F389586

General Info

Members Datasets Scaffolds Average Seq Length
290 163 580 303

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100318409|Ga0068869_1003184091
Length 347
Sequence VVGSHFSTYHFRMARHHALGLHSRLLAASIVVVSLATAFGCRGRASVDPAARDVASATKETESWRAMHEESYRRNWATIAGLHVLETGSQTAGAAPGNDIVLPASASSPRIGRFVLSGEVVRFEPDAAAHVHIGDRSVTTPVDLIDDEADTPDELEVGGIRMMVHRSGQRKALRVWDPQGEQARGFLGFRWFPIQMEYRVTARFIRDAAARDVRVVNTFGDVDRYKTEGVVEFALGGRTLRLRPFTTRPKRFYFVFRDRSSGEETYEAARFLYSDLRDDGTTVLDFNQAYNPPCAFNPYTTCPIPLPENRLDVKVLAGERAYPVHVGSDPATTRLRGQTPVQPDSRP

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
109 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
113 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
114 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
117 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
118 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
119 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
120 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
123 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
124 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
125 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
126 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
127 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
137 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
138 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
139 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
140 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
141 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
142 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
143 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
144 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
146 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
147 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
150 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
151 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
155 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
156 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
157 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
158 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
159 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
160 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
161 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
162 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
163 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.69
Nodule 0
Rhizoplane 2.07
Rhizosphere 97.24
Stem 0
Stem Tuber 0
Unclassified 15.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100318409 3300005334 Unclassified 1261
2 MBSR1b_contig_3248837 2162886012 Bacteria 1005
3 JGI24746J21847_1018932 3300001977 Bacteria 972
4 Ga0065712_10011968 3300005290 Bacteria 3210
5 Ga0065712_10152260 3300005290 Bacteria 1360
6 Ga0065715_10101409 3300005293 Bacteria 3206
7 Ga0065707_10014172 3300005295 Bacteria 1769
8 Ga0065707_10021865 3300005295 Unclassified 1621
9 Ga0070676_10272610 3300005328 Bacteria 1137
10 Ga0070690_100024525 3300005330 Bacteria 3708
11 Ga0070670_100006296 3300005331 Bacteria 10050
12 Ga0070670_100032201 3300005331 Unclassified 4515
13 Ga0070670_100195489 3300005331 Bacteria 1757
14 Ga0070677_10005043 3300005333 Unclassified 4336
15 Ga0070677_10015901 3300005333 Bacteria 2671
16 Ga0070677_10020668 3300005333 Bacteria 2402
17 Ga0068869_100002862 3300005334 Bacteria 10468
18 Ga0070666_10002775 3300005335 Bacteria 10577
19 Ga0070666_10011346 3300005335 Bacteria 5590
20 Ga0068868_100005150 3300005338 Bacteria 9176
21 Ga0070687_100036548 3300005343 Bacteria 2448
22 Ga0070687_100199185 3300005343 Unclassified 1212
23 Ga0070661_100055650 3300005344 Bacteria 2896
24 Ga0070668_100032790 3300005347 Unclassified 3952
25 Ga0070669_100024135 3300005353 Unclassified 4358
26 Ga0070675_100220361 3300005354 Bacteria 1652
27 Ga0070671_100004861 3300005355 Bacteria 10686
28 Ga0070671_100040155 3300005355 Bacteria 3886
29 Ga0070671_100250278 3300005355 Unclassified 1505
30 Ga0070674_100028026 3300005356 Bacteria 3696
31 Ga0070674_100080621 3300005356 Bacteria 2324
32 Ga0070673_100139517 3300005364 Bacteria 2043
33 Ga0070688_100067344 3300005365 Bacteria 2281
34 Ga0070688_100205300 3300005365 Unclassified 1381
35 Ga0070667_100006858 3300005367 Bacteria 9461
36 Ga0070667_100013394 3300005367 Bacteria 6778
37 Ga0070700_100132486 3300005441 Bacteria 1684
38 Ga0070694_100145877 3300005444 Bacteria 1724
39 Ga0070678_100054385 3300005456 Bacteria 2917
40 Ga0070662_100013079 3300005457 Bacteria 5516
41 Ga0070684_100101353 3300005535 Bacteria 2573
42 Ga0070686_100024680 3300005544 Unclassified 3606
43 Ga0070686_100213168 3300005544 Bacteria 1391
44 Ga0070704_100184686 3300005549 Bacteria 1671
45 Ga0070664_100001548 3300005564 Bacteria 18400
46 Ga0070664_100064483 3300005564 Bacteria 3124
47 Ga0068856_100106865 3300005614 Bacteria 2794
48 Ga0070702_100022570 3300005615 Bacteria 3329
49 Ga0068852_100170954 3300005616 Bacteria 2037
50 Ga0068859_100007850 3300005617 Bacteria 10832
51 Ga0068859_100135333 3300005617 Bacteria 2537
52 Ga0068859_100160252 3300005617 Bacteria 2329
53 Ga0068864_100035999 3300005618 Bacteria 4217
54 Ga0068861_100085649 3300005719 Unclassified 2475
55 Ga0068870_10012957 3300005840 Unclassified 3907
56 Ga0068870_10144075 3300005840 Bacteria 1397
57 Ga0068863_100040961 3300005841 Bacteria 4403
58 Ga0068858_100084392 3300005842 Bacteria 2954
59 Ga0068860_100065795 3300005843 Bacteria 3442
60 Ga0068862_100023342 3300005844 Bacteria 5182
61 Ga0081539_10000010 3300005985 Bacteria 484386
62 Ga0081539_10001689 3300005985 Bacteria 35619
63 Ga0081539_10052093 3300005985 Bacteria 2302
64 Ga0068871_100052176 3300006358 Bacteria 3311
65 Ga0075428_100009894 3300006844 Bacteria 10593
66 Ga0075428_100011630 3300006844 Bacteria 9792
67 Ga0075428_100016028 3300006844 Bacteria 8287
68 Ga0075428_100018455 3300006844 Bacteria 7712
69 Ga0075430_100001079 3300006846 Bacteria 21627
70 Ga0075430_100003929 3300006846 Bacteria 12538
71 Ga0075430_100011299 3300006846 Bacteria 7572
72 Ga0075430_100034022 3300006846 Bacteria 4324
73 Ga0075430_100037877 3300006846 Bacteria 4088
74 Ga0075430_100080385 3300006846 Unclassified 2731
75 Ga0075430_100092596 3300006846 Bacteria 2527
76 Ga0075430_100105531 3300006846 Bacteria 2351
77 Ga0075431_100028838 3300006847 Bacteria 5707
78 Ga0075431_100460471 3300006847 Bacteria 1266
79 Ga0075433_10000460 3300006852 Bacteria 26456
80 Ga0075433_10142966 3300006852 Bacteria 2127
81 Ga0075433_10271095 3300006852 Unclassified 1504
82 Ga0075434_100000561 3300006871 Bacteria 28555
83 Ga0075434_100023513 3300006871 Bacteria 6008
84 Ga0075434_100109227 3300006871 Bacteria 2776
85 Ga0075429_100007216 3300006880 Bacteria 9645
86 Ga0075429_100007889 3300006880 Bacteria 9247
87 Ga0075429_100044693 3300006880 Bacteria 3852
88 Ga0075429_100154004 3300006880 Bacteria 2013
89 Ga0075429_100298351 3300006880 Unclassified 1411
90 Ga0068865_100038118 3300006881 Bacteria 3251
91 Ga0097620_100007850 3300006931 Bacteria 10832
92 Ga0097620_100135328 3300006931 Bacteria 2537
93 Ga0097620_100160244 3300006931 Bacteria 2329
94 Ga0075435_100052326 3300007076 Bacteria 3292
95 Ga0075435_100264088 3300007076 Bacteria 1467
96 Ga0111539_10000562 3300009094 Bacteria 47603
97 Ga0111539_10006199 3300009094 Bacteria 15432
98 Ga0111539_10008585 3300009094 Bacteria 12974
99 Ga0111539_10107604 3300009094 Bacteria 3272
100 Ga0111539_10255536 3300009094 Bacteria 2040
101 Ga0111539_10398069 3300009094 Unclassified 1604
102 Ga0111539_10700021 3300009094 Bacteria 1179
103 Ga0105245_10004713 3300009098 Bacteria 12052
104 Ga0105247_10028465 3300009101 Bacteria 3381
105 Ga0114129_10007474 3300009147 Bacteria 15564
106 Ga0114129_10021198 3300009147 Bacteria 9230
107 Ga0114129_10034087 3300009147 Bacteria 7192
108 Ga0114129_10037076 3300009147 Bacteria 6884
109 Ga0114129_10040134 3300009147 Bacteria 6599
110 Ga0114129_10208254 3300009147 Bacteria 2645
111 Ga0105248_10266790 3300009177 Bacteria 1927
112 Ga0105248_10736938 3300009177 Bacteria 1112
113 Ga0105238_10067548 3300009551 Bacteria 3576
114 Ga0105249_10000979 3300009553 Bacteria 25316
115 Ga0105249_10507343 3300009553 Unclassified 1252
116 Ga0105249_10603835 3300009553 Bacteria 1152
117 Ga0105239_10357283 3300010375 Bacteria 1649
118 Ga0105246_10005945 3300011119 Bacteria 7450
119 Ga0105246_10041179 3300011119 Bacteria 3121
120 Ga0157374_10073481 3300013296 Bacteria 3228
121 Ga0157374_10141895 3300013296 Bacteria 2332
122 Ga0157378_10251403 3300013297 Bacteria 1692
123 Ga0157378_10297797 3300013297 Bacteria 1560
124 Ga0163162_10025891 3300013306 Bacteria 5797
125 Ga0163162_10070547 3300013306 Bacteria 3545
126 Ga0157375_10008623 3300013308 Bacteria 8927
127 Ga0157375_10057500 3300013308 Bacteria 3845
128 Ga0157375_10111533 3300013308 Bacteria 2834
129 Ga0157375_10330585 3300013308 Bacteria 1689
130 Ga0163163_10054040 3300014325 Bacteria 3966
131 Ga0157380_10002809 3300014326 Bacteria 11835
132 Ga0157380_10030578 3300014326 Unclassified 4126
133 Ga0157380_10100065 3300014326 Bacteria 2412
134 Ga0157377_10003930 3300014745 Bacteria 6771
135 Ga0157377_10011110 3300014745 Bacteria 4483
136 Ga0157377_10013367 3300014745 Unclassified 4153
137 Ga0157379_10012436 3300014968 Bacteria 7431
138 Ga0163161_10147968 3300017792 Unclassified 1783
139 Ga0207697_10000813 3300025315 Bacteria 17691
140 Ga0207656_10118441 3300025321 Bacteria 1230
141 Ga0207682_10007622 3300025893 Bacteria 4306
142 Ga0207682_10007743 3300025893 Unclassified 4268
143 Ga0207682_10039921 3300025893 Bacteria 1910
144 Ga0207688_10027138 3300025901 Unclassified 3150
145 Ga0207688_10134232 3300025901 Unclassified 1453
146 Ga0207680_10053915 3300025903 Bacteria 2416
147 Ga0207645_10001480 3300025907 Bacteria 19207
148 Ga0207643_10005225 3300025908 Bacteria 6944
149 Ga0207643_10013984 3300025908 Unclassified 4354
150 Ga0207643_10138560 3300025908 Bacteria 1452
151 Ga0207662_10015806 3300025918 Bacteria 4251
152 Ga0207681_10043668 3300025923 Bacteria 3001
153 Ga0207650_10043030 3300025925 Bacteria 3313
154 Ga0207650_10336421 3300025925 Bacteria 1239
155 Ga0207659_10058819 3300025926 Bacteria 2760
156 Ga0207644_10110915 3300025931 Bacteria 2074
157 Ga0207706_10013787 3300025933 Bacteria 7336
158 Ga0207670_10033267 3300025936 Unclassified 3321
159 Ga0207669_10089956 3300025937 Bacteria 1995
160 Ga0207691_10005411 3300025940 Bacteria 12320
161 Ga0207691_10085734 3300025940 Bacteria 2827
162 Ga0207711_10033218 3300025941 Bacteria 4364
163 Ga0207689_10041266 3300025942 Bacteria 3818
164 Ga0207689_10043697 3300025942 Unclassified 3704
165 Ga0207679_10008426 3300025945 Bacteria 6568
166 Ga0207651_10016598 3300025960 Bacteria 4320
167 Ga0207651_10044688 3300025960 Bacteria 2967
168 Ga0207668_10044571 3300025972 Bacteria 3019
169 Ga0207658_10218187 3300025986 Unclassified 1603
170 Ga0207703_10182911 3300026035 Unclassified 1851
171 Ga0207703_10320582 3300026035 Bacteria 1419
172 Ga0207678_10034679 3300026067 Bacteria 4395
173 Ga0207708_10002011 3300026075 Bacteria 14972
174 Ga0207641_10006550 3300026088 Bacteria 9791
175 Ga0207648_10016513 3300026089 Bacteria 6742
176 Ga0207648_10124807 3300026089 Bacteria 2264
177 Ga0207675_100025972 3300026118 Bacteria 5451
178 Ga0207683_10071283 3300026121 Bacteria 3072
179 Ga0207428_10000144 3300027907 Bacteria 96684
180 Ga0207428_10004622 3300027907 Bacteria 13054
181 Ga0207428_10004813 3300027907 Bacteria 12749
182 Ga0207428_10041294 3300027907 Bacteria 3735
183 Ga0207428_10042819 3300027907 Bacteria 3660
184 Ga0268264_10627427 3300028381 Unclassified 1062
185 Ga0307408_100141157 3300031548 Bacteria 1891
186 Ga0307413_10013596 3300031824 Bacteria 4098
187 Ga0307406_10088386 3300031901 Unclassified 2079
188 Ga0307412_10032841 3300031911 Bacteria 3293
189 Ga0307409_100688418 3300031995 Bacteria 1020
190 Ga0307416_100028598 3300032002 Bacteria 4148
191 Ga0307416_100046115 3300032002 Bacteria 3437
192 Ga0307414_10124638 3300032004 Bacteria 1988
193 Ga0307411_10105037 3300032005 Bacteria 2007
194 Ga0307411_10108028 3300032005 Unclassified 1984
195 Ga0307415_100011657 3300032126 Bacteria 5043
196 Ga0307415_100123141 3300032126 Bacteria 1948
197 Ga0373937_0033050 3300036401 Bacteria 4695
198 Ga0373937_0278949 3300036401 Bacteria 1578
199 Ga0439451_034461 3300042009 Unclassified 1018
200 Ga0439435_0003498 3300042436 Bacteria 3275
201 Ga0439464_0005074 3300042439 Unclassified 3387
202 Ga0451576_0021324 3300045051 Bacteria 7041
203 Ga0495656_0038442 3300046615 Bacteria 1982
204 Ga0495658_0151213 3300046683 Bacteria 1426
205 Ga0495669_0157247 3300046684 Unclassified 1078
206 Ga0496102_0255312 3300048905 Bacteria 1653
207 Ga0496104_0065146 3300048907 Bacteria 3457
208 Ga0496109_0071563 3300048912 Bacteria 3184
209 Ga0496112_0254741 3300048915 Bacteria 1705
210 Ga0496113_0272925 3300048916 Unclassified 1352
211 Ga0496115_0042568 3300048918 Bacteria 3618
212 Ga0501291_018814 3300049514 Unclassified 1078
213 Ga0501299_021341 3300049522 Unclassified 1187
214 Ga0501031_0139912 3300049568 Bacteria 1582
215 Ga0501036_0012797 3300049572 Bacteria 6962
216 Ga0501038_0173567 3300049574 Bacteria 1743
217 Ga0501039_0035627 3300049575 Bacteria 3841
218 Ga0501039_0055765 3300049575 Bacteria 3061
219 Ga0501040_0014493 3300049576 Bacteria 5196
220 Ga0501041_0003158 3300049577 Bacteria 9475
221 Ga0501041_0070086 3300049577 Bacteria 2152
222 Ga0501042_0001032 3300049578 Bacteria 15873
223 Ga0501042_0017196 3300049578 Bacteria 4983
224 Ga0501043_0045510 3300049579 Bacteria 3452
225 Ga0501048_0012287 3300049582 Bacteria 6373
226 Ga0501048_0082977 3300049582 Bacteria 2260
227 Ga0501067_0054803 3300049583 Bacteria 2209
228 Ga0501070_0182901 3300049586 Bacteria 1725
229 Ga0501071_0006773 3300049587 Bacteria 7460
230 Ga0501071_0055518 3300049587 Bacteria 2859
231 Ga0501071_0126261 3300049587 Bacteria 1899
232 Ga0501074_0071654 3300049590 Archaea 2491
233 Ga0501075_0007854 3300049591 Bacteria 7407
234 Ga0501075_0030830 3300049591 Bacteria 3975
235 Ga0501076_0008435 3300049592 Bacteria 7552
236 Ga0501235_039721 3300049669 Unclassified 1075
237 Ga0501225_0066973 3300049705 Unclassified 1016
238 Ga0501079_0009287 3300049741 Bacteria 7453
239 Ga0501080_0295477 3300049742 Bacteria 1470
240 Ga0501081_0001518 3300049743 Bacteria 14266
241 Ga0501081_0003124 3300049743 Bacteria 10522
242 Ga0501045_0002069 3300049824 Bacteria 13552
243 Ga0501045_0057676 3300049824 Bacteria 2842
244 nmdc:mga05p37_113559_c1 3300050507 Bacteria 3330
245 nmdc:mga05p37_136358_c1 3300050507 Bacteria 3009
246 nmdc:mga05p37_27312_c1 3300050507 Bacteria 6949
247 nmdc:mga05p37_34447_c1 3300050507 Bacteria 6203
248 nmdc:mga05p37_541231_c1 3300050507 Bacteria 1328
249 nmdc:mga05p37_679_c1 3300050507 Bacteria 37674
250 nmdc:mga09592_121481_c1 3300050508 Bacteria 2244
251 nmdc:mga09592_169472_c1 3300050508 Unclassified 1888
252 nmdc:mga09592_22200_c1 3300050508 Bacteria 5238
253 nmdc:mga09592_255894_c1 3300050508 Bacteria 1518
254 nmdc:mga09592_41911_c1 3300050508 Bacteria 3851
255 nmdc:mga0qj67_297144_c1 3300050509 Bacteria 1309
256 nmdc:mga0qj67_41775_c1 3300050509 Bacteria 3608
257 nmdc:mga0qj67_4618_c1 3300050509 Bacteria 9990
258 nmdc:mga0qj67_76918_c1 3300050509 Unclassified 2670
259 nmdc:mga0qj67_92340_c1 3300050509 Bacteria 2434
260 nmdc:mga06r32_170735_c1 3300050510 Bacteria 2159
261 nmdc:mga06r32_25897_c1 3300050510 Bacteria 5462
262 nmdc:mga06r32_35937_c1 3300050510 Unclassified 4677
263 nmdc:mga06r32_65619_c1 3300050510 Bacteria 3502
264 nmdc:mga06r32_7014_c1 3300050510 Bacteria 10136
265 nmdc:mga08y16_1178_c1 3300050511 Bacteria 25815
266 nmdc:mga08y16_188336_c1 3300050511 Unclassified 2141
267 nmdc:mga08y16_275432_c1 3300050511 Bacteria 1737
268 nmdc:mga08y16_2889_c1 3300050511 Bacteria 17675
269 nmdc:mga08y16_639211_c1 3300050511 Bacteria 1069
270 nmdc:mga08y16_671_c1 3300050511 Bacteria 32362
271 nmdc:mga08y16_84903_c1 3300050511 Unclassified 3300
272 nmdc:mga0n895_17965_c1 3300050512 Bacteria 6536
273 nmdc:mga0n895_28090_c1 3300050512 Bacteria 5350
274 nmdc:mga0n895_348304_c1 3300050512 Bacteria 1500
275 nmdc:mga0rr50_41685_c1 3300050513 Bacteria 3347
276 nmdc:mga0a205_111992_c1 3300050515 Unclassified 2628
277 nmdc:mga0a205_18104_c1 3300050515 Bacteria 6619
278 nmdc:mga0a205_2492_c1 3300050515 Bacteria 16226
279 Ga0500641_0002526 3300053096 Bacteria 6467
280 Ga0500555_019263 3300053103 Bacteria 1966
281 Ga0501084_0069732 3300054114 Bacteria 2943
282 Ga0590071_001846 3300059421 Bacteria 5461
283 Ga0590071_003725 3300059421 Bacteria 3741
284 Ga0590074_001927 3300059423 Bacteria 3387
285 Ga0590077_000258 3300059426 Bacteria 15108
286 Ga0590077_009033 3300059426 Bacteria 2040
287 Ga0501082_0001901 3300060353 Bacteria 18362
288 Ga0530510_0005914 3300061734 Bacteria 8479
289 Ga0530510_0031270 3300061734 Bacteria 3827
290 Ga0530510_0210407 3300061734 Bacteria 1445
291 Ga0068869_100318409
292 MBSR1b_contig_3248837
293 JGI24746J21847_1018932
294 Ga0065712_10011968
295 Ga0065712_10152260
296 Ga0065715_10101409
297 Ga0065707_10014172
298 Ga0065707_10021865
299 Ga0070676_10272610
300 Ga0070690_100024525
301 Ga0070670_100006296
302 Ga0070670_100032201
303 Ga0070670_100195489
304 Ga0070677_10005043
305 Ga0070677_10015901
306 Ga0070677_10020668
307 Ga0068869_100002862
308 Ga0070666_10002775
309 Ga0070666_10011346
310 Ga0068868_100005150
311 Ga0070687_100036548
312 Ga0070687_100199185
313 Ga0070661_100055650
314 Ga0070668_100032790
315 Ga0070669_100024135
316 Ga0070675_100220361
317 Ga0070671_100004861
318 Ga0070671_100040155
319 Ga0070671_100250278
320 Ga0070674_100028026
321 Ga0070674_100080621
322 Ga0070673_100139517
323 Ga0070688_100067344
324 Ga0070688_100205300
325 Ga0070667_100006858
326 Ga0070667_100013394
327 Ga0070700_100132486
328 Ga0070694_100145877
329 Ga0070678_100054385
330 Ga0070662_100013079
331 Ga0070684_100101353
332 Ga0070686_100024680
333 Ga0070686_100213168
334 Ga0070704_100184686
335 Ga0070664_100001548
336 Ga0070664_100064483
337 Ga0068856_100106865
338 Ga0070702_100022570
339 Ga0068852_100170954
340 Ga0068859_100007850
341 Ga0068859_100135333
342 Ga0068859_100160252
343 Ga0068864_100035999
344 Ga0068861_100085649
345 Ga0068870_10012957
346 Ga0068870_10144075
347 Ga0068863_100040961
348 Ga0068858_100084392
349 Ga0068860_100065795
350 Ga0068862_100023342
351 Ga0081539_10000010
352 Ga0081539_10001689
353 Ga0081539_10052093
354 Ga0068871_100052176
355 Ga0075428_100009894
356 Ga0075428_100011630
357 Ga0075428_100016028
358 Ga0075428_100018455
359 Ga0075430_100001079
360 Ga0075430_100003929
361 Ga0075430_100011299
362 Ga0075430_100034022
363 Ga0075430_100037877
364 Ga0075430_100080385
365 Ga0075430_100092596
366 Ga0075430_100105531
367 Ga0075431_100028838
368 Ga0075431_100460471
369 Ga0075433_10000460
370 Ga0075433_10142966
371 Ga0075433_10271095
372 Ga0075434_100000561
373 Ga0075434_100023513
374 Ga0075434_100109227
375 Ga0075429_100007216
376 Ga0075429_100007889
377 Ga0075429_100044693
378 Ga0075429_100154004
379 Ga0075429_100298351
380 Ga0068865_100038118
381 Ga0097620_100007850
382 Ga0097620_100135328
383 Ga0097620_100160244
384 Ga0075435_100052326
385 Ga0075435_100264088
386 Ga0111539_10000562
387 Ga0111539_10006199
388 Ga0111539_10008585
389 Ga0111539_10107604
390 Ga0111539_10255536
391 Ga0111539_10398069
392 Ga0111539_10700021
393 Ga0105245_10004713
394 Ga0105247_10028465
395 Ga0114129_10007474
396 Ga0114129_10021198
397 Ga0114129_10034087
398 Ga0114129_10037076
399 Ga0114129_10040134
400 Ga0114129_10208254
401 Ga0105248_10266790
402 Ga0105248_10736938
403 Ga0105238_10067548
404 Ga0105249_10000979
405 Ga0105249_10507343
406 Ga0105249_10603835
407 Ga0105239_10357283
408 Ga0105246_10005945
409 Ga0105246_10041179
410 Ga0157374_10073481
411 Ga0157374_10141895
412 Ga0157378_10251403
413 Ga0157378_10297797
414 Ga0163162_10025891
415 Ga0163162_10070547
416 Ga0157375_10008623
417 Ga0157375_10057500
418 Ga0157375_10111533
419 Ga0157375_10330585
420 Ga0163163_10054040
421 Ga0157380_10002809
422 Ga0157380_10030578
423 Ga0157380_10100065
424 Ga0157377_10003930
425 Ga0157377_10011110
426 Ga0157377_10013367
427 Ga0157379_10012436
428 Ga0163161_10147968
429 Ga0207697_10000813
430 Ga0207656_10118441
431 Ga0207682_10007622
432 Ga0207682_10007743
433 Ga0207682_10039921
434 Ga0207688_10027138
435 Ga0207688_10134232
436 Ga0207680_10053915
437 Ga0207645_10001480
438 Ga0207643_10005225
439 Ga0207643_10013984
440 Ga0207643_10138560
441 Ga0207662_10015806
442 Ga0207681_10043668
443 Ga0207650_10043030
444 Ga0207650_10336421
445 Ga0207659_10058819
446 Ga0207644_10110915
447 Ga0207706_10013787
448 Ga0207670_10033267
449 Ga0207669_10089956
450 Ga0207691_10005411
451 Ga0207691_10085734
452 Ga0207711_10033218
453 Ga0207689_10041266
454 Ga0207689_10043697
455 Ga0207679_10008426
456 Ga0207651_10016598
457 Ga0207651_10044688
458 Ga0207668_10044571
459 Ga0207658_10218187
460 Ga0207703_10182911
461 Ga0207703_10320582
462 Ga0207678_10034679
463 Ga0207708_10002011
464 Ga0207641_10006550
465 Ga0207648_10016513
466 Ga0207648_10124807
467 Ga0207675_100025972
468 Ga0207683_10071283
469 Ga0207428_10000144
470 Ga0207428_10004622
471 Ga0207428_10004813
472 Ga0207428_10041294
473 Ga0207428_10042819
474 Ga0268264_10627427
475 Ga0307408_100141157
476 Ga0307413_10013596
477 Ga0307406_10088386
478 Ga0307412_10032841
479 Ga0307409_100688418
480 Ga0307416_100028598
481 Ga0307416_100046115
482 Ga0307414_10124638
483 Ga0307411_10105037
484 Ga0307411_10108028
485 Ga0307415_100011657
486 Ga0307415_100123141
487 Ga0373937_0033050
488 Ga0373937_0278949
489 Ga0439451_034461
490 Ga0439435_0003498
491 Ga0439464_0005074
492 Ga0451576_0021324
493 Ga0495656_0038442
494 Ga0495658_0151213
495 Ga0495669_0157247
496 Ga0496102_0255312
497 Ga0496104_0065146
498 Ga0496109_0071563
499 Ga0496112_0254741
500 Ga0496113_0272925
501 Ga0496115_0042568
502 Ga0501291_018814
503 Ga0501299_021341
504 Ga0501031_0139912
505 Ga0501036_0012797
506 Ga0501038_0173567
507 Ga0501039_0035627
508 Ga0501039_0055765
509 Ga0501040_0014493
510 Ga0501041_0003158
511 Ga0501041_0070086
512 Ga0501042_0001032
513 Ga0501042_0017196
514 Ga0501043_0045510
515 Ga0501048_0012287
516 Ga0501048_0082977
517 Ga0501067_0054803
518 Ga0501070_0182901
519 Ga0501071_0006773
520 Ga0501071_0055518
521 Ga0501071_0126261
522 Ga0501074_0071654
523 Ga0501075_0007854
524 Ga0501075_0030830
525 Ga0501076_0008435
526 Ga0501235_039721
527 Ga0501225_0066973
528 Ga0501079_0009287
529 Ga0501080_0295477
530 Ga0501081_0001518
531 Ga0501081_0003124
532 Ga0501045_0002069
533 Ga0501045_0057676
534 nmdc:mga05p37_113559_c1
535 nmdc:mga05p37_136358_c1
536 nmdc:mga05p37_27312_c1
537 nmdc:mga05p37_34447_c1
538 nmdc:mga05p37_541231_c1
539 nmdc:mga05p37_679_c1
540 nmdc:mga09592_121481_c1
541 nmdc:mga09592_169472_c1
542 nmdc:mga09592_22200_c1
543 nmdc:mga09592_255894_c1
544 nmdc:mga09592_41911_c1
545 nmdc:mga0qj67_297144_c1
546 nmdc:mga0qj67_41775_c1
547 nmdc:mga0qj67_4618_c1
548 nmdc:mga0qj67_76918_c1
549 nmdc:mga0qj67_92340_c1
550 nmdc:mga06r32_170735_c1
551 nmdc:mga06r32_25897_c1
552 nmdc:mga06r32_35937_c1
553 nmdc:mga06r32_65619_c1
554 nmdc:mga06r32_7014_c1
555 nmdc:mga08y16_1178_c1
556 nmdc:mga08y16_188336_c1
557 nmdc:mga08y16_275432_c1
558 nmdc:mga08y16_2889_c1
559 nmdc:mga08y16_639211_c1
560 nmdc:mga08y16_671_c1
561 nmdc:mga08y16_84903_c1
562 nmdc:mga0n895_17965_c1
563 nmdc:mga0n895_28090_c1
564 nmdc:mga0n895_348304_c1
565 nmdc:mga0rr50_41685_c1
566 nmdc:mga0a205_111992_c1
567 nmdc:mga0a205_18104_c1
568 nmdc:mga0a205_2492_c1
569 Ga0500641_0002526
570 Ga0500555_019263
571 Ga0501084_0069732
572 Ga0590071_001846
573 Ga0590071_003725
574 Ga0590074_001927
575 Ga0590077_000258
576 Ga0590077_009033
577 Ga0501082_0001901
578 Ga0530510_0005914
579 Ga0530510_0031270
580 Ga0530510_0210407

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07920

DUF1684

Protein of unknown function (DUF1684)

184

320

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fj4-assembly2.cif.gz_A crystal structure of the protein q9hre7 complexed with mercury from halobacterium salinarium at the resolution 2.1a, northeast structural genomics consortium target hsr50 0.9198 144 281
4fj4-assembly1.cif.gz_B crystal structure of the protein q9hre7 complexed with mercury from halobacterium salinarium at the resolution 2.1a, northeast structural genomics consortium target hsr50 0.892 138 284
2lok-assembly1.cif.gz_A solution nmr structure of the uncharacterized protein from gene locus vng_0733h of halobacterium salinarium, northeast structural genomics consortium target hsr50 0.8707 144 282
4dlh-assembly2.cif.gz_B crystal structure of the protein q9hre7 from halobacterium salinarium at the resolution 1.9a, northeast structural genomics consortium (nesg) target hsr50 0.8658 138 281
5fwh-assembly1.cif.gz_A n-terminal fha domain from essc a component of the bacterial type vii secretion apparatus 0.8219 44 141
ID Description Score Start End Superfamily
af_A2VEV2_3_96_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.7822 47 119 2.60.200.20
af_B7Z0D7_3_100_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.7819 47 119 2.60.200.20
af_O65934_209_307_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.7752 47 124 2.60.200.20
af_Q9VX80_16_124_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.7718 45 139 2.60.200.20
af_Q54ST8_470_584_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.7716 47 137 2.60.200.20
ID Description Score Start End GO Terms
AF-A0A523X6C4-F1-model_v4 DUF1684 domain-containing protein 0.9613 17 284
AF-A0A7X3PNH9-F1-model_v4 DUF1684 domain-containing protein 0.9597 140 284
AF-A0A7C6E2V7-F1-model_v4 DUF1684 domain-containing protein 0.9566 17 288
AF-A0A1N6D3V5-F1-model_v4 DUF1684 domain-containing protein 0.9558 142 283 GO:0016020
AF-A0A2E1W2F7-F1-model_v4 DUF1684 domain-containing protein 0.954 38 284

Map