F389444

General Info

Members Datasets Scaffolds Average Seq Length
289 184 289 224

Family's Representative Sequence

Representative Sequence 3300049744|Ga0501083_0317417|Ga0501083_0317417_234_983
Length 249
Sequence MIVALRLIVGNKNYSSWSMRPWIAMKAAGIAFAEEVISLNAPDFKERVSKISGTGKVPVLDDDGVHVWESLAILEYLAERFPAARLWPSDPVARAHARAISSEMHAGFVPLRRACPMNMWRPVKKRDLADDVMANVRRIESMWQQCRERYGAGGPFLFGSFGAADAMYAPVVSRFHTYDVAVGPSARAYMDAVMALPAWAEWYAAALKEPWVLPEDEVDWPQVLKVWASSRLDHARAPNVRQAEAPEPK

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
20 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
24 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
25 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
26 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
52 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
53 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
54 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
81 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
83 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
84 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
85 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
86 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
87 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
90 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
91 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
92 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
93 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
94 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
95 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
96 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
97 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
98 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
102 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
103 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
104 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
105 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
106 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
107 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
108 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
109 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
110 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
111 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
112 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
113 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
114 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
115 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
116 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
117 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
118 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
119 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
120 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
123 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
124 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
125 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
126 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
127 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
128 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
129 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
130 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
131 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
132 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
133 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
134 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
149 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
150 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
158 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
161 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
164 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
165 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
166 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
167 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
168 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
169 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
172 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
173 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
174 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
175 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
176 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
177 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
178 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
179 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
180 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
181 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
182 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
183 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
184 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.27
Nodule 0
Rhizoplane 7.61
Rhizosphere 81.31
Stem 0
Stem Tuber 0
Unclassified 3.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10264933 3300005290 Bacteria 928
2 Ga0070683_100823356 3300005329 Bacteria 890
3 Ga0070690_100109323 3300005330 Bacteria 1843
4 Ga0070670_100224161 3300005331 Bacteria 1636
5 Ga0070670_100260149 3300005331 Bacteria 1513
6 Ga0070670_100506564 3300005331 Bacteria 1074
7 Ga0070689_100020143 3300005340 Bacteria 4946
8 Ga0070689_100062531 3300005340 Bacteria 2897
9 Ga0070661_100179961 3300005344 Bacteria 1608
10 Ga0070668_100300509 3300005347 Bacteria 1346
11 Ga0070669_100044519 3300005353 Bacteria 3234
12 Ga0070675_100112449 3300005354 Bacteria 2306
13 Ga0070671_100275565 3300005355 Bacteria 1430
14 Ga0070674_100315346 3300005356 Bacteria 1252
15 Ga0070674_100477670 3300005356 Bacteria 1034
16 Ga0070700_100173628 3300005441 Bacteria 1494
17 Ga0070678_100030952 3300005456 Bacteria 3685
18 Ga0070681_10159718 3300005458 Bacteria 2178
19 Ga0068867_100335371 3300005459 Bacteria 1257
20 Ga0070684_100358680 3300005535 Bacteria 1341
21 Ga0068853_100226444 3300005539 Bacteria 1709
22 Ga0068853_100575158 3300005539 Bacteria 1069
23 Ga0070672_100363135 3300005543 Bacteria 1236
24 Ga0068862_100590824 3300005844 Bacteria 1065
25 Ga0068862_100996138 3300005844 Bacteria 829
26 Ga0081540_1007483 3300005983 Bacteria 7776
27 Ga0070717_10141832 3300006028 Bacteria 2073
28 Ga0075365_10378229 3300006038 Bacteria 999
29 Ga0075364_10192175 3300006051 Bacteria 1382
30 Ga0075362_10016070 3300006177 Bacteria 3057
31 Ga0075369_10037518 3300006186 Bacteria 2064
32 Ga0075366_10011621 3300006195 Bacteria 4975
33 Ga0075366_10057071 3300006195 Bacteria 2320
34 Ga0097621_100204732 3300006237 Bacteria 1714
35 Ga0075370_10215698 3300006353 Bacteria 1133
36 Ga0075428_100034988 3300006844 Bacteria 5538
37 Ga0075433_10279756 3300006852 Bacteria 1478
38 Ga0075435_100060901 3300007076 Bacteria 3061
39 Ga0105240_10073725 3300009093 Bacteria 4215
40 Ga0111539_10020039 3300009094 Bacteria 8239
41 Ga0111539_10090509 3300009094 Bacteria 3596
42 Ga0111539_10281694 3300009094 Bacteria 1934
43 Ga0111539_10588877 3300009094 Bacteria 1295
44 Ga0105245_10053615 3300009098 Bacteria 3620
45 Ga0105245_10390190 3300009098 Bacteria 1389
46 Ga0105247_10356363 3300009101 Bacteria 1030
47 Ga0114129_10074762 3300009147 Bacteria 4719
48 Ga0114129_10122550 3300009147 Bacteria 3577
49 Ga0105243_10074030 3300009148 Bacteria 2762
50 Ga0105248_10064964 3300009177 Bacteria 4096
51 Ga0105248_10435647 3300009177 Bacteria 1477
52 Ga0105248_10709543 3300009177 Bacteria 1135
53 Ga0105238_10035756 3300009551 Bacteria 5049
54 Ga0105249_10040257 3300009553 Bacteria 4244
55 Ga0105249_10211865 3300009553 Bacteria 1902
56 Ga0105249_10963971 3300009553 Bacteria 921
57 Ga0157373_10003448 3300013100 Bacteria 11963
58 Ga0157373_10009597 3300013100 Bacteria 7143
59 Ga0157370_10281522 3300013104 Bacteria 1536
60 Ga0157378_10109158 3300013297 Bacteria 2534
61 Ga0157378_10185517 3300013297 Bacteria 1959
62 Ga0163162_10644411 3300013306 Bacteria 1183
63 Ga0157375_10620516 3300013308 Bacteria 1239
64 Ga0157375_11274861 3300013308 Bacteria 863
65 Ga0163163_10045685 3300014325 Bacteria 4300
66 Ga0163163_10722470 3300014325 Bacteria 1060
67 Ga0157380_10532152 3300014326 Bacteria 1149
68 Ga0182008_10073729 3300014497 Bacteria 1679
69 Ga0157379_10186333 3300014968 Bacteria 1875
70 Ga0157379_10821620 3300014968 Bacteria 878
71 Ga0157379_11085606 3300014968 Bacteria 766
72 Ga0163161_10870591 3300017792 Bacteria 761
73 Ga0213874_10015107 3300021377 Bacteria 2031
74 Ga0213875_10000089 3300021388 Bacteria 105772
75 Ga0209758_1053344 3300025297 Bacteria 1390
76 Ga0207688_10048351 3300025901 Bacteria 2376
77 Ga0207645_10092573 3300025907 Bacteria 1944
78 Ga0207645_10274848 3300025907 Bacteria 1118
79 Ga0207649_10090044 3300025920 Bacteria 2007
80 Ga0207681_10206176 3300025923 Bacteria 1512
81 Ga0207681_10268216 3300025923 Bacteria 1339
82 Ga0207650_10222398 3300025925 Bacteria 1520
83 Ga0207650_10365828 3300025925 Bacteria 1189
84 Ga0207659_10318065 3300025926 Bacteria 1283
85 Ga0207644_10273687 3300025931 Bacteria 1354
86 Ga0207706_10103410 3300025933 Bacteria 2506
87 Ga0207706_10370933 3300025933 Bacteria 1243
88 Ga0207709_10040210 3300025935 Bacteria 2798
89 Ga0207670_10002052 3300025936 Bacteria 10560
90 Ga0207670_10623611 3300025936 Bacteria 887
91 Ga0207669_10096091 3300025937 Bacteria 1944
92 Ga0207669_10138310 3300025937 Bacteria 1686
93 Ga0207669_10308512 3300025937 Bacteria 1206
94 Ga0207665_10774310 3300025939 Bacteria 757
95 Ga0207691_10096692 3300025940 Bacteria 2640
96 Ga0207711_10006488 3300025941 Bacteria 9849
97 Ga0207689_10041802 3300025942 Bacteria 3793
98 Ga0207661_10090619 3300025944 Bacteria 2546
99 Ga0207679_10118997 3300025945 Bacteria 2099
100 Ga0207712_10158412 3300025961 Bacteria 1756
101 Ga0207668_10120532 3300025972 Bacteria 1986
102 Ga0207640_10074081 3300025981 Bacteria 2303
103 Ga0207703_10749187 3300026035 Bacteria 931
104 Ga0207708_10032525 3300026075 Bacteria 3960
105 Ga0207708_10053542 3300026075 Bacteria 3075
106 Ga0207648_10088346 3300026089 Bacteria 2706
107 Ga0207676_10072275 3300026095 Bacteria 2772
108 Ga0207674_10061742 3300026116 Bacteria 3785
109 Ga0207674_10943371 3300026116 Bacteria 831
110 Ga0207683_10052832 3300026121 Bacteria 3561
111 Ga0207683_10157427 3300026121 Bacteria 2052
112 Ga0207683_10485313 3300026121 Bacteria 1141
113 Ga0207428_10164997 3300027907 Bacteria 1680
114 Ga0207428_10295451 3300027907 Bacteria 1199
115 Ga0268265_10238436 3300028380 Bacteria 1603
116 Ga0268265_10747499 3300028380 Bacteria 949
117 Ga0265325_10002095 3300031241 Bacteria 13629
118 Ga0265325_10135881 3300031241 Bacteria 1173
119 Ga0265340_10000678 3300031247 Bacteria 19097
120 Ga0265340_10011504 3300031247 Bacteria 4702
121 Ga0265340_10069566 3300031247 Bacteria 1670
122 Ga0265339_10009168 3300031249 Bacteria 6242
123 Ga0265339_10128529 3300031249 Bacteria 1297
124 Ga0307513_10313659 3300031456 Bacteria 1329
125 Ga0265313_10003467 3300031595 Bacteria 12734
126 Ga0265342_10000137 3300031712 Bacteria 81963
127 Ga0307416_100583072 3300032002 Bacteria 1196
128 Ga0373938_0015281 3300034957 Bacteria 1485
129 Ga0373952_0018347 3300035092 Bacteria 1447
130 Ga0373941_0125513 3300035115 Bacteria 919
131 Ga0373954_0140215 3300035118 Bacteria 1179
132 Ga0373946_0185951 3300035171 Bacteria 988
133 Ga0373961_0159123 3300035241 Bacteria 774
134 Ga0373931_0000933 3300035691 Bacteria 12286
135 Ga0373931_0034091 3300035691 Bacteria 2641
136 Ga0373931_0050950 3300035691 Bacteria 2204
137 Ga0373935_0050647 3300035692 Bacteria 2636
138 Ga0373933_0324392 3300035724 Bacteria 999
139 Ga0373947_0218551 3300035725 Bacteria 1252
140 Ga0373937_0567520 3300036401 Bacteria 1078
141 Ga0373925_0085811 3300037068 Bacteria 2400
142 Ga0436364_0768079 3300037853 Bacteria 31728
143 Ga0436365_0074464 3300039437 Bacteria 14893
144 Ga0436365_0928338 3300039437 Bacteria 1797
145 Ga0436365_0990941 3300039437 Bacteria 5991
146 Ga0436365_1168499 3300039437 Bacteria 1434
147 Ga0436361_1126571 3300039447 Bacteria 1471
148 Ga0436363_0131655 3300039450 Bacteria 1262
149 Ga0436363_0202437 3300039450 Bacteria 2416
150 Ga0451853_0631899 3300041512 Unclassified 931
151 Ga0439446_0096468 3300042156 Bacteria 931
152 Ga0439435_0000992 3300042436 Bacteria 4967
153 Ga0451577_0000063 3300042876 Bacteria 264379
154 Ga0451577_0018810 3300042876 Bacteria 6356
155 Ga0451577_0270655 3300042876 Bacteria 1538
156 Ga0451577_0471753 3300042876 Bacteria 1139
157 Ga0453683_0000354 3300044673 Bacteria 55512
158 Ga0453683_0002698 3300044673 Bacteria 13537
159 Ga0453683_0002740 3300044673 Bacteria 13442
160 Ga0453683_0021532 3300044673 Bacteria 4115
161 Ga0453684_0000198 3300044712 Bacteria 264379
162 Ga0453684_0014740 3300044712 Bacteria 12460
163 Ga0453684_0061405 3300044712 Bacteria 4824
164 Ga0453684_0066471 3300044712 Bacteria 4590
165 Ga0451576_0001166 3300045051 Bacteria 47381
166 Ga0451576_0001251 3300045051 Bacteria 44672
167 Ga0451576_0016930 3300045051 Bacteria 8030
168 Ga0495592_0158390 3300046454 Bacteria 1560
169 Ga0495638_0048708 3300046460 Bacteria 2651
170 Ga0495644_0073525 3300046523 Bacteria 1286
171 Ga0495587_0067431 3300046536 Bacteria 2086
172 Ga0495587_0229275 3300046536 Bacteria 1047
173 Ga0495656_0014435 3300046615 Bacteria 2962
174 Ga0495656_0076220 3300046615 Bacteria 1502
175 Ga0495611_0323490 3300046648 Bacteria 709
176 Ga0495600_0296778 3300046809 Bacteria 1020
177 Ga0495600_0312964 3300046809 Bacteria 988
178 Ga0495602_0544657 3300048088 Bacteria 805
179 Ga0496101_0007756 3300048904 Bacteria 6974
180 Ga0496102_0043382 3300048905 Bacteria 4078
181 Ga0496103_0354709 3300048906 Bacteria 943
182 Ga0496104_0032642 3300048907 Bacteria 4846
183 Ga0496104_0060865 3300048907 Bacteria 3577
184 Ga0496105_0005561 3300048908 Bacteria 9570
185 Ga0496106_0101077 3300048909 Bacteria 2236
186 Ga0496106_0702931 3300048909 Unclassified 806
187 Ga0496106_0953816 3300048909 Bacteria 676
188 Ga0496107_0031662 3300048910 Bacteria 3776
189 Ga0496108_0116567 3300048911 Bacteria 2288
190 Ga0496108_0284908 3300048911 Bacteria 1438
191 Ga0496109_0066752 3300048912 Bacteria 3295
192 Ga0496109_0099240 3300048912 Bacteria 2701
193 Ga0496110_0032268 3300048913 Bacteria 4522
194 Ga0496110_0364928 3300048913 Bacteria 1316
195 Ga0496112_0096046 3300048915 Bacteria 2934
196 Ga0496112_0150171 3300048915 Bacteria 2297
197 Ga0496113_0104282 3300048916 Bacteria 2200
198 Ga0496114_0014986 3300048917 Bacteria 6232
199 Ga0496115_0211698 3300048918 Bacteria 1601
200 Ga0496115_0302844 3300048918 Bacteria 1309
201 Ga0501032_0059441 3300049569 Bacteria 2565
202 Ga0501032_0215848 3300049569 Bacteria 1249
203 Ga0501032_0412794 3300049569 Bacteria 866
204 Ga0501033_0271903 3300049570 Bacteria 1197
205 Ga0501034_0548431 3300049571 Bacteria 1065
206 Ga0501036_0671752 3300049572 Bacteria 857
207 Ga0501037_0081709 3300049573 Bacteria 2342
208 Ga0501037_0303317 3300049573 Bacteria 1108
209 Ga0501038_0035083 3300049574 Bacteria 4406
210 Ga0501038_0350108 3300049574 Bacteria 1150
211 Ga0501039_0100936 3300049575 Bacteria 2252
212 Ga0501039_0130459 3300049575 Bacteria 1972
213 Ga0501040_0227173 3300049576 Bacteria 1329
214 Ga0501040_0235184 3300049576 Bacteria 1305
215 Ga0501041_0073572 3300049577 Bacteria 2100
216 Ga0501042_0211988 3300049578 Bacteria 1397
217 Ga0501043_0198635 3300049579 Bacteria 1557
218 Ga0501043_0224161 3300049579 Bacteria 1453
219 Ga0501046_0206090 3300049580 Bacteria 1461
220 Ga0501046_0281349 3300049580 Bacteria 1218
221 Ga0501047_0211360 3300049581 Bacteria 1798
222 Ga0501047_0368521 3300049581 Bacteria 1271
223 Ga0501048_0118611 3300049582 Bacteria 1869
224 Ga0501048_0376645 3300049582 Bacteria 1013
225 Ga0501067_0153869 3300049583 Bacteria 1281
226 Ga0501068_0082962 3300049584 Bacteria 1969
227 Ga0501069_0001787 3300049585 Bacteria 10754
228 Ga0501069_0023733 3300049585 Bacteria 3343
229 Ga0501069_0287858 3300049585 Bacteria 962
230 Ga0501070_0021869 3300049586 Bacteria 5358
231 Ga0501070_0519739 3300049586 Bacteria 955
232 Ga0501071_0006711 3300049587 Bacteria 7483
233 Ga0501071_0120875 3300049587 Bacteria 1941
234 Ga0501071_0127873 3300049587 Bacteria 1886
235 Ga0501072_0015480 3300049588 Bacteria 5847
236 Ga0501073_0078695 3300049589 Bacteria 2294
237 Ga0501073_0137151 3300049589 Bacteria 1695
238 Ga0501075_0120992 3300049591 Bacteria 1992
239 Ga0501076_0373875 3300049592 Bacteria 1171
240 Ga0501077_0112892 3300049593 Bacteria 1723
241 Ga0501079_0066145 3300049741 Bacteria 2789
242 Ga0501079_0355799 3300049741 Bacteria 1147
243 Ga0501080_0007808 3300049742 Bacteria 9676
244 Ga0501080_0183676 3300049742 Bacteria 1923
245 Ga0501080_0325578 3300049742 Bacteria 1390
246 Ga0501080_0636530 3300049742 Bacteria 944
247 Ga0501083_0035634 3300049744 Bacteria 3398
248 Ga0501083_0052650 3300049744 Bacteria 2734
249 Ga0501083_0078574 3300049744 Bacteria 2188
250 Ga0501083_0317417 3300049744 Bacteria 1013
251 Ga0501035_0111708 3300049822 Bacteria 2394
252 Ga0501035_0158331 3300049822 Bacteria 1961
253 Ga0501035_0169692 3300049822 Bacteria 1885
254 Ga0501035_0381977 3300049822 Bacteria 1174
255 Ga0501044_0159180 3300049823 Bacteria 2236
256 Ga0501044_0456505 3300049823 Bacteria 1184
257 Ga0501045_0013589 3300049824 Bacteria 5753
258 Ga0501045_0246375 3300049824 Bacteria 1330
259 nmdc:mga03683_51792_c1 3300050489 Bacteria 1715
260 nmdc:mga03n38_3140_c1 3300050490 Bacteria 5256
261 nmdc:mga00v17_151246_c1 3300050491 Bacteria 1491
262 nmdc:mga00v17_176821_c1 3300050491 Bacteria 1377
263 nmdc:mga00v17_543984_c1 3300050491 Unclassified 751
264 nmdc:mga0k408_39972_c1 3300050493 Bacteria 2697
265 nmdc:mga07m45_245327_c1 3300050496 Bacteria 1042
266 nmdc:mga0qj67_118282_c1 3300050509 Bacteria 2142
267 nmdc:mga0qj67_620664_c1 3300050509 Bacteria 864
268 nmdc:mga08y16_25027_c1 3300050511 Bacteria 6296
269 nmdc:mga08y16_68308_c1 3300050511 Bacteria 3705
270 nmdc:mga0rr50_56072_c1 3300050513 Bacteria 2943
271 nmdc:mga08x19_343753_c1 3300050514 Bacteria 1041
272 nmdc:mga0a205_351735_c1 3300050515 Bacteria 1341
273 Ga0495601_0055169 3300053077 Bacteria 2515
274 Ga0495612_0022318 3300053078 Bacteria 2537
275 Ga0495595_0018332 3300053084 Bacteria 3024
276 Ga0495619_0005458 3300053085 Bacteria 8058
277 Ga0500646_0154388 3300053090 Bacteria 762
278 Ga0500646_0156053 3300053090 Bacteria 759
279 Ga0500641_0123760 3300053096 Bacteria 1115
280 Ga0500641_0218234 3300053096 Bacteria 809
281 Ga0500654_093985 3300053099 Bacteria 1318
282 Ga0500604_0027439 3300053151 Bacteria 1647
283 Ga0501084_0047938 3300054114 Bacteria 3578
284 Ga0501084_0103003 3300054114 Bacteria 2397
285 Ga0501084_0362008 3300054114 Bacteria 1226
286 Ga0501084_0509207 3300054114 Bacteria 1017
287 Ga0501082_0000327 3300060353 Bacteria 42286
288 Ga0501082_0103337 3300060353 Bacteria 2464
289 Ga0530510_0153808 3300061734 Bacteria 1699

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053090 Ga0500646_0154388 Ga0500646_0154388_14_628 200
2 3300005539 Ga0068853_100575158 Ga0068853_1005751581 201
3 3300013100 Ga0157373_10009597 Ga0157373_100095976 201
4 3300013104 Ga0157370_10281522 Ga0157370_102815222 201
5 3300035724 Ga0373933_0324392 Ga0373933_0324392_29_637 202
6 3300046648 Ga0495611_0323490 Ga0495611_0323490_19_627 202
7 3300048909 Ga0496106_0702931 Ga0496106_0702931_160_768 202
8 3300049592 Ga0501076_0373875 Ga0501076_0373875_538_1146 202
9 3300049744 Ga0501083_0035634 Ga0501083_0035634_18_626 202
10 3300050491 nmdc:mga00v17_543984_c1 nmdc:mga00v17_543984_c1_128_736 202
11 3300013100 Ga0157373_10003448 Ga0157373_1000344813 203
12 3300035241 Ga0373961_0159123 Ga0373961_0159123_26_637 203
13 3300046809 Ga0495600_0312964 Ga0495600_0312964_362_976 204
14 3300048909 Ga0496106_0953816 Ga0496106_0953816_38_652 204
15 3300048911 Ga0496108_0284908 Ga0496108_0284908_43_657 204
16 3300025941 Ga0207711_10006488 Ga0207711_100064881 205
17 3300049572 Ga0501036_0671752 Ga0501036_0671752_22_657 211
18 3300042156 Ga0439446_0096468 Ga0439446_0096468_111_749 212
19 3300049585 Ga0501069_0287858 Ga0501069_0287858_90_743 215
20 3300042876 Ga0451577_0000063 Ga0451577_0000063_40445_41098 216
21 3300042876 Ga0451577_0018810 Ga0451577_0018810_5421_6074 216
22 3300042876 Ga0451577_0270655 Ga0451577_0270655_50_703 216
23 3300042876 Ga0451577_0471753 Ga0451577_0471753_402_1055 216
24 3300044673 Ga0453683_0000354 Ga0453683_0000354_19779_20432 216
25 3300044673 Ga0453683_0002698 Ga0453683_0002698_7837_8490 216
26 3300044673 Ga0453683_0002740 Ga0453683_0002740_5430_6083 216
27 3300044673 Ga0453683_0021532 Ga0453683_0021532_2308_2958 216
28 3300044712 Ga0453684_0000198 Ga0453684_0000198_223282_223935 216
29 3300044712 Ga0453684_0014740 Ga0453684_0014740_3608_4258 216
30 3300044712 Ga0453684_0061405 Ga0453684_0061405_3206_3859 216
31 3300044712 Ga0453684_0066471 Ga0453684_0066471_1176_1829 216
32 3300045051 Ga0451576_0001166 Ga0451576_0001166_645_1298 216
33 3300045051 Ga0451576_0001251 Ga0451576_0001251_590_1243 216
34 3300045051 Ga0451576_0016930 Ga0451576_0016930_3765_4415 216
35 3300049569 Ga0501032_0059441 Ga0501032_0059441_936_1589 217
36 3300049570 Ga0501033_0271903 Ga0501033_0271903_272_925 217
37 3300049580 Ga0501046_0281349 Ga0501046_0281349_37_690 217
38 3300049581 Ga0501047_0211360 Ga0501047_0211360_273_926 217
39 3300049585 Ga0501069_0001787 Ga0501069_0001787_7714_8367 217
40 3300049742 Ga0501080_0007808 Ga0501080_0007808_6797_7450 217
41 3300049822 Ga0501035_0111708 Ga0501035_0111708_138_791 217
42 3300049823 Ga0501044_0159180 Ga0501044_0159180_258_932 217
43 3300049824 Ga0501045_0013589 Ga0501045_0013589_2733_3386 217
44 3300014968 Ga0157379_11085606 Ga0157379_110856061 219
45 3300035115 Ga0373941_0125513 Ga0373941_0125513_171_854 219
46 3300035691 Ga0373931_0000933 Ga0373931_0000933_5235_5918 219
47 3300005329 Ga0070683_100823356 Ga0070683_1008233561 220
48 3300005340 Ga0070689_100062531 Ga0070689_1000625312 220
49 3300005344 Ga0070661_100179961 Ga0070661_1001799612 220
50 3300005356 Ga0070674_100477670 Ga0070674_1004776702 220
51 3300005539 Ga0068853_100226444 Ga0068853_1002264442 220
52 3300006051 Ga0075364_10192175 Ga0075364_101921752 220
53 3300006177 Ga0075362_10016070 Ga0075362_100160703 220
54 3300006186 Ga0075369_10037518 Ga0075369_100375182 220
55 3300006195 Ga0075366_10057071 Ga0075366_100570712 220
56 3300006353 Ga0075370_10215698 Ga0075370_102156982 220
57 3300013297 Ga0157378_10109158 Ga0157378_101091584 220
58 3300013306 Ga0163162_10644411 Ga0163162_106444112 220
59 3300013308 Ga0157375_11274861 Ga0157375_112748611 220
60 3300017792 Ga0163161_10870591 Ga0163161_108705911 220
61 3300025920 Ga0207649_10090044 Ga0207649_100900442 220
62 3300025933 Ga0207706_10103410 Ga0207706_101034105 220
63 3300025936 Ga0207670_10623611 Ga0207670_106236112 220
64 3300025937 Ga0207669_10308512 Ga0207669_103085122 220
65 3300025945 Ga0207679_10118997 Ga0207679_101189973 220
66 3300025981 Ga0207640_10074081 Ga0207640_100740813 220
67 3300028380 Ga0268265_10747499 Ga0268265_107474992 220
68 3300031247 Ga0265340_10011504 Ga0265340_100115043 220
69 3300031247 Ga0265340_10069566 Ga0265340_100695662 220
70 3300031249 Ga0265339_10128529 Ga0265339_101285292 220
71 3300041512 Ga0451853_0631899 Ga0451853_0631899_125_799 220
72 3300049744 Ga0501083_0052650 Ga0501083_0052650_20_694 220
73 3300050489 nmdc:mga03683_51792_c1 nmdc:mga03683_51792_c1_348_1022 220
74 3300050490 nmdc:mga03n38_3140_c1 nmdc:mga03n38_3140_c1_4213_4887 220
75 3300050491 nmdc:mga00v17_176821_c1 nmdc:mga00v17_176821_c1_259_933 220
76 3300050496 nmdc:mga07m45_245327_c1 nmdc:mga07m45_245327_c1_20_694 220
77 3300053090 Ga0500646_0156053 Ga0500646_0156053_44_718 220
78 3300053151 Ga0500604_0027439 Ga0500604_0027439_815_1489 220
79 3300060353 Ga0501082_0000327 Ga0501082_0000327_32458_33132 220
80 3300009098 Ga0105245_10053615 Ga0105245_100536152 221
81 3300025937 Ga0207669_10096091 Ga0207669_100960912 222
82 3300005331 Ga0070670_100260149 Ga0070670_1002601493 223
83 3300005844 Ga0068862_100590824 Ga0068862_1005908242 223
84 3300006844 Ga0075428_100034988 Ga0075428_1000349883 223
85 3300009147 Ga0114129_10074762 Ga0114129_100747623 223
86 3300009148 Ga0105243_10074030 Ga0105243_100740303 223
87 3300009553 Ga0105249_10963971 Ga0105249_109639712 223
88 3300014326 Ga0157380_10532152 Ga0157380_105321522 223
89 3300021388 Ga0213875_10000089 Ga0213875_1000008941 223
90 3300025925 Ga0207650_10222398 Ga0207650_102223982 223
91 3300025935 Ga0207709_10040210 Ga0207709_100402103 223
92 3300025939 Ga0207665_10774310 Ga0207665_107743101 223
93 3300032002 Ga0307416_100583072 Ga0307416_1005830722 223
94 3300035691 Ga0373931_0050950 Ga0373931_0050950_545_1216 223
95 3300037853 Ga0436364_0768079 Ga0436364_0768079_12984_13655 223
96 3300039437 Ga0436365_0928338 Ga0436365_0928338_718_1389 223
97 3300039450 Ga0436363_0131655 Ga0436363_0131655_462_1133 223
98 3300046615 Ga0495656_0014435 Ga0495656_0014435_1020_1691 223
99 3300005330 Ga0070690_100109323 Ga0070690_1001093233 224
100 3300005331 Ga0070670_100224161 Ga0070670_1002241613 224
101 3300005340 Ga0070689_100020143 Ga0070689_1000201438 224
102 3300005354 Ga0070675_100112449 Ga0070675_1001124494 224
103 3300005355 Ga0070671_100275565 Ga0070671_1002755651 224
104 3300005356 Ga0070674_100315346 Ga0070674_1003153462 224
105 3300005441 Ga0070700_100173628 Ga0070700_1001736283 224
106 3300005456 Ga0070678_100030952 Ga0070678_1000309526 224
107 3300005458 Ga0070681_10159718 Ga0070681_101597183 224
108 3300005535 Ga0070684_100358680 Ga0070684_1003586802 224
109 3300005543 Ga0070672_100363135 Ga0070672_1003631352 224
110 3300006028 Ga0070717_10141832 Ga0070717_101418323 224
111 3300009147 Ga0114129_10122550 Ga0114129_101225504 224
112 3300009177 Ga0105248_10709543 Ga0105248_107095432 224
113 3300013308 Ga0157375_10620516 Ga0157375_106205162 224
114 3300014325 Ga0163163_10045685 Ga0163163_100456855 224
115 3300014497 Ga0182008_10073729 Ga0182008_100737292 224
116 3300014968 Ga0157379_10821620 Ga0157379_108216202 224
117 3300021377 Ga0213874_10015107 Ga0213874_100151073 224
118 3300025901 Ga0207688_10048351 Ga0207688_100483512 224
119 3300025907 Ga0207645_10092573 Ga0207645_100925732 224
120 3300025923 Ga0207681_10268216 Ga0207681_102682162 224
121 3300025926 Ga0207659_10318065 Ga0207659_103180652 224
122 3300025931 Ga0207644_10273687 Ga0207644_102736872 224
123 3300025933 Ga0207706_10370933 Ga0207706_103709332 224
124 3300025936 Ga0207670_10002052 Ga0207670_100020529 224
125 3300025937 Ga0207669_10138310 Ga0207669_101383102 224
126 3300026035 Ga0207703_10749187 Ga0207703_107491872 224
127 3300026075 Ga0207708_10032525 Ga0207708_100325254 224
128 3300026089 Ga0207648_10088346 Ga0207648_100883462 224
129 3300026121 Ga0207683_10052832 Ga0207683_100528325 224
130 3300031241 Ga0265325_10002095 Ga0265325_100020955 224
131 3300031241 Ga0265325_10135881 Ga0265325_101358812 224
132 3300031595 Ga0265313_10003467 Ga0265313_100034674 224
133 3300034957 Ga0373938_0015281 Ga0373938_0015281_408_1082 224
134 3300035092 Ga0373952_0018347 Ga0373952_0018347_348_1022 224
135 3300035118 Ga0373954_0140215 Ga0373954_0140215_12_686 224
136 3300035171 Ga0373946_0185951 Ga0373946_0185951_14_688 224
137 3300035691 Ga0373931_0034091 Ga0373931_0034091_1036_1710 224
138 3300035725 Ga0373947_0218551 Ga0373947_0218551_299_973 224
139 3300036401 Ga0373937_0567520 Ga0373937_0567520_109_783 224
140 3300037068 Ga0373925_0085811 Ga0373925_0085811_736_1410 224
141 3300039437 Ga0436365_0990941 Ga0436365_0990941_161_835 224
142 3300039450 Ga0436363_0202437 Ga0436363_0202437_179_853 224
143 3300046454 Ga0495592_0158390 Ga0495592_0158390_75_749 224
144 3300046523 Ga0495644_0073525 Ga0495644_0073525_208_882 224
145 3300046536 Ga0495587_0067431 Ga0495587_0067431_865_1539 224
146 3300046536 Ga0495587_0229275 Ga0495587_0229275_191_865 224
147 3300046615 Ga0495656_0076220 Ga0495656_0076220_226_900 224
148 3300046809 Ga0495600_0296778 Ga0495600_0296778_268_942 224
149 3300048088 Ga0495602_0544657 Ga0495602_0544657_31_705 224
150 3300048907 Ga0496104_0060865 Ga0496104_0060865_2893_3567 224
151 3300048911 Ga0496108_0116567 Ga0496108_0116567_560_1234 224
152 3300048912 Ga0496109_0066752 Ga0496109_0066752_1092_1766 224
153 3300048912 Ga0496109_0099240 Ga0496109_0099240_1988_2662 224
154 3300048913 Ga0496110_0364928 Ga0496110_0364928_161_835 224
155 3300048915 Ga0496112_0150171 Ga0496112_0150171_741_1415 224
156 3300048916 Ga0496113_0104282 Ga0496113_0104282_1155_1829 224
157 3300048918 Ga0496115_0211698 Ga0496115_0211698_359_1033 224
158 3300049569 Ga0501032_0215848 Ga0501032_0215848_62_736 224
159 3300049569 Ga0501032_0412794 Ga0501032_0412794_84_758 224
160 3300049571 Ga0501034_0548431 Ga0501034_0548431_29_703 224
161 3300049573 Ga0501037_0081709 Ga0501037_0081709_84_758 224
162 3300049573 Ga0501037_0303317 Ga0501037_0303317_370_1044 224
163 3300049574 Ga0501038_0035083 Ga0501038_0035083_62_736 224
164 3300049574 Ga0501038_0350108 Ga0501038_0350108_315_989 224
165 3300049575 Ga0501039_0100936 Ga0501039_0100936_849_1523 224
166 3300049575 Ga0501039_0130459 Ga0501039_0130459_175_849 224
167 3300049576 Ga0501040_0227173 Ga0501040_0227173_368_1042 224
168 3300049576 Ga0501040_0235184 Ga0501040_0235184_61_735 224
169 3300049577 Ga0501041_0073572 Ga0501041_0073572_63_737 224
170 3300049578 Ga0501042_0211988 Ga0501042_0211988_230_904 224
171 3300049579 Ga0501043_0198635 Ga0501043_0198635_57_731 224
172 3300049579 Ga0501043_0224161 Ga0501043_0224161_618_1292 224
173 3300049580 Ga0501046_0206090 Ga0501046_0206090_458_1132 224
174 3300049581 Ga0501047_0368521 Ga0501047_0368521_162_836 224
175 3300049582 Ga0501048_0118611 Ga0501048_0118611_754_1428 224
176 3300049583 Ga0501067_0153869 Ga0501067_0153869_550_1224 224
177 3300049584 Ga0501068_0082962 Ga0501068_0082962_51_725 224
178 3300049585 Ga0501069_0023733 Ga0501069_0023733_823_1497 224
179 3300049586 Ga0501070_0021869 Ga0501070_0021869_3578_4252 224
180 3300049586 Ga0501070_0519739 Ga0501070_0519739_264_938 224
181 3300049587 Ga0501071_0006711 Ga0501071_0006711_5463_6137 224
182 3300049587 Ga0501071_0127873 Ga0501071_0127873_1192_1866 224
183 3300049588 Ga0501072_0015480 Ga0501072_0015480_4944_5618 224
184 3300049589 Ga0501073_0078695 Ga0501073_0078695_220_894 224
185 3300049589 Ga0501073_0137151 Ga0501073_0137151_157_831 224
186 3300049591 Ga0501075_0120992 Ga0501075_0120992_1002_1676 224
187 3300049593 Ga0501077_0112892 Ga0501077_0112892_633_1307 224
188 3300049741 Ga0501079_0066145 Ga0501079_0066145_1838_2512 224
189 3300049741 Ga0501079_0355799 Ga0501079_0355799_228_902 224
190 3300049742 Ga0501080_0183676 Ga0501080_0183676_60_734 224
191 3300049742 Ga0501080_0325578 Ga0501080_0325578_248_922 224
192 3300049742 Ga0501080_0636530 Ga0501080_0636530_107_781 224
193 3300049744 Ga0501083_0078574 Ga0501083_0078574_34_708 224
194 3300049822 Ga0501035_0158331 Ga0501035_0158331_1192_1866 224
195 3300049822 Ga0501035_0169692 Ga0501035_0169692_415_1089 224
196 3300049822 Ga0501035_0381977 Ga0501035_0381977_485_1159 224
197 3300049823 Ga0501044_0456505 Ga0501044_0456505_56_730 224
198 3300049824 Ga0501045_0246375 Ga0501045_0246375_253_927 224
199 3300050491 nmdc:mga00v17_151246_c1 nmdc:mga00v17_151246_c1_677_1351 224
200 3300050509 nmdc:mga0qj67_118282_c1 nmdc:mga0qj67_118282_c1_418_1092 224
201 3300053077 Ga0495601_0055169 Ga0495601_0055169_400_1074 224
202 3300053085 Ga0495619_0005458 Ga0495619_0005458_2572_3246 224
203 3300054114 Ga0501084_0047938 Ga0501084_0047938_2307_2981 224
204 3300054114 Ga0501084_0103003 Ga0501084_0103003_114_788 224
205 3300054114 Ga0501084_0509207 Ga0501084_0509207_326_1000 224
206 3300060353 Ga0501082_0103337 Ga0501082_0103337_269_943 224
207 3300061734 Ga0530510_0153808 Ga0530510_0153808_771_1445 224
208 3300005459 Ga0068867_100335371 Ga0068867_1003353711 225
209 3300006195 Ga0075366_10011621 Ga0075366_100116217 225
210 3300009101 Ga0105247_10356363 Ga0105247_103563632 225
211 3300009177 Ga0105248_10435647 Ga0105248_104356472 225
212 3300014325 Ga0163163_10722470 Ga0163163_107224701 225
213 3300025907 Ga0207645_10274848 Ga0207645_102748481 225
214 3300025942 Ga0207689_10041802 Ga0207689_100418022 225
215 3300026095 Ga0207676_10072275 Ga0207676_100722752 225
216 3300026116 Ga0207674_10061742 Ga0207674_100617424 225
217 3300050493 nmdc:mga0k408_39972_c1 nmdc:mga0k408_39972_c1_686_1363 225
218 3300005983 Ga0081540_1007483 Ga0081540_10074832 226
219 3300006852 Ga0075433_10279756 Ga0075433_102797562 226
220 3300007076 Ga0075435_100060901 Ga0075435_1000609013 226
221 3300009093 Ga0105240_10073725 Ga0105240_100737256 226
222 3300009094 Ga0111539_10090509 Ga0111539_100905092 226
223 3300009551 Ga0105238_10035756 Ga0105238_100357564 226
224 3300025944 Ga0207661_10090619 Ga0207661_100906193 226
225 3300027907 Ga0207428_10295451 Ga0207428_102954511 226
226 3300039437 Ga0436365_0074464 Ga0436365_0074464_11214_11894 226
227 3300048918 Ga0496115_0302844 Ga0496115_0302844_503_1183 226
228 3300050511 nmdc:mga08y16_68308_c1 nmdc:mga08y16_68308_c1_2773_3456 226
229 3300050513 nmdc:mga0rr50_56072_c1 nmdc:mga0rr50_56072_c1_1988_2671 226
230 3300050514 nmdc:mga08x19_343753_c1 nmdc:mga08x19_343753_c1_42_725 226
231 3300050515 nmdc:mga0a205_351735_c1 nmdc:mga0a205_351735_c1_165_848 226
232 3300053078 Ga0495612_0022318 Ga0495612_0022318_482_1180 226
233 3300053084 Ga0495595_0018332 Ga0495595_0018332_440_1138 226
234 3300006237 Ga0097621_100204732 Ga0097621_1002047322 227
235 3300009094 Ga0111539_10020039 Ga0111539_100200397 227
236 3300009098 Ga0105245_10390190 Ga0105245_103901902 227
237 3300009177 Ga0105248_10064964 Ga0105248_100649646 227
238 3300013297 Ga0157378_10185517 Ga0157378_101855172 227
239 3300014968 Ga0157379_10186333 Ga0157379_101863332 227
240 3300026121 Ga0207683_10157427 Ga0207683_101574273 227
241 3300031247 Ga0265340_10000678 Ga0265340_100006789 227
242 3300031249 Ga0265339_10009168 Ga0265339_100091682 227
243 3300031712 Ga0265342_10000137 Ga0265342_1000013734 227
244 3300035692 Ga0373935_0050647 Ga0373935_0050647_66_749 227
245 3300039437 Ga0436365_1168499 Ga0436365_1168499_307_990 227
246 3300039447 Ga0436361_1126571 Ga0436361_1126571_481_1164 227
247 3300048904 Ga0496101_0007756 Ga0496101_0007756_3788_4471 227
248 3300048905 Ga0496102_0043382 Ga0496102_0043382_934_1617 227
249 3300048906 Ga0496103_0354709 Ga0496103_0354709_111_794 227
250 3300048907 Ga0496104_0032642 Ga0496104_0032642_1463_2146 227
251 3300048908 Ga0496105_0005561 Ga0496105_0005561_145_828 227
252 3300048909 Ga0496106_0101077 Ga0496106_0101077_319_1002 227
253 3300048910 Ga0496107_0031662 Ga0496107_0031662_2921_3604 227
254 3300048913 Ga0496110_0032268 Ga0496110_0032268_2586_3269 227
255 3300048915 Ga0496112_0096046 Ga0496112_0096046_2117_2800 227
256 3300048917 Ga0496114_0014986 Ga0496114_0014986_2876_3559 227
257 3300049582 Ga0501048_0376645 Ga0501048_0376645_260_943 227
258 3300049587 Ga0501071_0120875 Ga0501071_0120875_871_1554 227
259 3300054114 Ga0501084_0362008 Ga0501084_0362008_523_1206 227
260 3300009553 Ga0105249_10211865 Ga0105249_102118652 228
261 3300025961 Ga0207712_10158412 Ga0207712_101584123 228
262 3300050509 nmdc:mga0qj67_620664_c1 nmdc:mga0qj67_620664_c1_60_746 228
263 3300005347 Ga0070668_100300509 Ga0070668_1003005091 229
264 3300006038 Ga0075365_10378229 Ga0075365_103782291 229
265 3300025972 Ga0207668_10120532 Ga0207668_101205322 229
266 3300031456 Ga0307513_10313659 Ga0307513_103136591 229
267 3300042436 Ga0439435_0000992 Ga0439435_0000992_1555_2244 229
268 3300046460 Ga0495638_0048708 Ga0495638_0048708_1216_1905 229
269 3300049744 Ga0501083_0317417 Ga0501083_0317417_234_983 229
270 3300053096 Ga0500641_0123760 Ga0500641_0123760_13_702 229
271 3300053096 Ga0500641_0218234 Ga0500641_0218234_108_797 229
272 3300053099 Ga0500654_093985 Ga0500654_093985_368_1057 229
273 3300005290 Ga0065712_10264933 Ga0065712_102649331 233
274 3300005331 Ga0070670_100506564 Ga0070670_1005065642 233
275 3300005353 Ga0070669_100044519 Ga0070669_1000445193 233
276 3300005844 Ga0068862_100996138 Ga0068862_1009961382 233
277 3300009094 Ga0111539_10281694 Ga0111539_102816942 233
278 3300009094 Ga0111539_10588877 Ga0111539_105888771 233
279 3300009553 Ga0105249_10040257 Ga0105249_100402574 233
280 3300025297 Ga0209758_1053344 Ga0209758_10533442 233
281 3300025923 Ga0207681_10206176 Ga0207681_102061761 233
282 3300025925 Ga0207650_10365828 Ga0207650_103658282 233
283 3300025940 Ga0207691_10096692 Ga0207691_100966922 233
284 3300026075 Ga0207708_10053542 Ga0207708_100535422 233
285 3300026116 Ga0207674_10943371 Ga0207674_109433712 233
286 3300026121 Ga0207683_10485313 Ga0207683_104853131 233
287 3300027907 Ga0207428_10164997 Ga0207428_101649972 233
288 3300028380 Ga0268265_10238436 Ga0268265_102384362 233
289 3300050511 nmdc:mga08y16_25027_c1 nmdc:mga08y16_25027_c1_3442_4143 233

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

11

85

0.93

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

14

80

0.91

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

125

205

0.9

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

8

79

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mp4-assembly1.cif.gz_B crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure 0.8853 1 208
4mp4-assembly2.cif.gz_C-2 crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure 0.8685 1 208
4mp4-assembly2.cif.gz_C-2 crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure 0.8561 1 208
3bby-assembly1.cif.gz_A-2 crystal structure of glutathione s-transferase (np_416804.1) from escherichia coli k12 at 1.85 a resolution 0.8544 2 208
4isd-assembly2.cif.gz_C crystal structure of glutathione transferase homolog from burkholderia gl bgr1, target efi-501803, with bound glutathione 0.8528 2 208
ID Description Score Start End Superfamily
1v2aB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8766 18 83 3.40.30.10
3lxtA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8731 2 79 3.40.30.10
3touB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8547 2 87 3.40.30.10
af_Q9SRY6_37_122_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8511 1 85 3.40.30.10
af_Q8W2T8_11_99_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8496 2 84 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A348G0D0-F1-model_v4 Glutathione S-transferase 0.9917 2 229 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A522M3S8-F1-model_v4 Glutathione S-transferase family protein 0.9879 1 221 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A348G0D0-F1-model_v4 Glutathione S-transferase 0.9873 2 229 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A2T5VCM0-F1-model_v4 Glutathione S-transferase 0.9856 4 221 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A4R6RJH5-F1-model_v4 Glutathione S-transferase 0.9849 4 217 GO:0004364
GO:0006559
GO:0006749
GO:0016034

Feature Viewer

pLDDT pTM Quality
94.99 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map