0114129_10551936 Ga0114129_105519363 172
81 3300026041 Ga0207639_10000004 Ga0207639_10000004340 172
82 3300005355 Ga0070671_100490971 Ga0070671_1004909712 173
83 3300005434 Ga0070709_10463297 Ga0070709_104632972 173
84 3300009177 Ga0105248_10837798 Ga0105248_108377982 173
85 3300031727 Ga0316576_10324370 Ga0316576_103243702 173
86 3300031728 Ga0316578_10248959 Ga0316578_102489592 173
87 3300034820 Ga0373959_0000020 Ga0373959_0000020_34771_35325 173
88 3300035692 Ga0373935_0228589 Ga0373935_0228589_525_1046 173
89 3300035725 Ga0373947_0192961 Ga0373947_0192961_197_718 173
90 3300036712 Ga0316584_0093523 Ga0316584_0093523_1285_1806 173
91 3300037068 Ga0373925_0306128 Ga0373925_0306128_567_1088 173
92 3300049589 Ga0501073_0127262 Ga0501073_0127262_436_957 173
93 3300005539 Ga0068853_100007383 Ga0068853_1000073834 174
94 3300005616 Ga0068852_100019057 Ga0068852_1000190572 174
95 3300005616 Ga0068852_100154001 Ga0068852_1001540011 174
96 3300009093 Ga0105240_10199038 Ga0105240_101990383 174
97 3300009545 Ga0105237_10009263 Ga0105237_100092634 174
98 3300009551 Ga0105238_10008521 Ga0105238_1000852110 174
99 3300009551 Ga0105238_10030331 Ga0105238_100303314 174
100 3300010375 Ga0105239_10005781 Ga0105239_1000578111 174
101 3300013105 Ga0157369_10375591 Ga0157369_103755911 174
102 3300025246 Ga0209646_1005424 Ga0209646_10054242 174
103 3300025250 Ga0209026_1000089 Ga0209026_1000089179 174
104 3300025256 Ga0209759_1000539 Ga0209759_100053939 174
105 3300025261 Ga0209233_1021304 Ga0209233_10213042 174
106 3300025914 Ga0207671_10017154 Ga0207671_100171544 174
107 3300025924 Ga0207694_10005521 Ga0207694_1000552110 174
108 3300025924 Ga0207694_10084654 Ga0207694_100846542 174
109 3300025944 Ga0207661_10759486 Ga0207661_107594862 174
110 3300025949 Ga0207667_11242129 Ga0207667_112421291 174
111 3300026041 Ga0207639_10090673 Ga0207639_100906732 174
112 3300041452 Ga0451793_0400247 Ga0451793_0400247_722_1246 174
113 3300044706 Ga0466964_0000227 Ga0466964_0000227_10825_11349 174
114 3300045976 Ga0466967_0129198 Ga0466967_0129198_558_1082 174
115 3300048929 Ga0496126_0093860 Ga0496126_0093860_1290_1814 174
116 3300002774 JGI25150J39212_1019197 JGI25150J39212_10191971 175
117 3300003187 JGI25151J46595_10087266 JGI25151J46595_100872662 175
118 3300005290 Ga0065712_10434610 Ga0065712_104346101 175
119 3300005293 Ga0065715_10160347 Ga0065715_101603472 175
120 3300005295 Ga0065707_10276175 Ga0065707_102761752 175
121 3300005329 Ga0070683_100151415 Ga0070683_1001514153 175
122 3300005330 Ga0070690_100031372 Ga0070690_1000313722 175
123 3300005331 Ga0070670_100122007 Ga0070670_1001220072 175
124 3300005334 Ga0068869_100202478 Ga0068869_1002024781 175
125 3300005336 Ga0070680_100032210 Ga0070680_1000322104 175
126 3300005337 Ga0070682_100285294 Ga0070682_1002852942 175
127 3300005339 Ga0070660_100051062 Ga0070660_1000510622 175
128 3300005340 Ga0070689_100294416 Ga0070689_1002944161 175
129 3300005343 Ga0070687_100001854 Ga0070687_1000018543 175
130 3300005354 Ga0070675_100006200 Ga0070675_1000062005 175
131 3300005354 Ga0070675_100630254 Ga0070675_1006302542 175
132 3300005355 Ga0070671_100334296 Ga0070671_1003342962 175
133 3300005364 Ga0070673_100028388 Ga0070673_1000283884 175
134 3300005364 Ga0070673_100334218 Ga0070673_1003342182 175
135 3300005365 Ga0070688_100687993 Ga0070688_1006879932 175
136 3300005367 Ga0070667_100081114 Ga0070667_1000811142 175
137 3300005434 Ga0070709_10909620 Ga0070709_109096201 175
138 3300005436 Ga0070713_100002953 Ga0070713_1000029533 175
139 3300005445 Ga0070708_100000411 Ga0070708_1000004114 175
140 3300005445 Ga0070708_100112488 Ga0070708_1001124883 175
141 3300005456 Ga0070678_100125389 Ga0070678_1001253892 175
142 3300005457 Ga0070662_100187006 Ga0070662_1001870062 175
143 3300005458 Ga0070681_10057250 Ga0070681_100572502 175
144 3300005468 Ga0070707_100000677 Ga0070707_10000067723 175
145 3300005530 Ga0070679_100002001 Ga0070679_10000200113 175
146 3300005530 Ga0070679_100012044 Ga0070679_1000120442 175
147 3300005535 Ga0070684_100118093 Ga0070684_1001180932 175
148 3300005543 Ga0070672_100102472 Ga0070672_1001024722 175
149 3300005549 Ga0070704_100033062 Ga0070704_1000330623 175
150 3300005564 Ga0070664_100027312 Ga0070664_1000273122 175
151 3300005577 Ga0068857_100282697 Ga0068857_1002826972 175
152 3300005617 Ga0068859_100023810 Ga0068859_1000238105 175
153 3300005618 Ga0068864_100021997 Ga0068864_1000219972 175
154 3300005618 Ga0068864_100083757 Ga0068864_1000837572 175
155 3300005618 Ga0068864_100191963 Ga0068864_1001919632 175
156 3300005840 Ga0068870_10009089 Ga0068870_100090894 175
157 3300005843 Ga0068860_100528612 Ga0068860_1005286122 175
158 3300005844 Ga0068862_100491074 Ga0068862_1004910742 175
159 3300005937 Ga0081455_10171415 Ga0081455_101714152 175
160 3300006042 Ga0075368_10059431 Ga0075368_100594312 175
161 3300006048 Ga0075363_100000314 Ga0075363_1000003146 175
162 3300006048 Ga0075363_100297996 Ga0075363_1002979962 175
163 3300006051 Ga0075364_10008763 Ga0075364_100087632 175
164 3300006051 Ga0075364_10046804 Ga0075364_100468042 175
165 3300006178 Ga0075367_10038873 Ga0075367_100388732 175
166 3300006178 Ga0075367_10049413 Ga0075367_100494132 175
167 3300006186 Ga0075369_10057780 Ga0075369_100577802 175
168 3300006353 Ga0075370_10026214 Ga0075370_100262142 175
169 3300006871 Ga0075434_100317678 Ga0075434_1003176782 175
170 3300006931 Ga0097620_100023812 Ga0097620_1000238123 175
171 3300009147 Ga0114129_10000891 Ga0114129_1000089117 175
172 3300009177 Ga0105248_10049017 Ga0105248_100490175 175
173 3300009177 Ga0105248_10167936 Ga0105248_101679362 175
174 3300009551 Ga0105238_11021347 Ga0105238_110213472 175
175 3300009553 Ga0105249_10024114 Ga0105249_100241145 175
176 3300009553 Ga0105249_10603487 Ga0105249_106034872 175
177 3300011119 Ga0105246_10710969 Ga0105246_107109692 175
178 3300013296 Ga0157374_10701607 Ga0157374_107016072 175
179 3300013297 Ga0157378_10648199 Ga0157378_106481991 175
180 3300013306 Ga0163162_10484503 Ga0163162_104845032 175
181 3300013306 Ga0163162_11490113 Ga0163162_114901132 175
182 3300013308 Ga0157375_10181073 Ga0157375_101810732 175
183 3300014325 Ga0163163_10110399 Ga0163163_101103992 175
184 3300014325 Ga0163163_10162970 Ga0163163_101629702 175
185 3300021441 Ga0213871_10055436 Ga0213871_100554362 175
186 3300025233 Ga0209437_110066 Ga0209437_1100662 175
187 3300025245 Ga0207425_1000534 Ga0207425_100053414 175
188 3300025246 Ga0209646_1000054 Ga0209646_100005467 175
189 3300025294 Ga0209025_1008868 Ga0209025_10088684 175
190 3300025297 Ga0209758_1000590 Ga0209758_100059022 175
191 3300025321 Ga0207656_10225725 Ga0207656_102257252 175
192 3300025898 Ga0207692_10286696 Ga0207692_102866962 175
193 3300025901 Ga0207688_10070365 Ga0207688_100703652 175
194 3300025908 Ga0207643_10004659 Ga0207643_100046592 175
195 3300025912 Ga0207707_10016782 Ga0207707_100167824 175
196 3300025912 Ga0207707_10227737 Ga0207707_102277372 175
197 3300025917 Ga0207660_10002229 Ga0207660_100022292 175
198 3300025918 Ga0207662_10000342 Ga0207662_100003425 175
199 3300025919 Ga0207657_10052342 Ga0207657_100523423 175
200 3300025921 Ga0207652_10019544 Ga0207652_100195442 175
201 3300025922 Ga0207646_10000550 Ga0207646_1000055026 175
202 3300025923 Ga0207681_10125448 Ga0207681_101254482 175
203 3300025925 Ga0207650_10098155 Ga0207650_100981552 175
204 3300025926 Ga0207659_10017926 Ga0207659_100179263 175
205 3300025927 Ga0207687_10692448 Ga0207687_106924482 175
206 3300025928 Ga0207700_10017821 Ga0207700_100178212 175
207 3300025931 Ga0207644_10287566 Ga0207644_102875662 175
208 3300025931 Ga0207644_10485444 Ga0207644_104854442 175
209 3300025933 Ga0207706_10137826 Ga0207706_101378262 175
210 3300025936 Ga0207670_10032849 Ga0207670_100328492 175
211 3300025940 Ga0207691_10004882 Ga0207691_100048829 175
212 3300025941 Ga0207711_10168145 Ga0207711_101681452 175
213 3300025942 Ga0207689_10144769 Ga0207689_101447693 175
214 3300025945 Ga0207679_10020043 Ga0207679_100200434 175
215 3300025960 Ga0207651_10055388 Ga0207651_100553882 175
216 3300025960 Ga0207651_10175094 Ga0207651_101750942 175
217 3300025961 Ga0207712_10733459 Ga0207712_107334592 175
218 3300025972 Ga0207668_10651406 Ga0207668_106514062 175
219 3300025986 Ga0207658_10137527 Ga0207658_101375272 175
220 3300026023 Ga0207677_11168329 Ga0207677_111683292 175
221 3300026035 Ga0207703_10746374 Ga0207703_107463742 175
222 3300026041 Ga0207639_10702016 Ga0207639_107020162 175
223 3300026088 Ga0207641_10408736 Ga0207641_104087361 175
224 3300026095 Ga0207676_10017441 Ga0207676_100174412 175
225 3300026095 Ga0207676_10085491 Ga0207676_100854913 175
226 3300026095 Ga0207676_10190599 Ga0207676_101905993 175
227 3300026116 Ga0207674_10004580 Ga0207674_1000458012 175
228 3300027866 Ga0209813_10038895 Ga0209813_100388952 175
229 3300028380 Ga0268265_10215781 Ga0268265_102157812 175
230 3300028380 Ga0268265_11197092 Ga0268265_111970921 175
231 3300028381 Ga0268264_10646415 Ga0268264_106464152 175
232 3300031251 Ga0265327_10001222 Ga0265327_1000122214 175
233 3300035117 Ga0373953_0106145 Ga0373953_0106145_305_853 175
234 3300035119 Ga0373956_0007418 Ga0373956_0007418_448_996 175
235 3300035120 Ga0373957_0017864 Ga0373957_0017864_191_739 175
236 3300035172 Ga0373955_0002192 Ga0373955_0002192_6856_7404 175
237 3300036401 Ga0373937_0043553 Ga0373937_0043553_1194_1742 175
238 3300039438 Ga0436360_0518507 Ga0436360_0518507_1392_1919 175
239 3300039438 Ga0436360_0869737 Ga0436360_0869737_222_749 175
240 3300039447 Ga0436361_1098405 Ga0436361_1098405_647_1174 175
241 3300044842 Ga0466957_0016088 Ga0466957_0016088_3180_3707 175
242 3300045836 Ga0466958_0126469 Ga0466958_0126469_549_1076 175
243 3300046516 Ga0495628_0190759 Ga0495628_0190759_108_635 175
244 3300046516 Ga0495628_0207065 Ga0495628_0207065_850_1398 175
245 3300046525 Ga0495663_0208824 Ga0495663_0208824_116_664 175
246 3300046529 Ga0495652_0011827 Ga0495652_0011827_5629_6177 175
247 3300046536 Ga0495587_0050157 Ga0495587_0050157_1577_2125 175
248 3300046539 Ga0495621_0010023 Ga0495621_0010023_224_772 175
249 3300046543 Ga0495645_0000320 Ga0495645_0000320_23346_23894 175
250 3300046543 Ga0495645_0208258 Ga0495645_0208258_350_898 175
251 3300046559 Ga0495667_0023001 Ga0495667_0023001_3300_3848 175
252 3300046678 Ga0495599_0040973 Ga0495599_0040973_1613_2161 175
253 3300046809 Ga0495600_0027871 Ga0495600_0027871_295_843 175
254 3300047317 Ga0495604_0568416 Ga0495604_0568416_93_641 175
255 3300047319 Ga0495674_0385710 Ga0495674_0385710_532_1080 175
256 3300047322 Ga0495680_0207219 Ga0495680_0207219_352_900 175
257 3300047444 Ga0495675_0012677 Ga0495675_0012677_2266_2814 175
258 3300047447 Ga0495685_114778 Ga0495685_114778_208_756 175
259 3300047471 Ga0495684_0048595 Ga0495684_0048595_2088_2615 175
260 3300047471 Ga0495684_0530770 Ga0495684_0530770_16_564 175
261 3300048905 Ga0496102_0026513 Ga0496102_0026513_2311_2859 175
262 3300048907 Ga0496104_0151579 Ga0496104_0151579_889_1422 175
263 3300048911 Ga0496108_0068157 Ga0496108_0068157_1412_1960 175
264 3300048911 Ga0496108_0106915 Ga0496108_0106915_1060_1593 175
265 3300048912 Ga0496109_0201046 Ga0496109_0201046_600_1133 175
266 3300048913 Ga0496110_0184910 Ga0496110_0184910_424_957 175
267 3300048913 Ga0496110_0392352 Ga0496110_0392352_17_565 175
268 3300048915 Ga0496112_0285279 Ga0496112_0285279_450_983 175
269 3300048915 Ga0496112_0409410 Ga0496112_0409410_119_667 175
270 3300048916 Ga0496113_0056761 Ga0496113_0056761_2330_2878 175
271 3300048916 Ga0496113_0109740 Ga0496113_0109740_996_1529 175
272 3300048924 Ga0496121_0039787 Ga0496121_0039787_591_1142 175
273 3300048927 Ga0496124_0015161 Ga0496124_0015161_3853_4404 175
274 3300048929 Ga0496126_0007450 Ga0496126_0007450_3103_3648 175
275 3300049589 Ga0501073_0011056 Ga0501073_0011056_5661_6215 175
276 3300049590 Ga0501074_0466119 Ga0501074_0466119_239_793 175
277 3300050490 nmdc:mga03n38_236738_c1 nmdc:mga03n38_236738_c1_357_908 175
278 3300050490 nmdc:mga03n38_7074_c1 nmdc:mga03n38_7074_c1_1096_1641 175
279 3300050491 nmdc:mga00v17_961_c2 nmdc:mga00v17_961_c2_3490_4035 175
280 3300050492 nmdc:mga0yw44_1951_c1 nmdc:mga0yw44_1951_c1_7090_7635 175
281 3300050494 nmdc:mga06z11_3987_c1 nmdc:mga06z11_3987_c1_200_745 175
282 3300050494 nmdc:mga06z11_74559_c1 nmdc:mga06z11_74559_c1_343_894 175
283 3300050495 nmdc:mga04h51_66440_c1 nmdc:mga04h51_66440_c1_595_1140 175
284 3300050496 nmdc:mga07m45_2892_c1 nmdc:mga07m45_2892_c1_858_1403 175
285 3300050507 nmdc:mga05p37_22724_c1 nmdc:mga05p37_22724_c1_1000_1527 175
286 3300050512 nmdc:mga0n895_297446_c1 nmdc:mga0n895_297446_c1_897_1445 175
287 3300050513 nmdc:mga0rr50_1092003_c1 nmdc:mga0rr50_1092003_c1_23_574 175
288 3300050516 nmdc:mga0sz30_27979_c1 nmdc:mga0sz30_27979_c1_1066_1611 175
289 3300053077 Ga0495601_0513710 Ga0495601_0513710_109_657 175
290 3300053084 Ga0495595_0270405 Ga0495595_0270405_16_564 175

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06841

Phage_T4_gp19

T4-like virus tail tube protein gp19

17

166

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xeu-assembly1.cif.gz_C crystal structure of hcp2 from salmonella typhimurium 0.6988 64 160
7aeb-assembly1.cif.gz_Y cryo-em structure of an extracellular contractile injection system in marine bacterium algoriphagus machipongonensis, the baseplate complex in extended state applied 6-fold symmetry. 0.6706 17 159
6rap-assembly1.cif.gz_A cryo-em structure of the anti-feeding prophage cap (afp tube terminating cap) 0.6672 16 159
6j0n-assembly1.cif.gz_n cryo-em structure of an extracellular contractile injection system, baseplate in extended state, refined in c6 symmetry 0.6655 18 158
6j0f-assembly1.cif.gz_a cryo-em structure of an extracellular contractile injection system, pvc sheath/tube terminator in extended state 0.6618 16 159
ID Description Score Start End Superfamily
af_Q09318_3_304_3.40.630.170 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase; 0.8016 105 125 3.40.630.170
1lrzA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.6707 103 138 3.40.630.30
af_P9WFU7_308_607_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.6703 104 124 3.40.630.30
4w64B00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.5669 16 158 2.30.110.20
af_P46855_3_149_2.30.110.20 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.5644 38 162 2.30.110.20
ID Description Score Start End GO Terms
AF-A0A3C0E4N7-F1-model_v4 Phage tail protein 0.8295 17 161 GO:0005198
AF-A0A2H3LAJ6-F1-model_v4 Phage tail protein 0.8196 19 159 GO:0005198
AF-A0A661XWU2-F1-model_v4 Phage tail protein 0.812 19 159 GO:0005198
AF-A0A3C0E4N7-F1-model_v4 Phage tail protein 0.7972 17 161 GO:0005198
AF-A0A413W1T0-F1-model_v4 deleted 0.7915 19 159

Feature Viewer

pLDDT pTM Quality
79.37 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map