F389375

General Info

Members Datasets Scaffolds Average Seq Length
289 132 578 81

Family's Representative Sequence

Representative Sequence 3300046537|Ga0495598_0270388|Ga0495598_0270388_369_608
Length 79
Sequence MADQEIDELVEQAPPPEIDSKYRLIILAAKRSKQLQRGARPRIEIDSTKHKPTRIALEEVIQGKVQFHIKPDERAKTPA

Samples

Sample ID Description Type Environment
1 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
111 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
112 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
113 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
116 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
117 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
118 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
119 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
120 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
121 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
122 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
123 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
124 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
125 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
126 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
127 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
128 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
129 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
130 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
131 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
132 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.35
Nodule 0
Rhizoplane 0
Rhizosphere 99.65
Stem 0
Stem Tuber 0
Unclassified 34.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495598_0270388 3300046537 Bacteria 635
2 JGI24034J26672_10000005 3300002239 Bacteria 404185
3 Ga0065704_10159942 3300005289 Unclassified 1362
4 Ga0065704_10307882 3300005289 Bacteria 873
5 Ga0065707_10104678 3300005295 Unclassified 2684
6 Ga0065707_10119832 3300005295 Unclassified 2149
7 Ga0070676_10071407 3300005328 Unclassified 2085
8 Ga0070690_100047114 3300005330 Unclassified 2742
9 Ga0068869_100027416 3300005334 Bacteria 3972
10 Ga0068868_100037912 3300005338 Bacteria 3739
11 Ga0068868_101492417 3300005338 Unclassified 633
12 Ga0070689_100038393 3300005340 Bacteria 3664
13 Ga0070689_100280652 3300005340 Bacteria 1382
14 Ga0070689_101460425 3300005340 Bacteria 619
15 Ga0070687_100095469 3300005343 Unclassified 1653
16 Ga0070687_100114467 3300005343 Bacteria 1532
17 Ga0070687_100352189 3300005343 Bacteria 951
18 Ga0070669_100894364 3300005353 Bacteria 758
19 Ga0070669_101344875 3300005353 Unclassified 619
20 Ga0070675_101016012 3300005354 Unclassified 761
21 Ga0070671_100054366 3300005355 Unclassified 3329
22 Ga0070671_101876759 3300005355 Unclassified 533
23 Ga0070674_102028300 3300005356 Unclassified 524
24 Ga0070673_100040857 3300005364 Bacteria 3561
25 Ga0070688_100466161 3300005365 Bacteria 947
26 Ga0070688_101283284 3300005365 Bacteria 591
27 Ga0070703_10000091 3300005406 Bacteria 45812
28 Ga0070710_10058403 3300005437 Bacteria 2188
29 Ga0070701_11291749 3300005438 Unclassified 521
30 Ga0070711_101474756 3300005439 Bacteria 593
31 Ga0070705_100086089 3300005440 Unclassified 1944
32 Ga0070705_100214746 3300005440 Bacteria 1328
33 Ga0070705_100373302 3300005440 Unclassified 1047
34 Ga0070705_100567412 3300005440 Bacteria 873
35 Ga0070705_101365371 3300005440 Unclassified 589
36 Ga0070700_100074848 3300005441 Bacteria 2171
37 Ga0070700_100411799 3300005441 Unclassified 1019
38 Ga0070700_100959217 3300005441 Bacteria 700
39 Ga0070694_100014511 3300005444 Bacteria 4933
40 Ga0070694_100712744 3300005444 Bacteria 817
41 Ga0070694_101094582 3300005444 Bacteria 664
42 Ga0070694_101366521 3300005444 Unclassified 597
43 Ga0070694_101864199 3300005444 Unclassified 513
44 Ga0070708_100125124 3300005445 Bacteria 2375
45 Ga0070708_102040568 3300005445 Unclassified 531
46 Ga0068867_100899798 3300005459 Bacteria 796
47 Ga0068867_101154884 3300005459 Unclassified 709
48 Ga0070706_100535959 3300005467 Bacteria 1089
49 Ga0070706_101713945 3300005467 Unclassified 572
50 Ga0070707_100000435 3300005468 Bacteria 41411
51 Ga0070707_100431039 3300005468 Bacteria 1279
52 Ga0070707_100889647 3300005468 Bacteria 855
53 Ga0070698_100000312 3300005471 Bacteria 49298
54 Ga0070698_100028364 3300005471 Bacteria 5815
55 Ga0070698_100070869 3300005471 Bacteria 3497
56 Ga0070698_100221441 3300005471 Bacteria 1826
57 Ga0070698_100282223 3300005471 Unclassified 1592
58 Ga0070698_100532288 3300005471 Unclassified 1114
59 Ga0070698_101746366 3300005471 Bacteria 575
60 Ga0070699_100179018 3300005518 Bacteria 1881
61 Ga0070699_100324525 3300005518 Bacteria 1384
62 Ga0070699_100628513 3300005518 Unclassified 980
63 Ga0070699_101269616 3300005518 Unclassified 675
64 Ga0070697_100000046 3300005536 Bacteria 91230
65 Ga0070697_100033242 3300005536 Bacteria 4153
66 Ga0070697_100044547 3300005536 Bacteria 3594
67 Ga0070686_100010777 3300005544 Bacteria 5168
68 Ga0070686_100109461 3300005544 Bacteria 1880
69 Ga0070695_100133742 3300005545 Bacteria 1712
70 Ga0070695_100961755 3300005545 Unclassified 693
71 Ga0070695_101311967 3300005545 Bacteria 598
72 Ga0070696_100064181 3300005546 Bacteria 2573
73 Ga0070696_100555180 3300005546 Unclassified 921
74 Ga0070696_101013584 3300005546 Bacteria 694
75 Ga0070693_101422301 3300005547 Unclassified 540
76 Ga0070693_101521824 3300005547 Unclassified 523
77 Ga0070704_100152564 3300005549 Bacteria 1818
78 Ga0070704_100178374 3300005549 Bacteria 1697
79 Ga0070704_100179004 3300005549 Bacteria 1694
80 Ga0070704_100242973 3300005549 Bacteria 1474
81 Ga0070704_100558010 3300005549 Unclassified 1001
82 Ga0070704_101250344 3300005549 Unclassified 678
83 Ga0068854_100748297 3300005578 Bacteria 848
84 Ga0070702_101308180 3300005615 Unclassified 589
85 Ga0070702_101375098 3300005615 Bacteria 576
86 Ga0068852_100587609 3300005616 Bacteria 1117
87 Ga0068859_100355775 3300005617 Bacteria 1559
88 Ga0068859_100719970 3300005617 Bacteria 1088
89 Ga0068859_100988365 3300005617 Unclassified 924
90 Ga0068859_101658733 3300005617 Bacteria 706
91 Ga0068864_100485421 3300005618 Bacteria 1186
92 Ga0068866_10011288 3300005718 Bacteria 3860
93 Ga0068866_10263280 3300005718 Bacteria 1061
94 Ga0068861_100079049 3300005719 Bacteria 2570
95 Ga0068861_100431571 3300005719 Bacteria 1176
96 Ga0068863_101008726 3300005841 Unclassified 835
97 Ga0068863_101377851 3300005841 Bacteria 713
98 Ga0068863_101474048 3300005841 Unclassified 689
99 Ga0068858_100000311 3300005842 Bacteria 51906
100 Ga0068858_100161060 3300005842 Bacteria 2113
101 Ga0068858_100163390 3300005842 Bacteria 2097
102 Ga0068858_100694656 3300005842 Unclassified 990
103 Ga0068858_100738976 3300005842 Unclassified 958
104 Ga0068860_100081011 3300005843 Bacteria 3087
105 Ga0068860_100106361 3300005843 Bacteria 2680
106 Ga0068860_101010229 3300005843 Bacteria 850
107 Ga0068862_100077077 3300005844 Unclassified 2886
108 Ga0068862_100312401 3300005844 Unclassified 1449
109 Ga0070715_10968913 3300006163 Unclassified 528
110 Ga0070716_100000011 3300006173 Bacteria 143884
111 Ga0070716_100115178 3300006173 Bacteria 1673
112 Ga0070716_100539283 3300006173 Bacteria 868
113 Ga0070716_100571058 3300006173 Unclassified 846
114 Ga0097621_100310913 3300006237 Bacteria 1394
115 Ga0097621_100887373 3300006237 Bacteria 830
116 Ga0068871_101002420 3300006358 Bacteria 778
117 Ga0075428_100032741 3300006844 Bacteria 5741
118 Ga0075430_101556875 3300006846 Unclassified 543
119 Ga0075433_10025719 3300006852 Bacteria 4978
120 Ga0075433_10149590 3300006852 Bacteria 2077
121 Ga0075433_10239891 3300006852 Unclassified 1609
122 Ga0075433_10641653 3300006852 Bacteria 931
123 Ga0075434_100086377 3300006871 Bacteria 3137
124 Ga0075434_100129537 3300006871 Bacteria 2541
125 Ga0075434_100936013 3300006871 Bacteria 881
126 Ga0075434_101383079 3300006871 Unclassified 714
127 Ga0075434_101526189 3300006871 Bacteria 677
128 Ga0075429_100028211 3300006880 Bacteria 4874
129 Ga0068865_101642025 3300006881 Bacteria 578
130 Ga0075436_100000011 3300006914 Bacteria 208094
131 Ga0075436_100679404 3300006914 Bacteria 762
132 Ga0097620_100355801 3300006931 Bacteria 1559
133 Ga0097620_100719866 3300006931 Bacteria 1088
134 Ga0097620_100988342 3300006931 Unclassified 924
135 Ga0097620_101658058 3300006931 Bacteria 706
136 Ga0075435_100046123 3300007076 Bacteria 3495
137 Ga0075435_101254882 3300007076 Bacteria 649
138 Ga0099794_10002649 3300007265 Bacteria 6658
139 Ga0111539_10016807 3300009094 Bacteria 9063
140 Ga0105245_10552836 3300009098 Bacteria 1173
141 Ga0105247_10000022 3300009101 Bacteria 219796
142 Ga0114129_10014339 3300009147 Bacteria 11296
143 Ga0114129_10089467 3300009147 Bacteria 4268
144 Ga0114129_10634501 3300009147 Bacteria 1380
145 Ga0114129_12052930 3300009147 Unclassified 690
146 Ga0105243_10000357 3300009148 Bacteria 48866
147 Ga0105243_10000920 3300009148 Bacteria 27587
148 Ga0105243_10038958 3300009148 Bacteria 3704
149 Ga0105243_10133221 3300009148 Unclassified 2111
150 Ga0105243_10484187 3300009148 Bacteria 1168
151 Ga0105243_10509485 3300009148 Viruses 1142
152 Ga0105243_11560099 3300009148 Bacteria 686
153 Ga0105241_10824300 3300009174 Bacteria 856
154 Ga0105242_10000916 3300009176 Bacteria 22943
155 Ga0105242_10006463 3300009176 Bacteria 9028
156 Ga0105242_10021841 3300009176 Bacteria 5030
157 Ga0105242_10416205 3300009176 Bacteria 1258
158 Ga0105242_10676146 3300009176 Bacteria 1007
159 Ga0105242_10767072 3300009176 Bacteria 951
160 Ga0105242_10924391 3300009176 Unclassified 874
161 Ga0105242_11015806 3300009176 Unclassified 838
162 Ga0105242_12234303 3300009176 Unclassified 593
163 Ga0105248_10081515 3300009177 Unclassified 3637
164 Ga0105248_10268756 3300009177 Bacteria 1920
165 Ga0105248_10850461 3300009177 Bacteria 1030
166 Ga0105248_12378331 3300009177 Unclassified 603
167 Ga0105249_10013474 3300009553 Bacteria 7219
168 Ga0105249_10048194 3300009553 Bacteria 3885
169 Ga0105249_12322020 3300009553 Bacteria 609
170 Ga0105249_12339886 3300009553 Bacteria 607
171 Ga0105239_10023320 3300010375 Bacteria 6816
172 Ga0105239_11221817 3300010375 Bacteria 866
173 Ga0105246_11062188 3300011119 Bacteria 737
174 Ga0105246_11718822 3300011119 Unclassified 597
175 Ga0157378_10000051 3300013297 Bacteria 102008
176 Ga0157378_10018763 3300013297 Bacteria 6080
177 Ga0157378_10045305 3300013297 Bacteria 3907
178 Ga0157378_10050687 3300013297 Unclassified 3694
179 Ga0157378_10307488 3300013297 Unclassified 1536
180 Ga0157378_10344971 3300013297 Bacteria 1453
181 Ga0157378_11197021 3300013297 Unclassified 799
182 Ga0157378_12021403 3300013297 Unclassified 626
183 Ga0157378_12593481 3300013297 Unclassified 559
184 Ga0163162_10042087 3300013306 Bacteria 4570
185 Ga0163162_10084380 3300013306 Bacteria 3252
186 Ga0163162_11505272 3300013306 Bacteria 767
187 Ga0157375_10011570 3300013308 Bacteria 7794
188 Ga0163163_10807918 3300014325 Bacteria 1001
189 Ga0157380_10752335 3300014326 Unclassified 986
190 Ga0157380_10753589 3300014326 Unclassified 985
191 Ga0157379_10051663 3300014968 Bacteria 3671
192 Ga0163161_11728189 3300017792 Unclassified 555
193 Ga0207672_1000527 3300025223 Bacteria 4738
194 Ga0207653_10000034 3300025885 Bacteria 103130
195 Ga0207653_10200639 3300025885 Unclassified 752
196 Ga0207642_10017226 3300025899 Unclassified 2742
197 Ga0207642_10760173 3300025899 Bacteria 614
198 Ga0207710_10000001 3300025900 Bacteria 1797433
199 Ga0207645_10225332 3300025907 Bacteria 1236
200 Ga0207684_10005477 3300025910 Bacteria 11690
201 Ga0207684_10770780 3300025910 Bacteria 814
202 Ga0207662_10028023 3300025918 Bacteria 3254
203 Ga0207662_10122529 3300025918 Bacteria 1632
204 Ga0207662_10127608 3300025918 Unclassified 1601
205 Ga0207646_10000658 3300025922 Bacteria 44733
206 Ga0207646_10015934 3300025922 Bacteria 7069
207 Ga0207646_10018206 3300025922 Bacteria 6556
208 Ga0207646_11169928 3300025922 Bacteria 675
209 Ga0207646_11295592 3300025922 Unclassified 636
210 Ga0207646_11508744 3300025922 Bacteria 582
211 Ga0207681_11138838 3300025923 Unclassified 655
212 Ga0207644_10154640 3300025931 Bacteria 1777
213 Ga0207644_10155019 3300025931 Unclassified 1775
214 Ga0207686_10000170 3300025934 Bacteria 49724
215 Ga0207686_10001061 3300025934 Bacteria 16235
216 Ga0207686_10023514 3300025934 Bacteria 3561
217 Ga0207686_10235560 3300025934 Unclassified 1330
218 Ga0207686_11314877 3300025934 Unclassified 594
219 Ga0207709_10001213 3300025935 Bacteria 18538
220 Ga0207709_10076435 3300025935 Bacteria 2143
221 Ga0207709_10079409 3300025935 Bacteria 2110
222 Ga0207670_10324023 3300025936 Bacteria 1213
223 Ga0207670_10347997 3300025936 Bacteria 1173
224 Ga0207670_10598306 3300025936 Bacteria 905
225 Ga0207704_10081216 3300025938 Bacteria 2096
226 Ga0207665_10000087 3300025939 Bacteria 60306
227 Ga0207665_11335676 3300025939 Unclassified 571
228 Ga0207665_11543266 3300025939 Bacteria 527
229 Ga0207711_10530344 3300025941 Unclassified 1098
230 Ga0207711_10950427 3300025941 Unclassified 798
231 Ga0207711_11371831 3300025941 Unclassified 649
232 Ga0207689_10038076 3300025942 Bacteria 3984
233 Ga0207651_12061436 3300025960 Unclassified 512
234 Ga0207712_10265398 3300025961 Unclassified 1394
235 Ga0207712_11204348 3300025961 Unclassified 676
236 Ga0207712_11443165 3300025961 Bacteria 616
237 Ga0207640_10391847 3300025981 Viruses 1129
238 Ga0207677_11355643 3300026023 Unclassified 654
239 Ga0207703_10000024 3300026035 Bacteria 217968
240 Ga0207703_10234171 3300026035 Bacteria 1648
241 Ga0207703_10696607 3300026035 Unclassified 966
242 Ga0207708_10143996 3300026075 Bacteria 1872
243 Ga0207708_10452151 3300026075 Unclassified 1070
244 Ga0207641_10190910 3300026088 Bacteria 1883
245 Ga0207641_10992758 3300026088 Unclassified 836
246 Ga0207641_11471361 3300026088 Bacteria 683
247 Ga0207648_10226398 3300026089 Unclassified 1663
248 Ga0207648_10335675 3300026089 Bacteria 1360
249 Ga0207676_10139198 3300026095 Unclassified 2075
250 Ga0207675_100008290 3300026118 Bacteria 9789
251 Ga0207675_100218488 3300026118 Bacteria 1836
252 Ga0209588_1029362 3300027671 Bacteria 1754
253 Ga0207428_10007576 3300027907 Bacteria 9895
254 Ga0268265_10201699 3300028380 Bacteria 1726
255 Ga0268264_10068647 3300028381 Bacteria 2996
256 Ga0268264_10139782 3300028381 Unclassified 2158
257 Ga0268264_10456696 3300028381 Bacteria 1239
258 Ga0268264_11060082 3300028381 Bacteria 818
259 Ga0373946_0628868 3300035171 Unclassified 558
260 Ga0242420_005083 3300038996 Bacteria 2021
261 Ga0451577_0077491 3300042876 Unclassified 2964
262 Ga0453683_0435244 3300044673 Unclassified 847
263 Ga0451576_1304323 3300045051 Unclassified 757
264 Ga0495590_0420615 3300046457 Unclassified 514
265 Ga0495662_0129647 3300046476 Bacteria 1240
266 Ga0495630_0706523 3300046517 Bacteria 771
267 Ga0495598_0019751 3300046537 Bacteria 1771
268 Ga0495659_0020346 3300046664 Bacteria 2228
269 Ga0495669_0307740 3300046684 Bacteria 764
270 Ga0495600_0463050 3300046809 Unclassified 783
271 Ga0495685_228297 3300047447 Bacteria 593
272 Ga0495615_0094227 3300048090 Unclassified 838
273 Ga0501069_0981505 3300049585 Unclassified 515
274 Ga0501077_0953942 3300049593 Unclassified 552
275 nmdc:mga05p37_1657527_c1 3300050507 Unclassified 626
276 nmdc:mga05p37_555608_c1 3300050507 Bacteria 1306
277 nmdc:mga09592_67446_c1 3300050508 Bacteria 3034
278 nmdc:mga0qj67_563409_c1 3300050509 Unclassified 913
279 nmdc:mga08y16_191461_c1 3300050511 Unclassified 2122
280 nmdc:mga0n895_108526_c1 3300050512 Bacteria 2790
281 nmdc:mga0n895_1306973_c1 3300050512 Bacteria 696
282 nmdc:mga0n895_170418_c1 3300050512 Unclassified 2209
283 nmdc:mga0n895_338831_c1 3300050512 Unclassified 1523
284 nmdc:mga0n895_55434_c1 3300050512 Bacteria 3901
285 nmdc:mga0rr50_771859_c1 3300050513 Bacteria 820
286 nmdc:mga0a205_15651_c2 3300050515 Bacteria 3315
287 nmdc:mga0a205_734519_c1 3300050515 Unclassified 836
288 nmdc:mga0a205_83316_c1 3300050515 Unclassified 1427
289 Ga0500566_0529106 3300053094 Unclassified 503
290 Ga0495598_0270388
291 JGI24034J26672_10000005
292 Ga0065704_10159942
293 Ga0065704_10307882
294 Ga0065707_10104678
295 Ga0065707_10119832
296 Ga0070676_10071407
297 Ga0070690_100047114
298 Ga0068869_100027416
299 Ga0068868_100037912
300 Ga0068868_101492417
301 Ga0070689_100038393
302 Ga0070689_100280652
303 Ga0070689_101460425
304 Ga0070687_100095469
305 Ga0070687_100114467
306 Ga0070687_100352189
307 Ga0070669_100894364
308 Ga0070669_101344875
309 Ga0070675_101016012
310 Ga0070671_100054366
311 Ga0070671_101876759
312 Ga0070674_102028300
313 Ga0070673_100040857
314 Ga0070688_100466161
315 Ga0070688_101283284
316 Ga0070703_10000091
317 Ga0070710_10058403
318 Ga0070701_11291749
319 Ga0070711_101474756
320 Ga0070705_100086089
321 Ga0070705_100214746
322 Ga0070705_100373302
323 Ga0070705_100567412
324 Ga0070705_101365371
325 Ga0070700_100074848
326 Ga0070700_100411799
327 Ga0070700_100959217
328 Ga0070694_100014511
329 Ga0070694_100712744
330 Ga0070694_101094582
331 Ga0070694_101366521
332 Ga0070694_101864199
333 Ga0070708_100125124
334 Ga0070708_102040568
335 Ga0068867_100899798
336 Ga0068867_101154884
337 Ga0070706_100535959
338 Ga0070706_101713945
339 Ga0070707_100000435
340 Ga0070707_100431039
341 Ga0070707_100889647
342 Ga0070698_100000312
343 Ga0070698_100028364
344 Ga0070698_100070869
345 Ga0070698_100221441
346 Ga0070698_100282223
347 Ga0070698_100532288
348 Ga0070698_101746366
349 Ga0070699_100179018
350 Ga0070699_100324525
351 Ga0070699_100628513
352 Ga0070699_101269616
353 Ga0070697_100000046
354 Ga0070697_100033242
355 Ga0070697_100044547
356 Ga0070686_100010777
357 Ga0070686_100109461
358 Ga0070695_100133742
359 Ga0070695_100961755
360 Ga0070695_101311967
361 Ga0070696_100064181
362 Ga0070696_100555180
363 Ga0070696_101013584
364 Ga0070693_101422301
365 Ga0070693_101521824
366 Ga0070704_100152564
367 Ga0070704_100178374
368 Ga0070704_100179004
369 Ga0070704_100242973
370 Ga0070704_100558010
371 Ga0070704_101250344
372 Ga0068854_100748297
373 Ga0070702_101308180
374 Ga0070702_101375098
375 Ga0068852_100587609
376 Ga0068859_100355775
377 Ga0068859_100719970
378 Ga0068859_100988365
379 Ga0068859_101658733
380 Ga0068864_100485421
381 Ga0068866_10011288
382 Ga0068866_10263280
383 Ga0068861_100079049
384 Ga0068861_100431571
385 Ga0068863_101008726
386 Ga0068863_101377851
387 Ga0068863_101474048
388 Ga0068858_100000311
389 Ga0068858_100161060
390 Ga0068858_100163390
391 Ga0068858_100694656
392 Ga0068858_100738976
393 Ga0068860_100081011
394 Ga0068860_100106361
395 Ga0068860_101010229
396 Ga0068862_100077077
397 Ga0068862_100312401
398 Ga0070715_10968913
399 Ga0070716_100000011
400 Ga0070716_100115178
401 Ga0070716_100539283
402 Ga0070716_100571058
403 Ga0097621_100310913
404 Ga0097621_100887373
405 Ga0068871_101002420
406 Ga0075428_100032741
407 Ga0075430_101556875
408 Ga0075433_10025719
409 Ga0075433_10149590
410 Ga0075433_10239891
411 Ga0075433_10641653
412 Ga0075434_100086377
413 Ga0075434_100129537
414 Ga0075434_100936013
415 Ga0075434_101383079
416 Ga0075434_101526189
417 Ga0075429_100028211
418 Ga0068865_101642025
419 Ga0075436_100000011
420 Ga0075436_100679404
421 Ga0097620_100355801
422 Ga0097620_100719866
423 Ga0097620_100988342
424 Ga0097620_101658058
425 Ga0075435_100046123
426 Ga0075435_101254882
427 Ga0099794_10002649
428 Ga0111539_10016807
429 Ga0105245_10552836
430 Ga0105247_10000022
431 Ga0114129_10014339
432 Ga0114129_10089467
433 Ga0114129_10634501
434 Ga0114129_12052930
435 Ga0105243_10000357
436 Ga0105243_10000920
437 Ga0105243_10038958
438 Ga0105243_10133221
439 Ga0105243_10484187
440 Ga0105243_10509485
441 Ga0105243_11560099
442 Ga0105241_10824300
443 Ga0105242_10000916
444 Ga0105242_10006463
445 Ga0105242_10021841
446 Ga0105242_10416205
447 Ga0105242_10676146
448 Ga0105242_10767072
449 Ga0105242_10924391
450 Ga0105242_11015806
451 Ga0105242_12234303
452 Ga0105248_10081515
453 Ga0105248_10268756
454 Ga0105248_10850461
455 Ga0105248_12378331
456 Ga0105249_10013474
457 Ga0105249_10048194
458 Ga0105249_12322020
459 Ga0105249_12339886
460 Ga0105239_10023320
461 Ga0105239_11221817
462 Ga0105246_11062188
463 Ga0105246_11718822
464 Ga0157378_10000051
465 Ga0157378_10018763
466 Ga0157378_10045305
467 Ga0157378_10050687
468 Ga0157378_10307488
469 Ga0157378_10344971
470 Ga0157378_11197021
471 Ga0157378_12021403
472 Ga0157378_12593481
473 Ga0163162_10042087
474 Ga0163162_10084380
475 Ga0163162_11505272
476 Ga0157375_10011570
477 Ga0163163_10807918
478 Ga0157380_10752335
479 Ga0157380_10753589
480 Ga0157379_10051663
481 Ga0163161_11728189
482 Ga0207672_1000527
483 Ga0207653_10000034
484 Ga0207653_10200639
485 Ga0207642_10017226
486 Ga0207642_10760173
487 Ga0207710_10000001
488 Ga0207645_10225332
489 Ga0207684_10005477
490 Ga0207684_10770780
491 Ga0207662_10028023
492 Ga0207662_10122529
493 Ga0207662_10127608
494 Ga0207646_10000658
495 Ga0207646_10015934
496 Ga0207646_10018206
497 Ga0207646_11169928
498 Ga0207646_11295592
499 Ga0207646_11508744
500 Ga0207681_11138838
501 Ga0207644_10154640
502 Ga0207644_10155019
503 Ga0207686_10000170
504 Ga0207686_10001061
505 Ga0207686_10023514
506 Ga0207686_10235560
507 Ga0207686_11314877
508 Ga0207709_10001213
509 Ga0207709_10076435
510 Ga0207709_10079409
511 Ga0207670_10324023
512 Ga0207670_10347997
513 Ga0207670_10598306
514 Ga0207704_10081216
515 Ga0207665_10000087
516 Ga0207665_11335676
517 Ga0207665_11543266
518 Ga0207711_10530344
519 Ga0207711_10950427
520 Ga0207711_11371831
521 Ga0207689_10038076
522 Ga0207651_12061436
523 Ga0207712_10265398
524 Ga0207712_11204348
525 Ga0207712_11443165
526 Ga0207640_10391847
527 Ga0207677_11355643
528 Ga0207703_10000024
529 Ga0207703_10234171
530 Ga0207703_10696607
531 Ga0207708_10143996
532 Ga0207708_10452151
533 Ga0207641_10190910
534 Ga0207641_10992758
535 Ga0207641_11471361
536 Ga0207648_10226398
537 Ga0207648_10335675
538 Ga0207676_10139198
539 Ga0207675_100008290
540 Ga0207675_100218488
541 Ga0209588_1029362
542 Ga0207428_10007576
543 Ga0268265_10201699
544 Ga0268264_10068647
545 Ga0268264_10139782
546 Ga0268264_10456696
547 Ga0268264_11060082
548 Ga0373946_0628868
549 Ga0242420_005083
550 Ga0451577_0077491
551 Ga0453683_0435244
552 Ga0451576_1304323
553 Ga0495590_0420615
554 Ga0495662_0129647
555 Ga0495630_0706523
556 Ga0495598_0019751
557 Ga0495659_0020346
558 Ga0495669_0307740
559 Ga0495600_0463050
560 Ga0495685_228297
561 Ga0495615_0094227
562 Ga0501069_0981505
563 Ga0501077_0953942
564 nmdc:mga05p37_1657527_c1
565 nmdc:mga05p37_555608_c1
566 nmdc:mga09592_67446_c1
567 nmdc:mga0qj67_563409_c1
568 nmdc:mga08y16_191461_c1
569 nmdc:mga0n895_108526_c1
570 nmdc:mga0n895_1306973_c1
571 nmdc:mga0n895_170418_c1
572 nmdc:mga0n895_338831_c1
573 nmdc:mga0n895_55434_c1
574 nmdc:mga0rr50_771859_c1
575 nmdc:mga0a205_15651_c2
576 nmdc:mga0a205_734519_c1
577 nmdc:mga0a205_83316_c1
578 Ga0500566_0529106

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01192

RNA_pol_Rpb6

RNA polymerase Rpb6

16

67

0.95

Map