F389359

General Info

Members Datasets Scaffolds Average Seq Length
289 210 273 249

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0015023|Ga0495638_0015023_3774_4571
Length 265
Sequence VASGKDAMLFEGFLAMNDLNRGYARSIPVDRADMSVDAGLRSFMLGVYNKVALGLLLSAGLAFLTTAYAPVANMLYVLTPDGRLAGFTLLGMALRFAPLVMILVSVFAMRNPTARSSGALYWALVASIGAGLGLWLIVYNIQSVFSTFLITAIAFGGLSLFGYTTKKDLTGFGSFLIMGLIGLVLASLVQMFLHLPGLSFIISILGVFIFAGLIAYDTQNLKMSYYQLGGDQQSMAVATNYGALNLYLNFINLFQFLLSIFGSRR

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
6 2643221583 Caulobacter sp. Root655 Isolate Unclassified
7 2643221584 Caulobacter sp. Root656 Isolate Unclassified
8 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
9 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
10 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
11 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
12 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
13 2818991435 Caulobacter henricii 536 Isolate Unclassified
14 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
15 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
16 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
56 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
73 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
109 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
110 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
111 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
112 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
113 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
117 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
125 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
126 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
127 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
128 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
129 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
130 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
131 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
132 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
133 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
134 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
135 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
136 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
137 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
138 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
139 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
140 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
141 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
142 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
143 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
144 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
145 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
146 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
147 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
148 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
149 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
150 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
151 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
152 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
153 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
154 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
155 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
156 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
165 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
166 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
167 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
168 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
169 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
176 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
177 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
178 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
179 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
180 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
181 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
182 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
183 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
184 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
185 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
186 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
187 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
188 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
189 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
190 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
191 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
192 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
193 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
194 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
195 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
196 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
197 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
198 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
199 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
200 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
201 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
202 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.31
Metatranscriptomes 4.15
Isolates 5.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.3
Nodule 0
Rhizoplane 4.15
Rhizosphere 68.86
Stem 0
Stem Tuber 0
Unclassified 9.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055526_1015644 3300003771 Bacteria 3033
2 Ga0055537_1001924 3300003773 Bacteria 7433
3 Ga0055524_1005942 3300003775 Bacteria 5370
4 Ga0055528_1004265 3300003790 Bacteria 6917
5 Ga0055531_10007780 3300003794 Bacteria 5776
6 Ga0065165_1001973 3300005262 Bacteria 19389
7 Ga0070658_10048074 3300005327 Bacteria 3453
8 Ga0070670_100095252 3300005331 Bacteria 2560
9 Ga0068869_100636459 3300005334 Bacteria 904
10 Ga0070680_100023637 3300005336 Bacteria 4904
11 Ga0068868_100048048 3300005338 Bacteria 3347
12 Ga0070660_100110602 3300005339 Bacteria 2185
13 Ga0070691_10020301 3300005341 Bacteria 3069
14 Ga0070661_100376848 3300005344 Bacteria 1118
15 Ga0070668_100000610 3300005347 Bacteria 23961
16 Ga0070668_100004133 3300005347 Bacteria 10751
17 Ga0070668_100015020 3300005347 Bacteria 5783
18 Ga0070668_100176701 3300005347 Bacteria 1741
19 Ga0070669_100049409 3300005353 Bacteria 3070
20 Ga0070671_100287273 3300005355 Bacteria 1399
21 Ga0070673_100097543 3300005364 Bacteria 2414
22 Ga0070659_100536964 3300005366 Bacteria 1000
23 Ga0070667_100009149 3300005367 Bacteria 8198
24 Ga0070663_100564693 3300005455 Bacteria 953
25 Ga0070662_100067021 3300005457 Bacteria 2635
26 Ga0070681_10024709 3300005458 Bacteria 6044
27 Ga0070679_100011322 3300005530 Bacteria 8505
28 Ga0070679_100074618 3300005530 Bacteria 3382
29 Ga0068853_100014280 3300005539 Bacteria 6501
30 Ga0068853_100159615 3300005539 Bacteria 2034
31 Ga0070665_100001531 3300005548 Bacteria 26744
32 Ga0070665_100080392 3300005548 Bacteria 3265
33 Ga0068855_100018847 3300005563 Bacteria 8295
34 Ga0068855_100290887 3300005563 Bacteria 1811
35 Ga0068855_100398103 3300005563 Bacteria 1509
36 Ga0068857_100188774 3300005577 Bacteria 1877
37 Ga0068857_100618445 3300005577 Bacteria 1025
38 Ga0068856_100093355 3300005614 Bacteria 2995
39 Ga0068856_100267321 3300005614 Bacteria 1726
40 Ga0068859_100002128 3300005617 Bacteria 20159
41 Ga0068859_100478146 3300005617 Bacteria 1341
42 Ga0068864_100001593 3300005618 Bacteria 18693
43 Ga0068864_100211325 3300005618 Bacteria 1787
44 Ga0068861_100467750 3300005719 Bacteria 1133
45 Ga0068863_100000262 3300005841 Bacteria 55027
46 Ga0068863_100005675 3300005841 Bacteria 12256
47 Ga0068863_100762064 3300005841 Bacteria 964
48 Ga0068858_100001087 3300005842 Bacteria 28118
49 Ga0068860_100000540 3300005843 Bacteria 46055
50 Ga0068862_100031143 3300005844 Bacteria 4500
51 Ga0068862_100080524 3300005844 Bacteria 2824
52 Ga0070717_10221049 3300006028 Bacteria 1665
53 Ga0097620_100002128 3300006931 Bacteria 20159
54 Ga0097620_100478180 3300006931 Bacteria 1341
55 Ga0105251_10062443 3300009011 Bacteria 1750
56 Ga0105250_10004815 3300009092 Bacteria 6148
57 Ga0105240_10347449 3300009093 Bacteria 1683
58 Ga0105248_10026306 3300009177 Bacteria 6473
59 Ga0105248_10026748 3300009177 Bacteria 6416
60 Ga0105248_10290942 3300009177 Bacteria 1839
61 Ga0105238_10046974 3300009551 Bacteria 4354
62 Ga0105238_10057231 3300009551 Bacteria 3910
63 Ga0105249_10154571 3300009553 Bacteria 2211
64 Ga0105249_10689283 3300009553 Bacteria 1081
65 Ga0105239_10505795 3300010375 Bacteria 1374
66 Ga0163162_10041548 3300013306 Bacteria 4602
67 Ga0163162_10232544 3300013306 Bacteria 1974
68 Ga0157372_10359382 3300013307 Bacteria 1697
69 Ga0157375_10638549 3300013308 Bacteria 1221
70 Ga0163163_10016154 3300014325 Bacteria 6929
71 Ga0163163_10095602 3300014325 Bacteria 2991
72 Ga0163163_10115829 3300014325 Bacteria 2711
73 Ga0157379_10004025 3300014968 Bacteria 12524
74 Ga0163161_10173368 3300017792 Bacteria 1650
75 Ga0213876_10047815 3300021384 Bacteria 2262
76 Ga0213876_10077388 3300021384 Bacteria 1757
77 Ga0209565_1000090 3300025263 Bacteria 146540
78 Ga0209673_1002022 3300025273 Bacteria 15508
79 Ga0209676_1000272 3300025292 Bacteria 107765
80 Ga0209758_1002139 3300025297 Bacteria 20817
81 Ga0209758_1002576 3300025297 Bacteria 18204
82 Ga0209050_1000344 3300025298 Bacteria 92033
83 Ga0209256_1002382 3300025299 Bacteria 15508
84 Ga0209256_1004687 3300025299 Bacteria 8387
85 Ga0209051_1003206 3300025303 Bacteria 10922
86 Ga0209257_1000192 3300025304 Bacteria 151851
87 Ga0209257_1000624 3300025304 Bacteria 56974
88 Ga0209257_1007538 3300025304 Bacteria 6537
89 Ga0207696_1042231 3300025711 Bacteria 1329
90 Ga0207705_10002453 3300025909 Bacteria 14300
91 Ga0207707_10454829 3300025912 Bacteria 1095
92 Ga0207695_10006813 3300025913 Bacteria 14728
93 Ga0207660_10009386 3300025917 Bacteria 6333
94 Ga0207657_10003879 3300025919 Bacteria 15867
95 Ga0207649_10285531 3300025920 Bacteria 1201
96 Ga0207652_10010411 3300025921 Bacteria 7487
97 Ga0207652_10063975 3300025921 Bacteria 3182
98 Ga0207681_10004472 3300025923 Bacteria 8604
99 Ga0207694_10213854 3300025924 Bacteria 1571
100 Ga0207650_10324846 3300025925 Bacteria 1261
101 Ga0207644_10152333 3300025931 Bacteria 1790
102 Ga0207706_10085371 3300025933 Bacteria 2775
103 Ga0207711_10005870 3300025941 Bacteria 10364
104 Ga0207711_10034538 3300025941 Bacteria 4282
105 Ga0207711_10441882 3300025941 Bacteria 1210
106 Ga0207689_10655753 3300025942 Bacteria 884
107 Ga0207667_10116812 3300025949 Bacteria 2749
108 Ga0207667_10249055 3300025949 Bacteria 1817
109 Ga0207651_10113744 3300025960 Bacteria 2037
110 Ga0207712_10044748 3300025961 Bacteria 3061
111 Ga0207668_10000013 3300025972 Bacteria 167989
112 Ga0207668_10012718 3300025972 Bacteria 5161
113 Ga0207640_10280790 3300025981 Bacteria 1308
114 Ga0207658_10052428 3300025986 Bacteria 3010
115 Ga0207677_10285800 3300026023 Bacteria 1356
116 Ga0207703_10000051 3300026035 Bacteria 145390
117 Ga0207703_10015235 3300026035 Bacteria 5998
118 Ga0207639_10031457 3300026041 Bacteria 3901
119 Ga0207639_10142921 3300026041 Bacteria 1996
120 Ga0207639_10149130 3300026041 Bacteria 1957
121 Ga0207702_10195517 3300026078 Bacteria 1872
122 Ga0207702_10434723 3300026078 Bacteria 1271
123 Ga0207702_10455783 3300026078 Bacteria 1241
124 Ga0207641_10000003 3300026088 Bacteria 496984
125 Ga0207641_10042539 3300026088 Bacteria 3811
126 Ga0207641_10106040 3300026088 Bacteria 2483
127 Ga0207676_10007303 3300026095 Bacteria 7835
128 Ga0207676_10052219 3300026095 Bacteria 3194
129 Ga0207676_10141814 3300026095 Bacteria 2058
130 Ga0207675_100545605 3300026118 Bacteria 1158
131 Ga0268266_10004813 3300028379 Bacteria 12825
132 Ga0268266_10147852 3300028379 Bacteria 2114
133 Ga0268266_10270828 3300028379 Bacteria 1576
134 Ga0268265_10008926 3300028380 Bacteria 6776
135 Ga0268265_10068427 3300028380 Bacteria 2753
136 Ga0268265_10098242 3300028380 Bacteria 2358
137 Ga0268265_10145663 3300028380 Bacteria 1990
138 Ga0268264_10000091 3300028381 Bacteria 233338
139 Ga0307515_10042742 3300028794 Bacteria 7077
140 Ga0307515_10060368 3300028794 Bacteria 5409
141 Ga0265338_10198741 3300028800 Bacteria 1513
142 Ga0265327_10000279 3300031251 Bacteria 100885
143 Ga0265316_10223676 3300031344 Bacteria 1388
144 Ga0307513_10000100 3300031456 Bacteria 125183
145 Ga0307513_10051939 3300031456 Bacteria 4417
146 Ga0307516_10000338 3300031730 Bacteria 61339
147 Ga0307405_10251269 3300031731 Bacteria 1316
148 Ga0307414_10603449 3300032004 Bacteria 984
149 Ga0307510_10081193 3300033180 Bacteria 3146
150 Ga0307510_10357833 3300033180 Bacteria 909
151 Ga0373943_0124937 3300035170 Bacteria 1371
152 Ga0373925_0487598 3300037068 Bacteria 1011
153 Ga0395900_0317611 3300037418 Bacteria 1539
154 Ga0395898_0036015 3300037466 Bacteria 4917
155 Ga0436364_0132234 3300037853 Bacteria 1056
156 Ga0395901_0216258 3300038443 Bacteria 2004
157 Ga0436365_1197259 3300039437 Bacteria 2176
158 Ga0436365_1580449 3300039437 Bacteria 5472
159 Ga0439461_0065780 3300041410 Bacteria 831
160 Ga0439459_0011308 3300042438 Bacteria 1571
161 Ga0495617_014598 3300046452 Bacteria 2670
162 Ga0495627_000796 3300046453 Bacteria 23045
163 Ga0495590_0001376 3300046457 Bacteria 10555
164 Ga0495638_0000292 3300046460 Bacteria 65766
165 Ga0495638_0008087 3300046460 Bacteria 7481
166 Ga0495638_0013112 3300046460 Bacteria 5658
167 Ga0495638_0015023 3300046460 Bacteria 5212
168 Ga0495650_0000168 3300046471 Bacteria 145714
169 Ga0495606_0167147 3300046507 Bacteria 1279
170 Ga0495610_0003345 3300046512 Bacteria 12581
171 Ga0495616_0000134 3300046513 Bacteria 63981
172 Ga0495620_0007759 3300046515 Bacteria 5797
173 Ga0495631_0003801 3300046518 Bacteria 8210
174 Ga0495632_0002199 3300046519 Bacteria 15048
175 Ga0495632_0045449 3300046519 Bacteria 2187
176 Ga0495648_0000733 3300046524 Bacteria 35083
177 Ga0495663_0158705 3300046525 Bacteria 775
178 Ga0495642_0113552 3300046528 Bacteria 1159
179 Ga0495654_0000085 3300046530 Bacteria 107010
180 Ga0495654_0054379 3300046530 Bacteria 1942
181 Ga0495609_0041010 3300046538 Bacteria 2082
182 Ga0495621_0184543 3300046539 Bacteria 834
183 Ga0495597_0190647 3300046542 Bacteria 825
184 Ga0495668_0013892 3300046616 Bacteria 4735
185 Ga0495668_0171290 3300046616 Bacteria 1189
186 Ga0495611_0002565 3300046648 Bacteria 8238
187 Ga0495625_0000034 3300046660 Bacteria 225120
188 Ga0495625_0004388 3300046660 Bacteria 13384
189 Ga0495625_0041161 3300046660 Bacteria 3364
190 Ga0495635_0493406 3300046663 Bacteria 807
191 Ga0495588_0391290 3300046674 Bacteria 730
192 Ga0495669_0000006 3300046684 Bacteria 190838
193 Ga0495669_0002414 3300046684 Bacteria 7653
194 Ga0495589_0011264 3300046794 Bacteria 4642
195 Ga0495581_0111129 3300047315 Bacteria 1594
196 Ga0495672_0002366 3300047320 Bacteria 17415
197 Ga0495673_0000697 3300047469 Bacteria 32802
198 Ga0495673_0001053 3300047469 Bacteria 24277
199 Ga0495673_0006657 3300047469 Bacteria 6767
200 Ga0495686_0006587 3300047472 Bacteria 8857
201 Ga0495686_0007798 3300047472 Bacteria 7964
202 Ga0495686_0137609 3300047472 Bacteria 1443
203 Ga0495602_0227199 3300048088 Bacteria 1405
204 Ga0496100_0292054 3300048903 Bacteria 1218
205 Ga0496101_0050437 3300048904 Bacteria 2996
206 Ga0496102_0031556 3300048905 Bacteria 4754
207 Ga0496102_0263842 3300048905 Bacteria 1624
208 Ga0496105_0365304 3300048908 Bacteria 1151
209 Ga0496107_0029367 3300048910 Bacteria 3911
210 Ga0496107_0427942 3300048910 Bacteria 984
211 Ga0496108_0053249 3300048911 Bacteria 3393
212 Ga0496109_0111960 3300048912 Bacteria 2538
213 Ga0496112_0076909 3300048915 Bacteria 3300
214 Ga0496115_0001531 3300048918 Bacteria 16601
215 Ga0496115_0014443 3300048918 Bacteria 5977
216 Ga0496121_0095931 3300048924 Bacteria 2303
217 Ga0496124_0384425 3300048927 Bacteria 980
218 Ga0496125_0035010 3300048928 Bacteria 4415
219 Ga0496125_0109728 3300048928 Bacteria 2002
220 Ga0496126_0022610 3300048929 Bacteria 6111
221 Ga0496126_0684907 3300048929 Bacteria 798
222 Ga0501308_020984 3300049128 Bacteria 817
223 Ga0501308_021669 3300049128 Bacteria 808
224 Ga0501304_009486 3300049160 Bacteria 836
225 Ga0495678_076612 3300049459 Bacteria 1211
226 Ga0501034_0135952 3300049571 Bacteria 2439
227 Ga0501038_0294894 3300049574 Bacteria 1274
228 Ga0501047_0074243 3300049581 Bacteria 3274
229 Ga0501047_0194822 3300049581 Bacteria 1889
230 Ga0501238_000277 3300049671 Bacteria 6803
231 Ga0501238_005620 3300049671 Bacteria 1595
232 Ga0501257_001511 3300049686 Bacteria 4851
233 nmdc:mga0k408_68353_c1 3300050493 Bacteria 2072
234 nmdc:mga07m45_168539_c1 3300050496 Bacteria 1272
235 nmdc:mga0sz30_5449_c1 3300050516 Bacteria 4667
236 Ga0500643_007543 3300053087 Bacteria 4368
237 Ga0500643_012526 3300053087 Bacteria 3033
238 Ga0500644_0000379 3300053088 Bacteria 21729
239 Ga0500646_0084936 3300053090 Bacteria 971
240 Ga0500641_0016580 3300053096 Bacteria 2744
241 Ga0500641_0075992 3300053096 Bacteria 1420
242 Ga0500555_001071 3300053103 Bacteria 9192
243 Ga0500556_0004511 3300053104 Bacteria 3962
244 Ga0500556_0052625 3300053104 Bacteria 1478
245 Ga0500562_002213 3300053108 Bacteria 4864
246 Ga0500572_002170 3300053111 Bacteria 4827
247 Ga0500608_076119 3300053122 Bacteria 1590
248 Ga0500614_033237 3300053123 Bacteria 1274
249 Ga0500655_014835 3300053133 Bacteria 1427
250 Ga0500658_0003206 3300053134 Bacteria 6226
251 Ga0500559_0000004 3300053136 Bacteria 241551
252 Ga0500559_0007873 3300053136 Bacteria 4703
253 Ga0500564_000033 3300053138 Bacteria 39298
254 Ga0500577_0021797 3300053142 Bacteria 2116
255 Ga0500604_0114823 3300053151 Bacteria 897
256 Ga0500616_0026150 3300053153 Bacteria 3233
257 Ga0500622_0000553 3300053156 Bacteria 34248
258 Ga0500622_0030832 3300053156 Bacteria 2813
259 Ga0500622_0137537 3300053156 Bacteria 1168
260 Ga0500627_0006179 3300053158 Bacteria 4053
261 Ga0500611_002379 3300053727 Bacteria 2241
262 Ga0500645_005296 3300053730 Bacteria 4775
263 Ga0500645_016080 3300053730 Bacteria 2361
264 Ga0500609_003639 3300053731 Bacteria 2148
265 Ga0587084_025839 3300059477 Bacteria 913
266 Ga0587085_029139 3300059506 Bacteria 896
267 Ga0587086_029303 3300059507 Bacteria 800
268 Ga0587090_038051 3300059510 Bacteria 835
269 Ga0587095_008956 3300059514 Bacteria 821
270 Ga0587098_015132 3300059604 Bacteria 918
271 Ga0587069_015208 3300059642 Bacteria 1084
272 Ga0587076_034715 3300059645 Bacteria 913
273 Ga0587111_0076969 3300060346 Bacteria 790

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026078 Ga0207702_10434723 Ga0207702_104347231 221
2 3300046674 Ga0495588_0391290 Ga0495588_0391290_39_707 222
3 3300048929 Ga0496126_0684907 Ga0496126_0684907_30_698 222
4 3300053151 Ga0500604_0114823 Ga0500604_0114823_11_679 222
5 iso_pu_bacteria 2643221598 2644001787 224
6 3300005334 Ga0068869_100636459 Ga0068869_1006364591 225
7 3300025942 Ga0207689_10655753 Ga0207689_106557531 225
8 3300039437 Ga0436365_1197259 Ga0436365_1197259_992_1738 229
9 3300005347 Ga0070668_100176701 Ga0070668_1001767012 231
10 3300046528 Ga0495642_0113552 Ga0495642_0113552_433_1131 232
11 3300046542 Ga0495597_0190647 Ga0495597_0190647_112_810 232
12 3300021384 Ga0213876_10077388 Ga0213876_100773882 234
13 3300046663 Ga0495635_0493406 Ga0495635_0493406_21_770 234
14 3300047315 Ga0495581_0111129 Ga0495581_0111129_542_1291 234
15 3300048088 Ga0495602_0227199 Ga0495602_0227199_451_1200 234
16 3300037853 Ga0436364_0132234 Ga0436364_0132234_292_1038 237
17 3300041410 Ga0439461_0065780 Ga0439461_0065780_104_817 237
18 3300046525 Ga0495663_0158705 Ga0495663_0158705_49_762 237
19 3300053096 Ga0500641_0016580 Ga0500641_0016580_1912_2655 237
20 3300017792 Ga0163161_10173368 Ga0163161_101733682 238
21 3300028379 Ga0268266_10147852 Ga0268266_101478523 238
22 3300053111 Ga0500572_002170 Ga0500572_002170_526_1284 238
23 3300060346 Ga0587111_0076969 Ga0587111_0076969_48_773 241
24 3300005347 Ga0070668_100015020 Ga0070668_1000150205 242
25 3300005353 Ga0070669_100049409 Ga0070669_1000494093 242
26 3300005548 Ga0070665_100080392 Ga0070665_1000803924 242
27 3300005617 Ga0068859_100002128 Ga0068859_1000021284 242
28 3300005841 Ga0068863_100005675 Ga0068863_1000056754 242
29 3300005844 Ga0068862_100031143 Ga0068862_1000311432 242
30 3300006931 Ga0097620_100002128 Ga0097620_1000021284 242
31 3300009177 Ga0105248_10026748 Ga0105248_100267484 242
32 3300013306 Ga0163162_10041548 Ga0163162_100415484 242
33 3300014325 Ga0163163_10016154 Ga0163163_100161547 242
34 3300014968 Ga0157379_10004025 Ga0157379_1000402510 242
35 3300025923 Ga0207681_10004472 Ga0207681_100044722 242
36 3300025925 Ga0207650_10324846 Ga0207650_103248462 242
37 3300025941 Ga0207711_10005870 Ga0207711_100058704 242
38 3300025986 Ga0207658_10052428 Ga0207658_100524283 242
39 3300026035 Ga0207703_10015235 Ga0207703_100152352 242
40 3300026088 Ga0207641_10042539 Ga0207641_100425396 242
41 3300028379 Ga0268266_10270828 Ga0268266_102708282 242
42 3300032004 Ga0307414_10603449 Ga0307414_106034491 242
43 3300025981 Ga0207640_10280790 Ga0207640_102807902 244
44 iso_pu_bacteria 2643221614 2644087821 245
45 iso_pu_bacteria 2643221661 2644345425 245
46 iso_pu_bacteria 2643221666 2644367177 245
47 iso_pu_bacteria 2510917020 2511124466 246
48 iso_pu_bacteria 2582581280 2585151149 246
49 iso_pu_bacteria 2582581293 2585196190 246
50 iso_pu_bacteria 2643221545 2643750150 246
51 iso_pu_bacteria 2643221583 2643922371 246
52 iso_pu_bacteria 2643221584 2643931995 246
53 iso_pu_bacteria 2818991435 2819538227 246
54 iso_pu_bacteria 2818991454 2819647203 246
55 iso_pu_bacteria 2849573788 2849576234 246
56 iso_pu_bacteria 2928531327 2928532235 246
57 3300005563 Ga0068855_100290887 Ga0068855_1002908872 247
58 3300049128 Ga0501308_021669 Ga0501308_021669_27_791 247
59 3300053123 Ga0500614_033237 Ga0500614_033237_142_888 247
60 3300005614 Ga0068856_100267321 Ga0068856_1002673212 248
61 3300006028 Ga0070717_10221049 Ga0070717_102210493 248
62 3300010375 Ga0105239_10505795 Ga0105239_105057952 248
63 3300013308 Ga0157375_10638549 Ga0157375_106385491 248
64 3300026078 Ga0207702_10195517 Ga0207702_101955172 248
65 3300028800 Ga0265338_10198741 Ga0265338_101987412 248
66 3300031251 Ga0265327_10000279 Ga0265327_1000027988 248
67 3300031730 Ga0307516_10000338 Ga0307516_100003387 248
68 3300048918 Ga0496115_0014443 Ga0496115_0014443_5053_5826 248
69 3300049581 Ga0501047_0074243 Ga0501047_0074243_1806_2552 248
70 3300050516 nmdc:mga0sz30_5449_c1 nmdc:mga0sz30_5449_c1_2834_3583 248
71 3300059477 Ga0587084_025839 Ga0587084_025839_37_783 248
72 3300059506 Ga0587085_029139 Ga0587085_029139_20_766 248
73 3300059507 Ga0587086_029303 Ga0587086_029303_26_772 248
74 3300059642 Ga0587069_015208 Ga0587069_015208_252_998 248
75 3300059645 Ga0587076_034715 Ga0587076_034715_139_885 248
76 3300005347 Ga0070668_100004133 Ga0070668_1000041337 249
77 3300005366 Ga0070659_100536964 Ga0070659_1005369641 249
78 3300005614 Ga0068856_100093355 Ga0068856_1000933553 249
79 3300005618 Ga0068864_100001593 Ga0068864_10000159315 249
80 3300005719 Ga0068861_100467750 Ga0068861_1004677501 249
81 3300005841 Ga0068863_100000262 Ga0068863_10000026215 249
82 3300005842 Ga0068858_100001087 Ga0068858_10000108717 249
83 3300005843 Ga0068860_100000540 Ga0068860_10000054034 249
84 3300009011 Ga0105251_10062443 Ga0105251_100624432 249
85 3300009092 Ga0105250_10004815 Ga0105250_100048159 249
86 3300009177 Ga0105248_10026306 Ga0105248_100263068 249
87 3300013307 Ga0157372_10359382 Ga0157372_103593822 249
88 3300021384 Ga0213876_10047815 Ga0213876_100478153 249
89 3300025711 Ga0207696_1042231 Ga0207696_10422311 249
90 3300025941 Ga0207711_10034538 Ga0207711_100345387 249
91 3300025972 Ga0207668_10012718 Ga0207668_100127182 249
92 3300026035 Ga0207703_10000051 Ga0207703_10000051128 249
93 3300026041 Ga0207639_10149130 Ga0207639_101491303 249
94 3300026078 Ga0207702_10455783 Ga0207702_104557832 249
95 3300026088 Ga0207641_10000003 Ga0207641_10000003137 249
96 3300026095 Ga0207676_10007303 Ga0207676_100073034 249
97 3300026118 Ga0207675_100545605 Ga0207675_1005456052 249
98 3300028380 Ga0268265_10008926 Ga0268265_100089264 249
99 3300028380 Ga0268265_10068427 Ga0268265_100684272 249
100 3300028381 Ga0268264_10000091 Ga0268264_10000091221 249
101 3300028794 Ga0307515_10060368 Ga0307515_100603685 249
102 3300031344 Ga0265316_10223676 Ga0265316_102236762 249
103 3300031456 Ga0307513_10000100 Ga0307513_1000010090 249
104 3300031456 Ga0307513_10051939 Ga0307513_100519394 249
105 3300031731 Ga0307405_10251269 Ga0307405_102512692 249
106 3300033180 Ga0307510_10357833 Ga0307510_103578332 249
107 3300037418 Ga0395900_0317611 Ga0395900_0317611_643_1392 249
108 3300039437 Ga0436365_1580449 Ga0436365_1580449_2687_3436 249
109 3300046460 Ga0495638_0000292 Ga0495638_0000292_27333_28082 249
110 3300046660 Ga0495625_0000034 Ga0495625_0000034_197024_197773 249
111 3300048903 Ga0496100_0292054 Ga0496100_0292054_130_879 249
112 3300048910 Ga0496107_0427942 Ga0496107_0427942_34_783 249
113 3300048928 Ga0496125_0109728 Ga0496125_0109728_881_1630 249
114 3300049128 Ga0501308_020984 Ga0501308_020984_52_801 249
115 3300049160 Ga0501304_009486 Ga0501304_009486_71_820 249
116 3300049686 Ga0501257_001511 Ga0501257_001511_1039_1788 249
117 3300053087 Ga0500643_012526 Ga0500643_012526_803_1552 249
118 3300053103 Ga0500555_001071 Ga0500555_001071_2152_2901 249
119 3300053136 Ga0500559_0000004 Ga0500559_0000004_23523_24272 249
120 3300059510 Ga0587090_038051 Ga0587090_038051_21_770 249
121 3300059514 Ga0587095_008956 Ga0587095_008956_11_760 249
122 3300059604 Ga0587098_015132 Ga0587098_015132_104_853 249
123 3300003771 Ga0055526_1015644 Ga0055526_10156442 250
124 3300003773 Ga0055537_1001924 Ga0055537_10019242 250
125 3300003775 Ga0055524_1005942 Ga0055524_10059425 250
126 3300003790 Ga0055528_1004265 Ga0055528_10042654 250
127 3300003794 Ga0055531_10007780 Ga0055531_100077802 250
128 3300005262 Ga0065165_1001973 Ga0065165_10019738 250
129 3300005327 Ga0070658_10048074 Ga0070658_100480744 250
130 3300005331 Ga0070670_100095252 Ga0070670_1000952523 250
131 3300005336 Ga0070680_100023637 Ga0070680_1000236371 250
132 3300005338 Ga0068868_100048048 Ga0068868_1000480485 250
133 3300005339 Ga0070660_100110602 Ga0070660_1001106022 250
134 3300005341 Ga0070691_10020301 Ga0070691_100203012 250
135 3300005344 Ga0070661_100376848 Ga0070661_1003768481 250
136 3300005347 Ga0070668_100000610 Ga0070668_10000061018 250
137 3300005355 Ga0070671_100287273 Ga0070671_1002872732 250
138 3300005364 Ga0070673_100097543 Ga0070673_1000975433 250
139 3300005367 Ga0070667_100009149 Ga0070667_1000091494 250
140 3300005455 Ga0070663_100564693 Ga0070663_1005646931 250
141 3300005457 Ga0070662_100067021 Ga0070662_1000670213 250
142 3300005458 Ga0070681_10024709 Ga0070681_100247095 250
143 3300005530 Ga0070679_100011322 Ga0070679_1000113224 250
144 3300005530 Ga0070679_100074618 Ga0070679_1000746182 250
145 3300005539 Ga0068853_100014280 Ga0068853_1000142804 250
146 3300005539 Ga0068853_100159615 Ga0068853_1001596151 250
147 3300005548 Ga0070665_100001531 Ga0070665_10000153121 250
148 3300005563 Ga0068855_100018847 Ga0068855_1000188474 250
149 3300005563 Ga0068855_100398103 Ga0068855_1003981032 250
150 3300005577 Ga0068857_100188774 Ga0068857_1001887741 250
151 3300005577 Ga0068857_100618445 Ga0068857_1006184451 250
152 3300005617 Ga0068859_100478146 Ga0068859_1004781461 250
153 3300005618 Ga0068864_100211325 Ga0068864_1002113252 250
154 3300005841 Ga0068863_100762064 Ga0068863_1007620641 250
155 3300005844 Ga0068862_100080524 Ga0068862_1000805242 250
156 3300006931 Ga0097620_100478180 Ga0097620_1004781801 250
157 3300009093 Ga0105240_10347449 Ga0105240_103474492 250
158 3300009177 Ga0105248_10290942 Ga0105248_102909422 250
159 3300009551 Ga0105238_10046974 Ga0105238_100469742 250
160 3300009551 Ga0105238_10057231 Ga0105238_100572313 250
161 3300009553 Ga0105249_10154571 Ga0105249_101545713 250
162 3300009553 Ga0105249_10689283 Ga0105249_106892832 250
163 3300013306 Ga0163162_10232544 Ga0163162_102325443 250
164 3300014325 Ga0163163_10095602 Ga0163163_100956024 250
165 3300014325 Ga0163163_10115829 Ga0163163_101158291 250
166 3300025263 Ga0209565_1000090 Ga0209565_1000090115 250
167 3300025273 Ga0209673_1002022 Ga0209673_100202220 250
168 3300025292 Ga0209676_1000272 Ga0209676_100027241 250
169 3300025297 Ga0209758_1002139 Ga0209758_100213914 250
170 3300025297 Ga0209758_1002576 Ga0209758_10025764 250
171 3300025298 Ga0209050_1000344 Ga0209050_100034460 250
172 3300025299 Ga0209256_1002382 Ga0209256_10023822 250
173 3300025299 Ga0209256_1004687 Ga0209256_10046877 250
174 3300025303 Ga0209051_1003206 Ga0209051_100320610 250
175 3300025304 Ga0209257_1000192 Ga0209257_100019220 250
176 3300025304 Ga0209257_1000624 Ga0209257_100062456 250
177 3300025304 Ga0209257_1007538 Ga0209257_10075388 250
178 3300025909 Ga0207705_10002453 Ga0207705_1000245312 250
179 3300025912 Ga0207707_10454829 Ga0207707_104548291 250
180 3300025913 Ga0207695_10006813 Ga0207695_1000681311 250
181 3300025917 Ga0207660_10009386 Ga0207660_100093863 250
182 3300025919 Ga0207657_10003879 Ga0207657_1000387916 250
183 3300025920 Ga0207649_10285531 Ga0207649_102855311 250
184 3300025921 Ga0207652_10010411 Ga0207652_100104111 250
185 3300025921 Ga0207652_10063975 Ga0207652_100639754 250
186 3300025924 Ga0207694_10213854 Ga0207694_102138543 250
187 3300025931 Ga0207644_10152333 Ga0207644_101523331 250
188 3300025933 Ga0207706_10085371 Ga0207706_100853714 250
189 3300025941 Ga0207711_10441882 Ga0207711_104418822 250
190 3300025949 Ga0207667_10116812 Ga0207667_101168122 250
191 3300025949 Ga0207667_10249055 Ga0207667_102490553 250
192 3300025960 Ga0207651_10113744 Ga0207651_101137442 250
193 3300025961 Ga0207712_10044748 Ga0207712_100447483 250
194 3300025972 Ga0207668_10000013 Ga0207668_10000013136 250
195 3300026023 Ga0207677_10285800 Ga0207677_102858002 250
196 3300026041 Ga0207639_10031457 Ga0207639_100314572 250
197 3300026041 Ga0207639_10142921 Ga0207639_101429211 250
198 3300026088 Ga0207641_10106040 Ga0207641_101060402 250
199 3300026095 Ga0207676_10052219 Ga0207676_100522192 250
200 3300026095 Ga0207676_10141814 Ga0207676_101418142 250
201 3300028379 Ga0268266_10004813 Ga0268266_100048131 250
202 3300028380 Ga0268265_10098242 Ga0268265_100982422 250
203 3300028380 Ga0268265_10145663 Ga0268265_101456633 250
204 3300028794 Ga0307515_10042742 Ga0307515_100427424 250
205 3300033180 Ga0307510_10081193 Ga0307510_100811932 250
206 3300035170 Ga0373943_0124937 Ga0373943_0124937_257_1009 250
207 3300037068 Ga0373925_0487598 Ga0373925_0487598_187_939 250
208 3300037466 Ga0395898_0036015 Ga0395898_0036015_2185_2937 250
209 3300038443 Ga0395901_0216258 Ga0395901_0216258_560_1312 250
210 3300042438 Ga0439459_0011308 Ga0439459_0011308_13_765 250
211 3300046452 Ga0495617_014598 Ga0495617_014598_1884_2636 250
212 3300046453 Ga0495627_000796 Ga0495627_000796_10137_10889 250
213 3300046457 Ga0495590_0001376 Ga0495590_0001376_8314_9066 250
214 3300046460 Ga0495638_0008087 Ga0495638_0008087_793_1545 250
215 3300046460 Ga0495638_0013112 Ga0495638_0013112_824_1576 250
216 3300046460 Ga0495638_0015023 Ga0495638_0015023_3774_4571 250
217 3300046471 Ga0495650_0000168 Ga0495650_0000168_89673_90425 250
218 3300046507 Ga0495606_0167147 Ga0495606_0167147_378_1130 250
219 3300046512 Ga0495610_0003345 Ga0495610_0003345_10182_10934 250
220 3300046513 Ga0495616_0000134 Ga0495616_0000134_53429_54181 250
221 3300046515 Ga0495620_0007759 Ga0495620_0007759_1159_1911 250
222 3300046518 Ga0495631_0003801 Ga0495631_0003801_609_1385 250
223 3300046519 Ga0495632_0002199 Ga0495632_0002199_4682_5434 250
224 3300046519 Ga0495632_0045449 Ga0495632_0045449_250_1002 250
225 3300046524 Ga0495648_0000733 Ga0495648_0000733_2082_2834 250
226 3300046530 Ga0495654_0000085 Ga0495654_0000085_86850_87602 250
227 3300046530 Ga0495654_0054379 Ga0495654_0054379_1015_1791 250
228 3300046538 Ga0495609_0041010 Ga0495609_0041010_599_1351 250
229 3300046539 Ga0495621_0184543 Ga0495621_0184543_36_788 250
230 3300046616 Ga0495668_0013892 Ga0495668_0013892_2008_2760 250
231 3300046616 Ga0495668_0171290 Ga0495668_0171290_286_1038 250
232 3300046648 Ga0495611_0002565 Ga0495611_0002565_2982_3734 250
233 3300046660 Ga0495625_0004388 Ga0495625_0004388_2730_3482 250
234 3300046660 Ga0495625_0041161 Ga0495625_0041161_832_1584 250
235 3300046684 Ga0495669_0000006 Ga0495669_0000006_144171_144923 250
236 3300046684 Ga0495669_0002414 Ga0495669_0002414_106_858 250
237 3300046794 Ga0495589_0011264 Ga0495589_0011264_2750_3502 250
238 3300047320 Ga0495672_0002366 Ga0495672_0002366_344_1096 250
239 3300047469 Ga0495673_0000697 Ga0495673_0000697_17805_18557 250
240 3300047469 Ga0495673_0001053 Ga0495673_0001053_19277_20065 250
241 3300047469 Ga0495673_0006657 Ga0495673_0006657_4736_5563 250
242 3300047472 Ga0495686_0006587 Ga0495686_0006587_4795_5547 250
243 3300047472 Ga0495686_0007798 Ga0495686_0007798_1889_2641 250
244 3300047472 Ga0495686_0137609 Ga0495686_0137609_539_1291 250
245 3300048904 Ga0496101_0050437 Ga0496101_0050437_1651_2403 250
246 3300048905 Ga0496102_0031556 Ga0496102_0031556_2429_3181 250
247 3300048905 Ga0496102_0263842 Ga0496102_0263842_799_1551 250
248 3300048908 Ga0496105_0365304 Ga0496105_0365304_311_1063 250
249 3300048910 Ga0496107_0029367 Ga0496107_0029367_1995_2747 250
250 3300048911 Ga0496108_0053249 Ga0496108_0053249_1965_2717 250
251 3300048912 Ga0496109_0111960 Ga0496109_0111960_1017_1769 250
252 3300048915 Ga0496112_0076909 Ga0496112_0076909_2524_3276 250
253 3300048918 Ga0496115_0001531 Ga0496115_0001531_9441_10193 250
254 3300048924 Ga0496121_0095931 Ga0496121_0095931_827_1579 250
255 3300048927 Ga0496124_0384425 Ga0496124_0384425_92_844 250
256 3300048928 Ga0496125_0035010 Ga0496125_0035010_1222_1974 250
257 3300048929 Ga0496126_0022610 Ga0496126_0022610_3056_3808 250
258 3300049459 Ga0495678_076612 Ga0495678_076612_398_1150 250
259 3300049571 Ga0501034_0135952 Ga0501034_0135952_1530_2282 250
260 3300049574 Ga0501038_0294894 Ga0501038_0294894_437_1189 250
261 3300049581 Ga0501047_0194822 Ga0501047_0194822_866_1618 250
262 3300049671 Ga0501238_000277 Ga0501238_000277_2788_3540 250
263 3300049671 Ga0501238_005620 Ga0501238_005620_719_1507 250
264 3300050493 nmdc:mga0k408_68353_c1 nmdc:mga0k408_68353_c1_1087_1884 250
265 3300050496 nmdc:mga07m45_168539_c1 nmdc:mga07m45_168539_c1_169_921 250
266 3300053087 Ga0500643_007543 Ga0500643_007543_430_1182 250
267 3300053088 Ga0500644_0000379 Ga0500644_0000379_1955_2743 250
268 3300053090 Ga0500646_0084936 Ga0500646_0084936_122_874 250
269 3300053096 Ga0500641_0075992 Ga0500641_0075992_278_1054 250
270 3300053104 Ga0500556_0004511 Ga0500556_0004511_1258_2010 250
271 3300053104 Ga0500556_0052625 Ga0500556_0052625_12_800 250
272 3300053108 Ga0500562_002213 Ga0500562_002213_1988_2740 250
273 3300053122 Ga0500608_076119 Ga0500608_076119_188_940 250
274 3300053133 Ga0500655_014835 Ga0500655_014835_592_1344 250
275 3300053134 Ga0500658_0003206 Ga0500658_0003206_3833_4585 250
276 3300053136 Ga0500559_0007873 Ga0500559_0007873_3452_4204 250
277 3300053138 Ga0500564_000033 Ga0500564_000033_36438_37214 250
278 3300053142 Ga0500577_0021797 Ga0500577_0021797_1223_1975 250
279 3300053153 Ga0500616_0026150 Ga0500616_0026150_1196_1948 250
280 3300053156 Ga0500622_0000553 Ga0500622_0000553_30258_31034 250
281 3300053156 Ga0500622_0030832 Ga0500622_0030832_1918_2670 250
282 3300053156 Ga0500622_0137537 Ga0500622_0137537_290_1042 250
283 3300053158 Ga0500627_0006179 Ga0500627_0006179_1235_1987 250
284 3300053727 Ga0500611_002379 Ga0500611_002379_405_1202 250
285 3300053730 Ga0500645_005296 Ga0500645_005296_1318_2070 250
286 3300053730 Ga0500645_016080 Ga0500645_016080_12_764 250
287 3300053731 Ga0500609_003639 Ga0500609_003639_263_1015 250
288 iso_pu_bacteria 2582581279 2585149679 250
289 iso_pu_bacteria 2643221691 2644507039 250

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01027

Bax1-I

Inhibitor of apoptosis-promoting Bax1

41

261

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nq8-assembly2.cif.gz_B crystal structure of yetj mutant from bacillus subtilis - d171e 0.8464 28 246
4pgw-assembly1.cif.gz_A crystal structure of yetj from bacillus subtilis at ph 6 by pt-sad 0.8426 28 246
6nq9-assembly3.cif.gz_C crystal structure of yetj mutant from bacillus subtilis - d195e 0.8414 28 246
4pgw-assembly1.cif.gz_A crystal structure of yetj from bacillus subtilis at ph 6 by pt-sad 0.8227 28 246
6nq8-assembly2.cif.gz_B crystal structure of yetj mutant from bacillus subtilis - d171e 0.8196 28 246
ID Description Score Start End Superfamily
af_P0AAC4_18_230_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9042 28 246 1.20.1250.20
af_P0AAC4_18_230_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8922 28 246 1.20.1250.20
af_Q4DZH5_101_300_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.854 27 245 1.20.1250.20
af_Q6P9T9_32_232_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8443 27 243 1.20.1250.20
af_Q4DZH5_101_300_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8419 27 245 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A257JIU1-F1-model_v4 BAX inhibitor protein 0.9734 39 250 GO:0005886
AF-A0A527H739-F1-model_v4 Bax inhibitor-1/YccA family protein 0.9676 94 250 GO:0005886
AF-X0WMF3-F1-model_v4 Inner membrane protein YbhL 0.9647 123 250 GO:0005886
AF-A0A257JIU1-F1-model_v4 BAX inhibitor protein 0.9643 39 250 GO:0005886
AF-A0A527H739-F1-model_v4 Bax inhibitor-1/YccA family protein 0.9616 94 250 GO:0005886

Feature Viewer

pLDDT pTM Quality
89.47 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map