F389658

General Info

Members Datasets Scaffolds Average Seq Length
290 181 580 243

Family's Representative Sequence

Representative Sequence 3300005564|Ga0070664_100473444|Ga0070664_1004734441
Length 286
Sequence MLRSRSGSRTVPLITVLIADDEPAARRGVRQLLAPFADFAVVGECRDGREVLAALDVLKPDVVFLDVQMPEIDGFAVLEEMRRTGTPLPFVIFVTAHDEFAVRAFDVHAIDYLLKPVSEERFARALARAREMIASRHGGELGQKLQALLDEHLKRSAPSALAGARAAAGQPTDSPFARRILVRVGQRDEIVSVSDIDWIRSDDYCSVLHIAGKQHIIRETLGALEKRLDPRVFARIHRSVIVNLGRVAALRRLRVGGVNVVLRDGTQLPVSRARRAALTEILGAAI

Samples

Sample ID Description Type Environment
1 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
130 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
131 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
132 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
133 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
139 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
140 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
141 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
142 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
143 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
144 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
145 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
146 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
147 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
148 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
149 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
150 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
159 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
160 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
161 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
162 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
163 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
164 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
165 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
166 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
167 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
168 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
169 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
170 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
173 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
174 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
177 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
178 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
179 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
180 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
181 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.69
Nodule 0
Rhizoplane 2.07
Rhizosphere 95.17
Stem 0
Stem Tuber 0
Unclassified 13.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070664_100473444 3300005564 Bacteria 1152
2 CNAas_1000856 3300000532 Bacteria 2874
3 Ga0065714_10064429 3300005288 Bacteria 141954
4 Ga0065712_10067729 3300005290 Bacteria 142513
5 Ga0065715_10091171 3300005293 Bacteria 6037
6 Ga0065715_10247841 3300005293 Bacteria 1173
7 Ga0065715_10261543 3300005293 Bacteria 1136
8 Ga0070676_10041186 3300005328 Bacteria 2677
9 Ga0070683_100288742 3300005329 Bacteria 1560
10 Ga0068869_100028017 3300005334 Bacteria 3932
11 Ga0068869_100152723 3300005334 Bacteria 1792
12 Ga0070680_100006698 3300005336 Bacteria 8773
13 Ga0070680_100007011 3300005336 Bacteria 8588
14 Ga0068868_100238612 3300005338 Bacteria 1526
15 Ga0070660_100031104 3300005339 Bacteria 4007
16 Ga0070689_100068691 3300005340 Bacteria 2764
17 Ga0070689_100301149 3300005340 Bacteria 1334
18 Ga0070691_10097789 3300005341 Bacteria 1455
19 Ga0070661_100106402 3300005344 Bacteria 2091
20 Ga0070692_10012672 3300005345 Bacteria 3912
21 Ga0070669_100203097 3300005353 Bacteria 1560
22 Ga0070669_100354232 3300005353 Bacteria 1192
23 Ga0070673_100008329 3300005364 Bacteria 6887
24 Ga0070673_100058852 3300005364 Bacteria 3040
25 Ga0070673_100305275 3300005364 Bacteria 1402
26 Ga0070688_100079759 3300005365 Bacteria 2116
27 Ga0070659_100171221 3300005366 Bacteria 1779
28 Ga0070709_10002359 3300005434 Bacteria 10215
29 Ga0070714_100001962 3300005435 Bacteria 15026
30 Ga0070713_100642989 3300005436 Unclassified 1010
31 Ga0070710_10008900 3300005437 Bacteria 4900
32 Ga0070701_10342098 3300005438 Bacteria 932
33 Ga0070705_100000804 3300005440 Bacteria 17709
34 Ga0070700_100000282 3300005441 Bacteria 26812
35 Ga0070694_100009506 3300005444 Bacteria 5964
36 Ga0070694_100017614 3300005444 Unclassified 4517
37 Ga0070694_100076329 3300005444 Bacteria 2320
38 Ga0070694_100237945 3300005444 Bacteria 1372
39 Ga0070681_10011129 3300005458 Bacteria 8904
40 Ga0068867_100036421 3300005459 Unclassified 3572
41 Ga0070706_100000309 3300005467 Bacteria 59357
42 Ga0070707_100639761 3300005468 Bacteria 1026
43 Ga0070698_100254364 3300005471 Bacteria 1689
44 Ga0070699_100006469 3300005518 Bacteria 10205
45 Ga0070699_100073108 3300005518 Bacteria 2983
46 Ga0070699_100170367 3300005518 Bacteria 1929
47 Ga0070699_100879446 3300005518 Bacteria 820
48 Ga0070679_100007369 3300005530 Bacteria 10279
49 Ga0070679_100163670 3300005530 Bacteria 2198
50 Ga0070684_100038276 3300005535 Bacteria 4119
51 Ga0070684_100172555 3300005535 Bacteria 1964
52 Ga0068853_100042152 3300005539 Bacteria 3901
53 Ga0070672_100013273 3300005543 Bacteria 5814
54 Ga0070686_100029276 3300005544 Bacteria 3348
55 Ga0070686_100048359 3300005544 Bacteria 2694
56 Ga0070695_100001405 3300005545 Bacteria 13335
57 Ga0070695_100290929 3300005545 Bacteria 1204
58 Ga0070696_100072757 3300005546 Bacteria 2421
59 Ga0070696_100209472 3300005546 Bacteria 1458
60 Ga0070696_100421838 3300005546 Bacteria 1048
61 Ga0070693_100003840 3300005547 Bacteria 7039
62 Ga0070693_100083056 3300005547 Bacteria 1914
63 Ga0070704_100128126 3300005549 Unclassified 1962
64 Ga0070704_100267409 3300005549 Bacteria 1411
65 Ga0068855_100051835 3300005563 Bacteria 4833
66 Ga0068855_100236434 3300005563 Bacteria 2043
67 Ga0068854_100057753 3300005578 Bacteria 2799
68 Ga0068854_100120077 3300005578 Bacteria 1994
69 Ga0068854_100327931 3300005578 Bacteria 1246
70 Ga0068856_100065339 3300005614 Bacteria 3595
71 Ga0068856_100301679 3300005614 Bacteria 1619
72 Ga0070702_100102663 3300005615 Bacteria 1757
73 Ga0068852_100134526 3300005616 Bacteria 2281
74 Ga0068852_100668480 3300005616 Unclassified 1047
75 Ga0068852_100976903 3300005616 Bacteria 865
76 Ga0068859_100004587 3300005617 Bacteria 14095
77 Ga0068859_100189675 3300005617 Bacteria 2140
78 Ga0068859_100448926 3300005617 Bacteria 1386
79 Ga0068859_100944548 3300005617 Bacteria 946
80 Ga0068866_10093520 3300005718 Bacteria 1643
81 Ga0068863_100100882 3300005841 Bacteria 2744
82 Ga0068863_100444676 3300005841 Bacteria 1271
83 Ga0068862_100037031 3300005844 Bacteria 4135
84 Ga0068862_100412805 3300005844 Bacteria 1265
85 Ga0081539_10010403 3300005985 Bacteria 7564
86 Ga0075365_10004554 3300006038 Bacteria 7365
87 Ga0070716_100002351 3300006173 Bacteria 8705
88 Ga0070712_100188746 3300006175 Unclassified 1611
89 Ga0075428_100001190 3300006844 Bacteria 27834
90 Ga0075430_100001678 3300006846 Bacteria 18098
91 Ga0075430_100133144 3300006846 Bacteria 2072
92 Ga0075431_100017771 3300006847 Bacteria 7230
93 Ga0075431_100171347 3300006847 Bacteria 2230
94 Ga0075433_10012368 3300006852 Bacteria 6891
95 Ga0075433_10596157 3300006852 Unclassified 970
96 Ga0075434_100045855 3300006871 Bacteria 4337
97 Ga0075434_100052618 3300006871 Bacteria 4046
98 Ga0075434_100097633 3300006871 Unclassified 2942
99 Ga0075434_100117887 3300006871 Bacteria 2668
100 Ga0075434_100161354 3300006871 Unclassified 2261
101 Ga0075429_100032521 3300006880 Bacteria 4534
102 Ga0075436_100006984 3300006914 Bacteria 7728
103 Ga0075436_100034131 3300006914 Unclassified 3508
104 Ga0075436_100106153 3300006914 Bacteria 1959
105 Ga0097620_100004587 3300006931 Bacteria 14095
106 Ga0097620_100189675 3300006931 Bacteria 2140
107 Ga0097620_100448944 3300006931 Bacteria 1386
108 Ga0097620_100944410 3300006931 Bacteria 946
109 Ga0075435_100002580 3300007076 Bacteria 12086
110 Ga0075435_100033555 3300007076 Bacteria 4059
111 Ga0075435_100286634 3300007076 Bacteria 1406
112 Ga0111539_10076664 3300009094 Bacteria 3936
113 Ga0111539_10146953 3300009094 Bacteria 2760
114 Ga0111539_10657811 3300009094 Bacteria 1220
115 Ga0105245_10149948 3300009098 Bacteria 2204
116 Ga0105247_10058074 3300009101 Unclassified 2393
117 Ga0114129_10014731 3300009147 Bacteria 11140
118 Ga0114129_10031449 3300009147 Bacteria 7503
119 Ga0114129_10327772 3300009147 Unclassified 2034
120 Ga0114129_10404610 3300009147 Bacteria 1798
121 Ga0114129_10665658 3300009147 Bacteria 1342
122 Ga0105243_10028161 3300009148 Bacteria 4311
123 Ga0105248_10005168 3300009177 Bacteria 14393
124 Ga0105248_10116728 3300009177 Unclassified 3010
125 Ga0105248_10234581 3300009177 Bacteria 2065
126 Ga0105248_10302212 3300009177 Bacteria 1802
127 Ga0105237_10049584 3300009545 Bacteria 4220
128 Ga0105237_10201831 3300009545 Bacteria 1989
129 Ga0105238_10077480 3300009551 Bacteria 3315
130 Ga0105239_10053576 3300010375 Unclassified 4425
131 Ga0105246_10682303 3300011119 Bacteria 898
132 Ga0157370_10047612 3300013104 Bacteria 4109
133 Ga0157370_10134434 3300013104 Bacteria 2306
134 Ga0157369_10217716 3300013105 Bacteria 2000
135 Ga0157378_10995757 3300013297 Bacteria 872
136 Ga0157372_10001817 3300013307 Bacteria 23138
137 Ga0157372_10003532 3300013307 Bacteria 16847
138 Ga0157372_10212917 3300013307 Bacteria 2239
139 Ga0157375_10166602 3300013308 Bacteria 2348
140 Ga0157377_10311797 3300014745 Bacteria 1042
141 Ga0206353_10547222 3300020082 Bacteria 1249
142 Ga0213876_10003599 3300021384 Bacteria 8814
143 Ga0213876_10037193 3300021384 Bacteria 2568
144 Ga0213876_10164599 3300021384 Bacteria 1180
145 Ga0207692_10005404 3300025898 Bacteria 5118
146 Ga0207680_10084295 3300025903 Bacteria 2005
147 Ga0207699_10025273 3300025906 Unclassified 3258
148 Ga0207699_10107891 3300025906 Unclassified 1780
149 Ga0207645_10011519 3300025907 Bacteria 6033
150 Ga0207684_10000319 3300025910 Bacteria 68429
151 Ga0207707_10007194 3300025912 Bacteria 9690
152 Ga0207695_10140145 3300025913 Bacteria 2367
153 Ga0207671_10072316 3300025914 Bacteria 2574
154 Ga0207671_10118086 3300025914 Bacteria 2025
155 Ga0207693_10423103 3300025915 Unclassified 1041
156 Ga0207660_10084791 3300025917 Bacteria 2335
157 Ga0207649_10017696 3300025920 Bacteria 4039
158 Ga0207652_10002107 3300025921 Bacteria 17083
159 Ga0207646_10205491 3300025922 Bacteria 1779
160 Ga0207681_10249937 3300025923 Bacteria 1384
161 Ga0207664_10045060 3300025929 Bacteria 3457
162 Ga0207644_10060885 3300025931 Bacteria 2732
163 Ga0207709_10003681 3300025935 Bacteria 9022
164 Ga0207670_10515040 3300025936 Bacteria 973
165 Ga0207669_10177285 3300025937 Bacteria 1524
166 Ga0207665_10002168 3300025939 Bacteria 13268
167 Ga0207711_10002332 3300025941 Bacteria 17005
168 Ga0207711_10084079 3300025941 Bacteria 2785
169 Ga0207689_10120227 3300025942 Bacteria 2161
170 Ga0207689_10238290 3300025942 Bacteria 1504
171 Ga0207689_10487946 3300025942 Bacteria 1032
172 Ga0207689_10493818 3300025942 Bacteria 1025
173 Ga0207661_10782434 3300025944 Bacteria 878
174 Ga0207667_10165532 3300025949 Bacteria 2273
175 Ga0207651_10133898 3300025960 Bacteria 1902
176 Ga0207640_10128876 3300025981 Bacteria 1825
177 Ga0207640_10185178 3300025981 Bacteria 1565
178 Ga0207639_10014023 3300026041 Bacteria 5625
179 Ga0207678_10118741 3300026067 Bacteria 2257
180 Ga0207678_10142466 3300026067 Bacteria 2046
181 Ga0207708_10000306 3300026075 Bacteria 38726
182 Ga0207708_10015286 3300026075 Bacteria 5756
183 Ga0207641_10031027 3300026088 Bacteria 4431
184 Ga0207641_10054630 3300026088 Bacteria 3390
185 Ga0207641_10438225 3300026088 Bacteria 1261
186 Ga0207641_10512731 3300026088 Bacteria 1166
187 Ga0207648_10027916 3300026089 Bacteria 5007
188 Ga0207648_10034054 3300026089 Unclassified 4492
189 Ga0207648_10418892 3300026089 Bacteria 1216
190 Ga0207676_10062985 3300026095 Bacteria 2944
191 Ga0207674_10084682 3300026116 Bacteria 3168
192 Ga0207675_100010354 3300026118 Bacteria 8737
193 Ga0207675_100082432 3300026118 Bacteria 3016
194 Ga0207698_10076857 3300026142 Bacteria 2674
195 Ga0207698_10646816 3300026142 Unclassified 1047
196 Ga0207428_10041907 3300027907 Bacteria 3705
197 Ga0207428_10095394 3300027907 Bacteria 2304
198 Ga0207428_10304569 3300027907 Bacteria 1179
199 Ga0268265_10088130 3300028380 Bacteria 2472
200 Ga0268264_10114930 3300028381 Bacteria 2364
201 Ga0307413_10044813 3300031824 Bacteria 2617
202 Ga0307410_10013030 3300031852 Bacteria 4835
203 Ga0307410_10047878 3300031852 Bacteria 2860
204 Ga0307410_10209754 3300031852 Bacteria 1492
205 Ga0307407_10052798 3300031903 Unclassified 2336
206 Ga0307412_10005650 3300031911 Bacteria 7024
207 Ga0307412_10113617 3300031911 Bacteria 1938
208 Ga0307409_100516664 3300031995 Bacteria 1166
209 Ga0307414_10395819 3300032004 Unclassified 1198
210 Ga0307411_10034728 3300032005 Bacteria 3141
211 Ga0307411_10122391 3300032005 Bacteria 1885
212 Ga0307415_100057717 3300032126 Unclassified 2669
213 Ga0373959_0046923 3300034820 Unclassified 923
214 Ga0373949_0111746 3300035090 Unclassified 759
215 Ga0373941_0060776 3300035115 Unclassified 1229
216 Ga0373941_0096873 3300035115 Unclassified 1021
217 Ga0373931_0182332 3300035691 Bacteria 1244
218 Ga0373931_0220100 3300035691 Unclassified 1143
219 Ga0373931_0582825 3300035691 Bacteria 730
220 Ga0373935_0194721 3300035692 Unclassified 1398
221 Ga0395900_0167462 3300037418 Bacteria 2239
222 Ga0395901_0118070 3300038443 Unclassified 2787
223 Ga0242420_000755 3300038996 Unclassified 3898
224 Ga0436365_1557810 3300039437 Bacteria 863
225 Ga0436365_1694233 3300039437 Bacteria 1153
226 Ga0436365_1748069 3300039437 Bacteria 20143
227 Ga0439453_0005290 3300041408 Bacteria 1959
228 Ga0439462_0015157 3300042015 Bacteria 1985
229 Ga0439446_0015157 3300042156 Bacteria 2136
230 Ga0466967_0033142 3300045976 Bacteria 4371
231 Ga0495629_0024329 3300046459 Bacteria 4312
232 Ga0495638_0003436 3300046460 Bacteria 12475
233 Ga0495639_0063868 3300046475 Bacteria 1691
234 Ga0495620_0004034 3300046515 Bacteria 8341
235 Ga0495665_0075281 3300046531 Bacteria 1777
236 Ga0495645_0070251 3300046543 Bacteria 2527
237 Ga0495599_0269013 3300046678 Bacteria 1034
238 Ga0495672_0004867 3300047320 Bacteria 10804
239 Ga0495684_0212880 3300047471 Bacteria 1420
240 Ga0496104_0215109 3300048907 Bacteria 1834
241 Ga0496106_0012867 3300048909 Bacteria 6175
242 Ga0496108_0261791 3300048911 Bacteria 1505
243 Ga0496110_0438371 3300048913 Unclassified 1191
244 Ga0496112_0013602 3300048915 Bacteria 7520
245 Ga0496113_0482546 3300048916 Unclassified 996
246 Ga0501034_0003378 3300049571 Bacteria 18220
247 Ga0501067_0350717 3300049583 Bacteria 823
248 Ga0501068_0000976 3300049584 Bacteria 15026
249 Ga0501070_0612213 3300049586 Bacteria 867
250 Ga0501071_0045403 3300049587 Bacteria 3154
251 Ga0501073_0003513 3300049589 Bacteria 11775
252 Ga0501073_0448585 3300049589 Bacteria 892
253 Ga0501074_0039255 3300049590 Unclassified 3429
254 Ga0501075_0155287 3300049591 Bacteria 1745
255 Ga0501076_0013121 3300049592 Bacteria 6204
256 Ga0501077_0001210 3300049593 Bacteria 15603
257 Ga0501079_0004624 3300049741 Bacteria 10195
258 Ga0501081_0035972 3300049743 Bacteria 3374
259 Ga0501083_0095438 3300049744 Bacteria 1962
260 nmdc:mga0yw44_17239_c1 3300050492 Bacteria 3925
261 nmdc:mga05p37_34495_c1 3300050507 Bacteria 6199
262 nmdc:mga05p37_36753_c1 3300050507 Bacteria 6007
263 nmdc:mga05p37_36945_c1 3300050507 Bacteria 5991
264 nmdc:mga05p37_376121_c1 3300050507 Bacteria 1666
265 nmdc:mga05p37_675064_c1 3300050507 Bacteria 1153
266 nmdc:mga09592_224800_c1 3300050508 Unclassified 1626
267 nmdc:mga09592_22550_c1 3300050508 Bacteria 5198
268 nmdc:mga09592_43119_c1 3300050508 Bacteria 3796
269 nmdc:mga0qj67_16870_c1 3300050509 Bacteria 5546
270 nmdc:mga0qj67_909845_c1 3300050509 Unclassified 693
271 nmdc:mga06r32_167901_c1 3300050510 Bacteria 2178
272 nmdc:mga08y16_142814_c1 3300050511 Bacteria 2489
273 nmdc:mga08y16_46646_c1 3300050511 Bacteria 4536
274 nmdc:mga0n895_145360_c1 3300050512 Unclassified 2401
275 nmdc:mga0n895_186215_c1 3300050512 Bacteria 2107
276 nmdc:mga0n895_424326_c1 3300050512 Unclassified 1344
277 nmdc:mga0n895_488311_c1 3300050512 Bacteria 1241
278 nmdc:mga0n895_66031_c1 3300050512 Bacteria 3582
279 nmdc:mga0n895_674059_c1 3300050512 Bacteria 1031
280 nmdc:mga0n895_875220_c1 3300050512 Bacteria 885
281 nmdc:mga0rr50_58456_c1 3300050513 Bacteria 2890
282 nmdc:mga08x19_16163_c1 3300050514 Bacteria 4548
283 nmdc:mga08x19_273164_c1 3300050514 Bacteria 1170
284 nmdc:mga08x19_35651_c1 3300050514 Unclassified 3148
285 nmdc:mga0a205_23138_c1 3300050515 Bacteria 5893
286 nmdc:mga0a205_247842_c1 3300050515 Unclassified 1661
287 Ga0501084_0002858 3300054114 Bacteria 13955
288 Ga0501084_0182468 3300054114 Bacteria 1772
289 Ga0501082_0268999 3300060353 Bacteria 1483
290 Ga0501082_0301213 3300060353 Unclassified 1396
291 Ga0070664_100473444
292 CNAas_1000856
293 Ga0065714_10064429
294 Ga0065712_10067729
295 Ga0065715_10091171
296 Ga0065715_10247841
297 Ga0065715_10261543
298 Ga0070676_10041186
299 Ga0070683_100288742
300 Ga0068869_100028017
301 Ga0068869_100152723
302 Ga0070680_100006698
303 Ga0070680_100007011
304 Ga0068868_100238612
305 Ga0070660_100031104
306 Ga0070689_100068691
307 Ga0070689_100301149
308 Ga0070691_10097789
309 Ga0070661_100106402
310 Ga0070692_10012672
311 Ga0070669_100203097
312 Ga0070669_100354232
313 Ga0070673_100008329
314 Ga0070673_100058852
315 Ga0070673_100305275
316 Ga0070688_100079759
317 Ga0070659_100171221
318 Ga0070709_10002359
319 Ga0070714_100001962
320 Ga0070713_100642989
321 Ga0070710_10008900
322 Ga0070701_10342098
323 Ga0070705_100000804
324 Ga0070700_100000282
325 Ga0070694_100009506
326 Ga0070694_100017614
327 Ga0070694_100076329
328 Ga0070694_100237945
329 Ga0070681_10011129
330 Ga0068867_100036421
331 Ga0070706_100000309
332 Ga0070707_100639761
333 Ga0070698_100254364
334 Ga0070699_100006469
335 Ga0070699_100073108
336 Ga0070699_100170367
337 Ga0070699_100879446
338 Ga0070679_100007369
339 Ga0070679_100163670
340 Ga0070684_100038276
341 Ga0070684_100172555
342 Ga0068853_100042152
343 Ga0070672_100013273
344 Ga0070686_100029276
345 Ga0070686_100048359
346 Ga0070695_100001405
347 Ga0070695_100290929
348 Ga0070696_100072757
349 Ga0070696_100209472
350 Ga0070696_100421838
351 Ga0070693_100003840
352 Ga0070693_100083056
353 Ga0070704_100128126
354 Ga0070704_100267409
355 Ga0068855_100051835
356 Ga0068855_100236434
357 Ga0068854_100057753
358 Ga0068854_100120077
359 Ga0068854_100327931
360 Ga0068856_100065339
361 Ga0068856_100301679
362 Ga0070702_100102663
363 Ga0068852_100134526
364 Ga0068852_100668480
365 Ga0068852_100976903
366 Ga0068859_100004587
367 Ga0068859_100189675
368 Ga0068859_100448926
369 Ga0068859_100944548
370 Ga0068866_10093520
371 Ga0068863_100100882
372 Ga0068863_100444676
373 Ga0068862_100037031
374 Ga0068862_100412805
375 Ga0081539_10010403
376 Ga0075365_10004554
377 Ga0070716_100002351
378 Ga0070712_100188746
379 Ga0075428_100001190
380 Ga0075430_100001678
381 Ga0075430_100133144
382 Ga0075431_100017771
383 Ga0075431_100171347
384 Ga0075433_10012368
385 Ga0075433_10596157
386 Ga0075434_100045855
387 Ga0075434_100052618
388 Ga0075434_100097633
389 Ga0075434_100117887
390 Ga0075434_100161354
391 Ga0075429_100032521
392 Ga0075436_100006984
393 Ga0075436_100034131
394 Ga0075436_100106153
395 Ga0097620_100004587
396 Ga0097620_100189675
397 Ga0097620_100448944
398 Ga0097620_100944410
399 Ga0075435_100002580
400 Ga0075435_100033555
401 Ga0075435_100286634
402 Ga0111539_10076664
403 Ga0111539_10146953
404 Ga0111539_10657811
405 Ga0105245_10149948
406 Ga0105247_10058074
407 Ga0114129_10014731
408 Ga0114129_10031449
409 Ga0114129_10327772
410 Ga0114129_10404610
411 Ga0114129_10665658
412 Ga0105243_10028161
413 Ga0105248_10005168
414 Ga0105248_10116728
415 Ga0105248_10234581
416 Ga0105248_10302212
417 Ga0105237_10049584
418 Ga0105237_10201831
419 Ga0105238_10077480
420 Ga0105239_10053576
421 Ga0105246_10682303
422 Ga0157370_10047612
423 Ga0157370_10134434
424 Ga0157369_10217716
425 Ga0157378_10995757
426 Ga0157372_10001817
427 Ga0157372_10003532
428 Ga0157372_10212917
429 Ga0157375_10166602
430 Ga0157377_10311797
431 Ga0206353_10547222
432 Ga0213876_10003599
433 Ga0213876_10037193
434 Ga0213876_10164599
435 Ga0207692_10005404
436 Ga0207680_10084295
437 Ga0207699_10025273
438 Ga0207699_10107891
439 Ga0207645_10011519
440 Ga0207684_10000319
441 Ga0207707_10007194
442 Ga0207695_10140145
443 Ga0207671_10072316
444 Ga0207671_10118086
445 Ga0207693_10423103
446 Ga0207660_10084791
447 Ga0207649_10017696
448 Ga0207652_10002107
449 Ga0207646_10205491
450 Ga0207681_10249937
451 Ga0207664_10045060
452 Ga0207644_10060885
453 Ga0207709_10003681
454 Ga0207670_10515040
455 Ga0207669_10177285
456 Ga0207665_10002168
457 Ga0207711_10002332
458 Ga0207711_10084079
459 Ga0207689_10120227
460 Ga0207689_10238290
461 Ga0207689_10487946
462 Ga0207689_10493818
463 Ga0207661_10782434
464 Ga0207667_10165532
465 Ga0207651_10133898
466 Ga0207640_10128876
467 Ga0207640_10185178
468 Ga0207639_10014023
469 Ga0207678_10118741
470 Ga0207678_10142466
471 Ga0207708_10000306
472 Ga0207708_10015286
473 Ga0207641_10031027
474 Ga0207641_10054630
475 Ga0207641_10438225
476 Ga0207641_10512731
477 Ga0207648_10027916
478 Ga0207648_10034054
479 Ga0207648_10418892
480 Ga0207676_10062985
481 Ga0207674_10084682
482 Ga0207675_100010354
483 Ga0207675_100082432
484 Ga0207698_10076857
485 Ga0207698_10646816
486 Ga0207428_10041907
487 Ga0207428_10095394
488 Ga0207428_10304569
489 Ga0268265_10088130
490 Ga0268264_10114930
491 Ga0307413_10044813
492 Ga0307410_10013030
493 Ga0307410_10047878
494 Ga0307410_10209754
495 Ga0307407_10052798
496 Ga0307412_10005650
497 Ga0307412_10113617
498 Ga0307409_100516664
499 Ga0307414_10395819
500 Ga0307411_10034728
501 Ga0307411_10122391
502 Ga0307415_100057717
503 Ga0373959_0046923
504 Ga0373949_0111746
505 Ga0373941_0060776
506 Ga0373941_0096873
507 Ga0373931_0182332
508 Ga0373931_0220100
509 Ga0373931_0582825
510 Ga0373935_0194721
511 Ga0395900_0167462
512 Ga0395901_0118070
513 Ga0242420_000755
514 Ga0436365_1557810
515 Ga0436365_1694233
516 Ga0436365_1748069
517 Ga0439453_0005290
518 Ga0439462_0015157
519 Ga0439446_0015157
520 Ga0466967_0033142
521 Ga0495629_0024329
522 Ga0495638_0003436
523 Ga0495639_0063868
524 Ga0495620_0004034
525 Ga0495665_0075281
526 Ga0495645_0070251
527 Ga0495599_0269013
528 Ga0495672_0004867
529 Ga0495684_0212880
530 Ga0496104_0215109
531 Ga0496106_0012867
532 Ga0496108_0261791
533 Ga0496110_0438371
534 Ga0496112_0013602
535 Ga0496113_0482546
536 Ga0501034_0003378
537 Ga0501067_0350717
538 Ga0501068_0000976
539 Ga0501070_0612213
540 Ga0501071_0045403
541 Ga0501073_0003513
542 Ga0501073_0448585
543 Ga0501074_0039255
544 Ga0501075_0155287
545 Ga0501076_0013121
546 Ga0501077_0001210
547 Ga0501079_0004624
548 Ga0501081_0035972
549 Ga0501083_0095438
550 nmdc:mga0yw44_17239_c1
551 nmdc:mga05p37_34495_c1
552 nmdc:mga05p37_36753_c1
553 nmdc:mga05p37_36945_c1
554 nmdc:mga05p37_376121_c1
555 nmdc:mga05p37_675064_c1
556 nmdc:mga09592_224800_c1
557 nmdc:mga09592_22550_c1
558 nmdc:mga09592_43119_c1
559 nmdc:mga0qj67_16870_c1
560 nmdc:mga0qj67_909845_c1
561 nmdc:mga06r32_167901_c1
562 nmdc:mga08y16_142814_c1
563 nmdc:mga08y16_46646_c1
564 nmdc:mga0n895_145360_c1
565 nmdc:mga0n895_186215_c1
566 nmdc:mga0n895_424326_c1
567 nmdc:mga0n895_488311_c1
568 nmdc:mga0n895_66031_c1
569 nmdc:mga0n895_674059_c1
570 nmdc:mga0n895_875220_c1
571 nmdc:mga0rr50_58456_c1
572 nmdc:mga08x19_16163_c1
573 nmdc:mga08x19_273164_c1
574 nmdc:mga08x19_35651_c1
575 nmdc:mga0a205_23138_c1
576 nmdc:mga0a205_247842_c1
577 Ga0501084_0002858
578 Ga0501084_0182468
579 Ga0501082_0268999
580 Ga0501082_0301213

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04397

LytTR

LytTr DNA-binding domain

186

283

0.97

PF00072

Response_reg

Response regulator receiver domain

16

127

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qv0-assembly1.cif.gz_A crystal structure of the response regulatory domain of protein mrke from klebsiella pneumoniae 0.9088 7 122
6m8o-assembly1.cif.gz_A crystal structure of the receiver domain of lytr from staphylococcus aureus 0.8954 7 119
5vxn-assembly1.cif.gz_A structure of two rcsb dimers bound to two parallel dnas. 0.8952 6 122
4qyw-assembly1.cif.gz_A structure of phosphono-chey from t.maritima 0.8908 7 119
5vxn-assembly2.cif.gz_C structure of two rcsb dimers bound to two parallel dnas. 0.888 6 122
ID Description Score Start End Superfamily
af_P0AFT5_1_126_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9308 6 121 3.40.50.2300
2qv0B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9072 7 122 3.40.50.2300
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9037 6 86 3.40.50.2300
af_P0AE39_136_205_2.40.50.40 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.9026 133 199 2.40.50.40
af_P9WGM1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9007 7 86 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A3D4TPM5-F1-model_v4 DNA-binding response regulator 0.9537 5 123 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A7V9SLC8-F1-model_v4 Response regulator 0.9534 7 131 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A4Q3SP19-F1-model_v4 Response regulator 0.9529 6 128 GO:0000156
GO:0003677
GO:0005737
AF-A0A7Y9ELP4-F1-model_v4 DNA-binding LytR/AlgR family response regulator 0.952 130 238 GO:0000156
GO:0003677
AF-A0A4Q5YEC4-F1-model_v4 Response regulator 0.9472 7 128 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Map