F389623

General Info

Members Datasets Scaffolds Average Seq Length
290 182 580 256

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100190038|Ga0070713_1001900382
Length 266
Sequence VKIAAVQHDIEWEDGAATRKRVTPLIAQAARAGARLVALTEMYATGFSMRPERIAEDEGGPNEQFLIDQAREHGCWLVASIAQNGADGKPRNVAVLAAPDGTVHRYAKIHPFSYAGEHERYEAGTEFVTVDVEGVRVSLFVCYDLRFADEFWALADDTDLYVVVANWPEPRREHWRTLLRARAIENQAYVMGVNRVGAAGSSQSLNHVGDSAIIDPLGRALAEASLVETVLVADVTPQQVAEVRETLPFLRDRRVLRDRPDLSDRR

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
12 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
78 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
79 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
82 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
83 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
84 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
85 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
86 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
87 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
88 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
89 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
92 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
93 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
94 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
95 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
96 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
97 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
98 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
99 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
100 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
101 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
102 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
105 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
106 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
107 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
108 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
109 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
110 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
111 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
112 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
113 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
114 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
115 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
116 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
117 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
118 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
119 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
120 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
121 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
122 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
123 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
124 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
125 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
126 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
127 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
135 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
136 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
137 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
138 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
139 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
140 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
141 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
157 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
158 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
159 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
160 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
161 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
162 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
163 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
164 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
168 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
171 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
175 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
176 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
177 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
178 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
179 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
180 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
181 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
182 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.62
Metatranscriptomes 1.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.41
Nodule 0
Rhizoplane 6.9
Rhizosphere 88.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100190038 3300005436 Bacteria 1850
2 Ga0070658_10087189 3300005327 Bacteria 2569
3 Ga0070683_100134432 3300005329 Bacteria 2341
4 Ga0070671_100000694 3300005355 Bacteria 24150
5 Ga0070674_100275610 3300005356 Bacteria 1331
6 Ga0070667_100003044 3300005367 Bacteria 14411
7 Ga0070667_100398065 3300005367 Bacteria 1253
8 Ga0070714_100000100 3300005435 Bacteria 73241
9 Ga0070711_100124855 3300005439 Bacteria 1909
10 Ga0070678_100612827 3300005456 Bacteria 973
11 Ga0070681_10403568 3300005458 Bacteria 1278
12 Ga0070672_100114688 3300005543 Bacteria 2200
13 Ga0070695_100050601 3300005545 Bacteria 2663
14 Ga0068855_100486115 3300005563 Bacteria 1343
15 Ga0068854_100171810 3300005578 Bacteria 1687
16 Ga0068859_100001908 3300005617 Bacteria 21260
17 Ga0068861_100182521 3300005719 Bacteria 1748
18 Ga0068863_100065347 3300005841 Bacteria 3442
19 Ga0068858_100025612 3300005842 Bacteria 5489
20 Ga0068860_100024603 3300005843 Bacteria 5815
21 Ga0081455_10005527 3300005937 Bacteria 13844
22 Ga0081455_10051611 3300005937 Bacteria 3526
23 Ga0081455_10194758 3300005937 Bacteria 1523
24 Ga0081539_10024431 3300005985 Bacteria 3920
25 Ga0075365_10147568 3300006038 Bacteria 1635
26 Ga0075363_100089276 3300006048 Bacteria 1695
27 Ga0075364_10083223 3300006051 Bacteria 2118
28 Ga0075430_100259393 3300006846 Bacteria 1440
29 Ga0075430_100261402 3300006846 Bacteria 1433
30 Ga0075430_100383671 3300006846 Bacteria 1159
31 Ga0075430_100425868 3300006846 Bacteria 1095
32 Ga0075431_100584938 3300006847 Bacteria 1101
33 Ga0075429_100392842 3300006880 Bacteria 1214
34 Ga0097620_100001908 3300006931 Bacteria 21260
35 Ga0105240_10046121 3300009093 Bacteria 5523
36 Ga0105240_10170913 3300009093 Bacteria 2575
37 Ga0111539_10064597 3300009094 Bacteria 4328
38 Ga0111539_10127209 3300009094 Bacteria 2984
39 Ga0111539_10358681 3300009094 Bacteria 1697
40 Ga0111539_10369178 3300009094 Bacteria 1670
41 Ga0105245_10274389 3300009098 Bacteria 1646
42 Ga0105247_10003554 3300009101 Bacteria 10134
43 Ga0114129_10408892 3300009147 Bacteria 1787
44 Ga0114129_10593793 3300009147 Bacteria 1435
45 Ga0105248_10293576 3300009177 Bacteria 1830
46 Ga0105237_10216631 3300009545 Bacteria 1915
47 Ga0105238_10174506 3300009551 Bacteria 2126
48 Ga0105249_10050777 3300009553 Bacteria 3781
49 Ga0105239_10009011 3300010375 Bacteria 11295
50 Ga0105239_10036692 3300010375 Bacteria 5378
51 Ga0105239_10622327 3300010375 Bacteria 1232
52 Ga0105239_11299550 3300010375 Bacteria 839
53 Ga0157369_10018675 3300013105 Bacteria 7774
54 Ga0157378_10250266 3300013297 Bacteria 1696
55 Ga0157372_10000769 3300013307 Bacteria 34731
56 Ga0157375_10157112 3300013308 Bacteria 2414
57 Ga0157375_10799847 3300013308 Bacteria 1092
58 Ga0163163_10378270 3300014325 Bacteria 1474
59 Ga0157380_10364744 3300014326 Bacteria 1357
60 Ga0157380_10575545 3300014326 Bacteria 1109
61 Ga0157379_10767340 3300014968 Bacteria 908
62 Ga0163161_10186934 3300017792 Bacteria 1591
63 Ga0206354_10664327 3300020081 Bacteria 3787
64 Ga0206353_10191839 3300020082 Bacteria 1021
65 Ga0206353_10585456 3300020082 Bacteria 2972
66 Ga0206353_11888417 3300020082 Bacteria 1104
67 Ga0207710_10002158 3300025900 Bacteria 9246
68 Ga0207705_10191362 3300025909 Bacteria 1547
69 Ga0207707_10467574 3300025912 Bacteria 1078
70 Ga0207695_10041590 3300025913 Bacteria 4918
71 Ga0207695_10106371 3300025913 Bacteria 2791
72 Ga0207671_10060875 3300025914 Bacteria 2801
73 Ga0207652_10337864 3300025921 Bacteria 1360
74 Ga0207694_10109703 3300025924 Bacteria 2194
75 Ga0207664_10000002 3300025929 Bacteria 657053
76 Ga0207644_10072256 3300025931 Bacteria 2526
77 Ga0207669_10093676 3300025937 Bacteria 1964
78 Ga0207691_10096529 3300025940 Bacteria 2642
79 Ga0207711_10431557 3300025941 Bacteria 1226
80 Ga0207661_10093557 3300025944 Bacteria 2509
81 Ga0207667_10198784 3300025949 Bacteria 2057
82 Ga0207712_10027021 3300025961 Bacteria 3829
83 Ga0207712_10265091 3300025961 Bacteria 1395
84 Ga0207668_10135997 3300025972 Bacteria 1883
85 Ga0207658_10335546 3300025986 Bacteria 1313
86 Ga0207677_10230777 3300026023 Bacteria 1491
87 Ga0207703_10013495 3300026035 Bacteria 6365
88 Ga0207703_10224431 3300026035 Bacteria 1681
89 Ga0207702_10033017 3300026078 Bacteria 4321
90 Ga0207641_10059727 3300026088 Bacteria 3248
91 Ga0207648_10778538 3300026089 Bacteria 890
92 Ga0207675_100052376 3300026118 Bacteria 3809
93 Ga0207675_100054570 3300026118 Bacteria 3728
94 Ga0207683_10298216 3300026121 Bacteria 1475
95 Ga0207428_10060970 3300027907 Bacteria 2988
96 Ga0207428_10065437 3300027907 Bacteria 2868
97 Ga0207428_10165037 3300027907 Bacteria 1680
98 Ga0207428_10183223 3300027907 Bacteria 1581
99 Ga0268266_10235110 3300028379 Bacteria 1689
100 Ga0268264_10097687 3300028381 Bacteria 2546
101 Ga0268264_10563563 3300028381 Bacteria 1119
102 Ga0265338_10061261 3300028800 Bacteria 3299
103 Ga0265327_10015065 3300031251 Bacteria 5019
104 Ga0265327_10041824 3300031251 Bacteria 2465
105 Ga0316576_10087341 3300031727 Bacteria 2320
106 Ga0316578_10168462 3300031728 Bacteria 1320
107 Ga0307415_100670777 3300032126 Bacteria 932
108 Ga0316583_10029578 3300032133 Bacteria 1953
109 Ga0373930_0000279 3300034816 Bacteria 6499
110 Ga0373948_0017395 3300034817 Bacteria 1339
111 Ga0373928_0008854 3300035084 Bacteria 1961
112 Ga0373932_0001148 3300035112 Bacteria 7605
113 Ga0316574_0009528 3300035398 Bacteria 5443
114 Ga0316574_0021767 3300035398 Bacteria 3811
115 Ga0316574_0141270 3300035398 Bacteria 1551
116 Ga0373931_0000068 3300035691 Bacteria 52126
117 Ga0373931_0000536 3300035691 Bacteria 15561
118 Ga0373927_0068641 3300035695 Bacteria 2294
119 Ga0373933_0316181 3300035724 Bacteria 1012
120 Ga0395901_0499679 3300038443 Bacteria 1238
121 Ga0439436_0067731 3300041404 Bacteria 996
122 Ga0451853_0188487 3300041512 Bacteria 2201
123 Ga0439435_0036516 3300042436 Bacteria 1358
124 Ga0466965_0253953 3300044683 Bacteria 944
125 Ga0466966_0040182 3300044684 Bacteria 3011
126 Ga0466966_0213215 3300044684 Bacteria 1167
127 Ga0466961_0007436 3300044693 Bacteria 6972
128 Ga0466961_0021754 3300044693 Bacteria 4126
129 Ga0466961_0424080 3300044693 Bacteria 806
130 Ga0466963_0018186 3300044694 Bacteria 4389
131 Ga0466963_0108370 3300044694 Bacteria 1905
132 Ga0466963_0125346 3300044694 Bacteria 1770
133 Ga0466963_0149534 3300044694 Bacteria 1621
134 Ga0466971_0004151 3300044719 Bacteria 6246
135 Ga0466971_0043686 3300044719 Bacteria 2013
136 Ga0466970_0013868 3300044765 Bacteria 4135
137 Ga0466957_0039722 3300044842 Bacteria 2840
138 Ga0466957_0056394 3300044842 Bacteria 2402
139 Ga0466957_0070392 3300044842 Bacteria 2162
140 Ga0466960_0010070 3300044901 Bacteria 3917
141 Ga0466960_0028532 3300044901 Bacteria 2554
142 Ga0466960_0176571 3300044901 Bacteria 1156
143 Ga0466958_0001235 3300045836 Bacteria 11989
144 Ga0466958_0049625 3300045836 Bacteria 2539
145 Ga0466958_0068882 3300045836 Bacteria 2164
146 Ga0466958_0169649 3300045836 Bacteria 1382
147 Ga0466967_0007110 3300045976 Bacteria 8032
148 Ga0466967_0017396 3300045976 Bacteria 5706
149 Ga0466967_0033948 3300045976 Bacteria 4324
150 Ga0466967_0039502 3300045976 Bacteria 4057
151 Ga0466967_0055828 3300045976 Bacteria 3480
152 Ga0466967_0173934 3300045976 Bacteria 2028
153 Ga0466967_0177055 3300045976 Bacteria 2009
154 Ga0466967_0272414 3300045976 Bacteria 1622
155 Ga0466967_0945528 3300045976 Bacteria 857
156 Ga0495592_0215918 3300046454 Bacteria 1285
157 Ga0495592_0304767 3300046454 Bacteria 1034
158 Ga0495594_0119362 3300046499 Bacteria 1490
159 Ga0495608_0070557 3300046511 Bacteria 2280
160 Ga0495618_0055026 3300046514 Bacteria 2519
161 Ga0495618_0534788 3300046514 Bacteria 703
162 Ga0495628_0042468 3300046516 Bacteria 3627
163 Ga0495628_0044459 3300046516 Bacteria 3533
164 Ga0495630_0167843 3300046517 Bacteria 1671
165 Ga0495666_0046030 3300046526 Bacteria 2104
166 Ga0495652_0547475 3300046529 Bacteria 796
167 Ga0495667_0066469 3300046559 Bacteria 2357
168 Ga0495599_0090907 3300046678 Bacteria 1905
169 Ga0495658_0042840 3300046683 Bacteria 2529
170 Ga0495624_0214230 3300046690 Bacteria 1168
171 Ga0495600_0235082 3300046809 Bacteria 1169
172 Ga0495581_0131238 3300047315 Bacteria 1460
173 Ga0495674_0024065 3300047319 Bacteria 5603
174 Ga0495672_0045849 3300047320 Bacteria 2612
175 Ga0495680_0415123 3300047322 Bacteria 927
176 Ga0495675_0037521 3300047444 Bacteria 3086
177 Ga0495684_0321199 3300047471 Bacteria 1107
178 Ga0495684_0333475 3300047471 Bacteria 1081
179 Ga0495602_0443302 3300048088 Bacteria 918
180 Ga0496100_0225875 3300048903 Bacteria 1376
181 Ga0496101_0032009 3300048904 Bacteria 3700
182 Ga0496101_0158353 3300048904 Bacteria 1736
183 Ga0496102_0000984 3300048905 Bacteria 26806
184 Ga0496102_0001990 3300048905 Bacteria 17646
185 Ga0496102_0239543 3300048905 Bacteria 1711
186 Ga0496102_0565048 3300048905 Bacteria 1060
187 Ga0496102_0589252 3300048905 Bacteria 1035
188 Ga0496103_0000096 3300048906 Bacteria 97798
189 Ga0496103_0112607 3300048906 Bacteria 1729
190 Ga0496104_0197059 3300048907 Bacteria 1926
191 Ga0496104_0429929 3300048907 Bacteria 1232
192 Ga0496105_0022466 3300048908 Bacteria 5109
193 Ga0496109_0134875 3300048912 Bacteria 2306
194 Ga0496109_0232127 3300048912 Bacteria 1736
195 Ga0496110_0034478 3300048913 Bacteria 4384
196 Ga0496111_0010607 3300048914 Bacteria 6191
197 Ga0496112_0244395 3300048915 Bacteria 1747
198 Ga0496113_0026209 3300048916 Bacteria 4165
199 Ga0496114_0035630 3300048917 Bacteria 4110
200 Ga0496117_0189517 3300048920 Bacteria 1173
201 Ga0496118_0008821 3300048921 Bacteria 10326
202 Ga0496119_0000125 3300048922 Bacteria 108373
203 Ga0496120_0003573 3300048923 Bacteria 14009
204 Ga0496121_0160400 3300048924 Bacteria 1645
205 Ga0501031_0125574 3300049568 Bacteria 1676
206 Ga0501032_0000754 3300049569 Bacteria 26285
207 Ga0501033_0006950 3300049570 Bacteria 8834
208 Ga0501033_0030710 3300049570 Bacteria 4037
209 Ga0501033_0185058 3300049570 Bacteria 1492
210 Ga0501033_0237863 3300049570 Bacteria 1292
211 Ga0501033_0291768 3300049570 Bacteria 1150
212 Ga0501034_0020696 3300049571 Bacteria 6717
213 Ga0501034_0172925 3300049571 Bacteria 2126
214 Ga0501036_0097398 3300049572 Bacteria 2486
215 Ga0501037_0001432 3300049573 Bacteria 17511
216 Ga0501038_0025534 3300049574 Bacteria 5265
217 Ga0501038_0191627 3300049574 Bacteria 1645
218 Ga0501039_0165562 3300049575 Bacteria 1738
219 Ga0501040_0045531 3300049576 Bacteria 2993
220 Ga0501040_0083358 3300049576 Bacteria 2217
221 Ga0501040_0221350 3300049576 Bacteria 1347
222 Ga0501041_0052761 3300049577 Bacteria 2479
223 Ga0501041_0070860 3300049577 Bacteria 2140
224 Ga0501041_0109299 3300049577 Bacteria 1715
225 Ga0501041_0183590 3300049577 Bacteria 1310
226 Ga0501042_0137352 3300049578 Bacteria 1762
227 Ga0501042_0192411 3300049578 Bacteria 1471
228 Ga0501042_0252477 3300049578 Bacteria 1273
229 Ga0501043_0004585 3300049579 Bacteria 11210
230 Ga0501043_0104139 3300049579 Bacteria 2230
231 Ga0501043_0165502 3300049579 Bacteria 1727
232 Ga0501046_0296513 3300049580 Bacteria 1182
233 Ga0501047_0080388 3300049581 Bacteria 3133
234 Ga0501047_0372239 3300049581 Bacteria 1263
235 Ga0501048_0173788 3300049582 Bacteria 1527
236 Ga0501070_0008564 3300049586 Bacteria 8647
237 Ga0501070_0090310 3300049586 Bacteria 2535
238 Ga0501070_0322967 3300049586 Bacteria 1255
239 Ga0501071_0145604 3300049587 Bacteria 1766
240 Ga0501071_0480112 3300049587 Bacteria 953
241 Ga0501072_0146219 3300049588 Bacteria 1885
242 Ga0501074_0047722 3300049590 Bacteria 3095
243 Ga0501074_0198661 3300049590 Bacteria 1429
244 Ga0501075_0006854 3300049591 Bacteria 7866
245 Ga0501075_0118034 3300049591 Bacteria 2017
246 Ga0501076_0092932 3300049592 Bacteria 2427
247 Ga0501076_0126395 3300049592 Bacteria 2072
248 Ga0501079_0087331 3300049741 Bacteria 2414
249 Ga0501079_0259823 3300049741 Bacteria 1357
250 Ga0501079_0370644 3300049741 Bacteria 1122
251 Ga0501080_0381867 3300049742 Bacteria 1269
252 Ga0501081_0042755 3300049743 Bacteria 3106
253 Ga0501081_0156953 3300049743 Bacteria 1637
254 Ga0501081_0199428 3300049743 Bacteria 1451
255 Ga0501035_0130067 3300049822 Bacteria 2195
256 Ga0501035_0204935 3300049822 Bacteria 1690
257 Ga0501035_0284458 3300049822 Bacteria 1397
258 Ga0501035_0526852 3300049822 Bacteria 970
259 Ga0501044_0004706 3300049823 Bacteria 15256
260 Ga0501044_0009890 3300049823 Bacteria 10364
261 Ga0501044_0214625 3300049823 Bacteria 1877
262 Ga0501045_0009335 3300049824 Bacteria 6858
263 Ga0501045_0032355 3300049824 Bacteria 3790
264 nmdc:mga0yw44_4236_c1 3300050492 Bacteria 6537
265 nmdc:mga0yw44_932_c1 3300050492 Bacteria 11093
266 nmdc:mga05p37_161477_c1 3300050507 Bacteria 2737
267 nmdc:mga05p37_621053_c1 3300050507 Bacteria 1216
268 nmdc:mga05p37_65373_c1 3300050507 Bacteria 4475
269 nmdc:mga09592_165441_c1 3300050508 Bacteria 1911
270 nmdc:mga0qj67_188147_c1 3300050509 Bacteria 1678
271 nmdc:mga0qj67_66940_c1 3300050509 Bacteria 2861
272 nmdc:mga06r32_184012_c1 3300050510 Bacteria 2076
273 nmdc:mga08y16_26742_c1 3300050511 Bacteria 6079
274 nmdc:mga08y16_315641_c1 3300050511 Bacteria 1609
275 nmdc:mga08y16_38565_c1 3300050511 Bacteria 5017
276 Ga0495601_0069439 3300053077 Bacteria 2247
277 Ga0495601_0147947 3300053077 Bacteria 1533
278 Ga0495595_0075356 3300053084 Bacteria 1600
279 Ga0495619_0034100 3300053085 Bacteria 3308
280 Ga0495619_0061899 3300053085 Bacteria 2491
281 Ga0500566_0003388 3300053094 Bacteria 9514
282 Ga0500616_0000506 3300053153 Bacteria 49867
283 Ga0501084_0189485 3300054114 Bacteria 1735
284 Ga0501082_0068958 3300060353 Bacteria 3045
285 Ga0501082_0314294 3300060353 Bacteria 1364
286 Ga0501082_0729160 3300060353 Bacteria 867
287 Ga0466962_0008142 3300061719 Bacteria 5026
288 Ga0466962_0067252 3300061719 Bacteria 1711
289 Ga0466962_0153979 3300061719 Bacteria 1116
290 Ga0530510_0092660 3300061734 Bacteria 2205
291 Ga0070713_100190038
292 Ga0070658_10087189
293 Ga0070683_100134432
294 Ga0070671_100000694
295 Ga0070674_100275610
296 Ga0070667_100003044
297 Ga0070667_100398065
298 Ga0070714_100000100
299 Ga0070711_100124855
300 Ga0070678_100612827
301 Ga0070681_10403568
302 Ga0070672_100114688
303 Ga0070695_100050601
304 Ga0068855_100486115
305 Ga0068854_100171810
306 Ga0068859_100001908
307 Ga0068861_100182521
308 Ga0068863_100065347
309 Ga0068858_100025612
310 Ga0068860_100024603
311 Ga0081455_10005527
312 Ga0081455_10051611
313 Ga0081455_10194758
314 Ga0081539_10024431
315 Ga0075365_10147568
316 Ga0075363_100089276
317 Ga0075364_10083223
318 Ga0075430_100259393
319 Ga0075430_100261402
320 Ga0075430_100383671
321 Ga0075430_100425868
322 Ga0075431_100584938
323 Ga0075429_100392842
324 Ga0097620_100001908
325 Ga0105240_10046121
326 Ga0105240_10170913
327 Ga0111539_10064597
328 Ga0111539_10127209
329 Ga0111539_10358681
330 Ga0111539_10369178
331 Ga0105245_10274389
332 Ga0105247_10003554
333 Ga0114129_10408892
334 Ga0114129_10593793
335 Ga0105248_10293576
336 Ga0105237_10216631
337 Ga0105238_10174506
338 Ga0105249_10050777
339 Ga0105239_10009011
340 Ga0105239_10036692
341 Ga0105239_10622327
342 Ga0105239_11299550
343 Ga0157369_10018675
344 Ga0157378_10250266
345 Ga0157372_10000769
346 Ga0157375_10157112
347 Ga0157375_10799847
348 Ga0163163_10378270
349 Ga0157380_10364744
350 Ga0157380_10575545
351 Ga0157379_10767340
352 Ga0163161_10186934
353 Ga0206354_10664327
354 Ga0206353_10191839
355 Ga0206353_10585456
356 Ga0206353_11888417
357 Ga0207710_10002158
358 Ga0207705_10191362
359 Ga0207707_10467574
360 Ga0207695_10041590
361 Ga0207695_10106371
362 Ga0207671_10060875
363 Ga0207652_10337864
364 Ga0207694_10109703
365 Ga0207664_10000002
366 Ga0207644_10072256
367 Ga0207669_10093676
368 Ga0207691_10096529
369 Ga0207711_10431557
370 Ga0207661_10093557
371 Ga0207667_10198784
372 Ga0207712_10027021
373 Ga0207712_10265091
374 Ga0207668_10135997
375 Ga0207658_10335546
376 Ga0207677_10230777
377 Ga0207703_10013495
378 Ga0207703_10224431
379 Ga0207702_10033017
380 Ga0207641_10059727
381 Ga0207648_10778538
382 Ga0207675_100052376
383 Ga0207675_100054570
384 Ga0207683_10298216
385 Ga0207428_10060970
386 Ga0207428_10065437
387 Ga0207428_10165037
388 Ga0207428_10183223
389 Ga0268266_10235110
390 Ga0268264_10097687
391 Ga0268264_10563563
392 Ga0265338_10061261
393 Ga0265327_10015065
394 Ga0265327_10041824
395 Ga0316576_10087341
396 Ga0316578_10168462
397 Ga0307415_100670777
398 Ga0316583_10029578
399 Ga0373930_0000279
400 Ga0373948_0017395
401 Ga0373928_0008854
402 Ga0373932_0001148
403 Ga0316574_0009528
404 Ga0316574_0021767
405 Ga0316574_0141270
406 Ga0373931_0000068
407 Ga0373931_0000536
408 Ga0373927_0068641
409 Ga0373933_0316181
410 Ga0395901_0499679
411 Ga0439436_0067731
412 Ga0451853_0188487
413 Ga0439435_0036516
414 Ga0466965_0253953
415 Ga0466966_0040182
416 Ga0466966_0213215
417 Ga0466961_0007436
418 Ga0466961_0021754
419 Ga0466961_0424080
420 Ga0466963_0018186
421 Ga0466963_0108370
422 Ga0466963_0125346
423 Ga0466963_0149534
424 Ga0466971_0004151
425 Ga0466971_0043686
426 Ga0466970_0013868
427 Ga0466957_0039722
428 Ga0466957_0056394
429 Ga0466957_0070392
430 Ga0466960_0010070
431 Ga0466960_0028532
432 Ga0466960_0176571
433 Ga0466958_0001235
434 Ga0466958_0049625
435 Ga0466958_0068882
436 Ga0466958_0169649
437 Ga0466967_0007110
438 Ga0466967_0017396
439 Ga0466967_0033948
440 Ga0466967_0039502
441 Ga0466967_0055828
442 Ga0466967_0173934
443 Ga0466967_0177055
444 Ga0466967_0272414
445 Ga0466967_0945528
446 Ga0495592_0215918
447 Ga0495592_0304767
448 Ga0495594_0119362
449 Ga0495608_0070557
450 Ga0495618_0055026
451 Ga0495618_0534788
452 Ga0495628_0042468
453 Ga0495628_0044459
454 Ga0495630_0167843
455 Ga0495666_0046030
456 Ga0495652_0547475
457 Ga0495667_0066469
458 Ga0495599_0090907
459 Ga0495658_0042840
460 Ga0495624_0214230
461 Ga0495600_0235082
462 Ga0495581_0131238
463 Ga0495674_0024065
464 Ga0495672_0045849
465 Ga0495680_0415123
466 Ga0495675_0037521
467 Ga0495684_0321199
468 Ga0495684_0333475
469 Ga0495602_0443302
470 Ga0496100_0225875
471 Ga0496101_0032009
472 Ga0496101_0158353
473 Ga0496102_0000984
474 Ga0496102_0001990
475 Ga0496102_0239543
476 Ga0496102_0565048
477 Ga0496102_0589252
478 Ga0496103_0000096
479 Ga0496103_0112607
480 Ga0496104_0197059
481 Ga0496104_0429929
482 Ga0496105_0022466
483 Ga0496109_0134875
484 Ga0496109_0232127
485 Ga0496110_0034478
486 Ga0496111_0010607
487 Ga0496112_0244395
488 Ga0496113_0026209
489 Ga0496114_0035630
490 Ga0496117_0189517
491 Ga0496118_0008821
492 Ga0496119_0000125
493 Ga0496120_0003573
494 Ga0496121_0160400
495 Ga0501031_0125574
496 Ga0501032_0000754
497 Ga0501033_0006950
498 Ga0501033_0030710
499 Ga0501033_0185058
500 Ga0501033_0237863
501 Ga0501033_0291768
502 Ga0501034_0020696
503 Ga0501034_0172925
504 Ga0501036_0097398
505 Ga0501037_0001432
506 Ga0501038_0025534
507 Ga0501038_0191627
508 Ga0501039_0165562
509 Ga0501040_0045531
510 Ga0501040_0083358
511 Ga0501040_0221350
512 Ga0501041_0052761
513 Ga0501041_0070860
514 Ga0501041_0109299
515 Ga0501041_0183590
516 Ga0501042_0137352
517 Ga0501042_0192411
518 Ga0501042_0252477
519 Ga0501043_0004585
520 Ga0501043_0104139
521 Ga0501043_0165502
522 Ga0501046_0296513
523 Ga0501047_0080388
524 Ga0501047_0372239
525 Ga0501048_0173788
526 Ga0501070_0008564
527 Ga0501070_0090310
528 Ga0501070_0322967
529 Ga0501071_0145604
530 Ga0501071_0480112
531 Ga0501072_0146219
532 Ga0501074_0047722
533 Ga0501074_0198661
534 Ga0501075_0006854
535 Ga0501075_0118034
536 Ga0501076_0092932
537 Ga0501076_0126395
538 Ga0501079_0087331
539 Ga0501079_0259823
540 Ga0501079_0370644
541 Ga0501080_0381867
542 Ga0501081_0042755
543 Ga0501081_0156953
544 Ga0501081_0199428
545 Ga0501035_0130067
546 Ga0501035_0204935
547 Ga0501035_0284458
548 Ga0501035_0526852
549 Ga0501044_0004706
550 Ga0501044_0009890
551 Ga0501044_0214625
552 Ga0501045_0009335
553 Ga0501045_0032355
554 nmdc:mga0yw44_4236_c1
555 nmdc:mga0yw44_932_c1
556 nmdc:mga05p37_161477_c1
557 nmdc:mga05p37_621053_c1
558 nmdc:mga05p37_65373_c1
559 nmdc:mga09592_165441_c1
560 nmdc:mga0qj67_188147_c1
561 nmdc:mga0qj67_66940_c1
562 nmdc:mga06r32_184012_c1
563 nmdc:mga08y16_26742_c1
564 nmdc:mga08y16_315641_c1
565 nmdc:mga08y16_38565_c1
566 Ga0495601_0069439
567 Ga0495601_0147947
568 Ga0495595_0075356
569 Ga0495619_0034100
570 Ga0495619_0061899
571 Ga0500566_0003388
572 Ga0500616_0000506
573 Ga0501084_0189485
574 Ga0501082_0068958
575 Ga0501082_0314294
576 Ga0501082_0729160
577 Ga0466962_0008142
578 Ga0466962_0067252
579 Ga0466962_0153979
580 Ga0530510_0092660

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00795

CN_hydrolase

Carbon-nitrogen hydrolase

2

245

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3p8k-assembly1.cif.gz_B crystal structure of a putative carbon-nitrogen family hydrolase from staphylococcus aureus 0.9503 1 251
2e11-assembly2.cif.gz_D the crystal structure of xc1258 from xanthomonas campestris: a cn-hydrolase superfamily protein with an arsenic adduct in the active site 0.9455 1 252
2w1v-assembly1.cif.gz_B crystal structure of mouse nitrilase-2 at 1.4a resolution 0.9398 2 251
5h8l-assembly2.cif.gz_I crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) c158s mutant in complex with putrescine 0.929 1 254
6mg6-assembly2.cif.gz_D crystal structure of carbon-nitrogen hydrolase from helicobacter pylori g27 0.9289 1 251
ID Description Score Start End Superfamily
af_Q2FWM9_1_261_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9476 1 256 3.60.110.10
2e11D00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9455 1 252 3.60.110.10
af_Q2FWM9_1_261_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.944 1 256 3.60.110.10
af_O59829_1_271_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9439 1 253 3.60.110.10
af_Q9VHE4_6_282_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9384 2 251 3.60.110.10
ID Description Score Start End GO Terms
AF-A0A7C7XA41-F1-model_v4 Carbon-nitrogen family hydrolase 0.9899 1 147 GO:0050152
GO:0106008
AF-A0A359F1J9-F1-model_v4 Carbon-nitrogen hydrolase 0.9875 1 251 GO:0050152
GO:0106008
AF-A0A6J6FYS3-F1-model_v4 Unannotated protein 0.9868 11 251 GO:0050152
GO:0106008
AF-A0A3A0FD55-F1-model_v4 Carbon-nitrogen hydrolase 0.9852 92 252 GO:0050152
GO:0106008
AF-A0A3C2CJI1-F1-model_v4 Carbon-nitrogen hydrolase 0.9835 1 99 GO:0050152
GO:0106008

Map