F389335

General Info

Members Datasets Scaffolds Average Seq Length
289 169 578 152

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0224223|Ga0466963_0224223_307_828
Length 173
Sequence LRPRRHRRHLSGRHLGDRLTQIFVDGDACPVRDEIYRVATRLGLGVSVVTNGSRPLRPPGLPNVRLVFVSDAADAADDWIAEHIAAADVCVTSDIPLAARCLAKGARVVAPNGRVWSEANIGNALAGRELSRHLRELGEKTRGPAPLTRQDRSRFLGALDTAVQAALRQAAAS

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
52 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
54 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
56 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
83 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
84 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
85 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
86 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
87 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
88 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
89 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
90 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
91 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
92 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
93 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
96 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
97 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
98 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
99 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
100 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
101 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
102 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
108 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
112 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
113 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
114 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
117 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
118 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
119 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
122 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
125 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
126 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
127 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
128 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
129 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
130 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
131 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
132 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
133 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
136 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
137 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
138 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
139 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
140 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
151 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
157 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
158 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
159 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
160 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
161 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
162 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
163 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
164 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
165 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
166 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
167 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
168 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
169 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.96
Metatranscriptomes 0.35
Isolates 0.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.15
Nodule 0
Rhizoplane 0.35
Rhizosphere 91
Stem 0
Stem Tuber 0
Unclassified 7.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0224223 3300044694 Bacteria 1317
2 rootH1_10127027 3300003323 Bacteria 1188
3 Ga0055529_1026782 3300003763 Bacteria 711
4 Ga0070658_10041944 3300005327 Bacteria 3692
5 Ga0070658_10597414 3300005327 Bacteria 956
6 Ga0070683_101176398 3300005329 Unclassified 737
7 Ga0070680_100041168 3300005336 Bacteria 3745
8 Ga0070680_100116052 3300005336 Bacteria 2231
9 Ga0070680_100908305 3300005336 Bacteria 760
10 Ga0070661_100211492 3300005344 Bacteria 1485
11 Ga0070668_101425043 3300005347 Bacteria 632
12 Ga0070659_100287806 3300005366 Bacteria 1368
13 Ga0070667_100035365 3300005367 Bacteria 4184
14 Ga0070713_100892021 3300005436 Bacteria 855
15 Ga0070713_101513233 3300005436 Bacteria 651
16 Ga0070678_100512371 3300005456 Bacteria 1060
17 Ga0070681_10169210 3300005458 Bacteria 2107
18 Ga0070681_10402187 3300005458 Bacteria 1281
19 Ga0068867_100004061 3300005459 Bacteria 10304
20 Ga0070707_100098611 3300005468 Bacteria 2830
21 Ga0070707_100732208 3300005468 Bacteria 952
22 Ga0070698_100125389 3300005471 Bacteria 2525
23 Ga0070699_100066186 3300005518 Bacteria 3136
24 Ga0070679_100092286 3300005530 Bacteria 3016
25 Ga0070679_100126523 3300005530 Bacteria 2538
26 Ga0070679_100134247 3300005530 Bacteria 2456
27 Ga0070679_100590682 3300005530 Bacteria 1054
28 Ga0070684_100935592 3300005535 Unclassified 812
29 Ga0070697_100218263 3300005536 Bacteria 1625
30 Ga0070697_100709702 3300005536 Bacteria 887
31 Ga0068853_100970443 3300005539 Bacteria 818
32 Ga0070665_100054837 3300005548 Bacteria 3997
33 Ga0070665_100354482 3300005548 Bacteria 1473
34 Ga0068855_100018848 3300005563 Bacteria 8295
35 Ga0068855_100590925 3300005563 Archaea 1198
36 Ga0068855_100722835 3300005563 Bacteria 1064
37 Ga0070664_100954337 3300005564 Bacteria 805
38 Ga0068864_100330102 3300005618 Bacteria 1435
39 Ga0068866_10081421 3300005718 Bacteria 1739
40 Ga0068858_100039962 3300005842 Bacteria 4350
41 Ga0068858_100318792 3300005842 Bacteria 1485
42 Ga0097621_100007594 3300006237 Bacteria 7768
43 Ga0097621_100660547 3300006237 Bacteria 960
44 Ga0068871_100005443 3300006358 Bacteria 8928
45 Ga0068871_100189293 3300006358 Bacteria 1772
46 Ga0075433_10868558 3300006852 Bacteria 787
47 Ga0068865_100003297 3300006881 Bacteria 9666
48 Ga0068865_100201004 3300006881 Bacteria 1547
49 Ga0068865_100483286 3300006881 Bacteria 1030
50 Ga0099795_10001428 3300007788 Bacteria 5174
51 Ga0105240_10118365 3300009093 Bacteria 3192
52 Ga0105240_10157510 3300009093 Bacteria 2700
53 Ga0105240_10228389 3300009093 Bacteria 2164
54 Ga0105240_10336820 3300009093 Bacteria 1715
55 Ga0105240_10562512 3300009093 Bacteria 1260
56 Ga0105240_10945125 3300009093 Bacteria 925
57 Ga0105241_10345812 3300009174 Bacteria 1290
58 Ga0105242_10008748 3300009176 Bacteria 7768
59 Ga0105248_10471822 3300009177 Bacteria 1414
60 Ga0105248_10690445 3300009177 Bacteria 1151
61 Ga0105237_10093805 3300009545 Bacteria 2991
62 Ga0105237_10356732 3300009545 Bacteria 1466
63 Ga0105237_10365442 3300009545 Bacteria 1447
64 Ga0105237_10570313 3300009545 Bacteria 1139
65 Ga0105237_11097028 3300009545 Bacteria 803
66 Ga0105238_10021638 3300009551 Bacteria 6550
67 Ga0105238_10114191 3300009551 Bacteria 2680
68 Ga0105238_10115199 3300009551 Bacteria 2667
69 Ga0105238_10135136 3300009551 Bacteria 2444
70 Ga0105249_11108893 3300009553 Bacteria 861
71 Ga0099796_10006327 3300010159 Bacteria 3022
72 Ga0105239_10234969 3300010375 Bacteria 2057
73 Ga0105239_10364797 3300010375 Bacteria 1632
74 Ga0105239_10393364 3300010375 Bacteria 1568
75 Ga0105239_10610382 3300010375 Bacteria 1245
76 Ga0105239_11139499 3300010375 Bacteria 898
77 Ga0157369_10197143 3300013105 Bacteria 2114
78 Ga0157369_11791240 3300013105 Bacteria 624
79 Ga0157374_10063725 3300013296 Bacteria 3457
80 Ga0157374_10066634 3300013296 Bacteria 3384
81 Ga0157372_11653627 3300013307 Bacteria 737
82 Ga0157375_10069442 3300013308 Bacteria 3529
83 Ga0163163_11794804 3300014325 Unclassified 674
84 Ga0157379_10136742 3300014968 Bacteria 2208
85 Ga0157379_10172063 3300014968 Bacteria 1955
86 Ga0157376_10068347 3300014969 Bacteria 3009
87 Ga0157376_10439691 3300014969 Bacteria 1270
88 Ga0157376_10500214 3300014969 Bacteria 1194
89 Ga0163161_10019379 3300017792 Bacteria 4773
90 Ga0213876_10016748 3300021384 Bacteria 3872
91 Ga0213875_10000189 3300021388 Bacteria 63108
92 Ga0224712_10097721 3300022467 Bacteria 1240
93 Ga0228598_1011231 3300024227 Bacteria 1783
94 Ga0209455_1011940 3300025272 Bacteria 2107
95 Ga0209758_1000032 3300025297 Bacteria 481623
96 Ga0207642_10011336 3300025899 Bacteria 3176
97 Ga0207647_10050782 3300025904 Bacteria 2566
98 Ga0207645_10208279 3300025907 Bacteria 1288
99 Ga0207705_10236090 3300025909 Bacteria 1392
100 Ga0207705_10417791 3300025909 Bacteria 1038
101 Ga0207654_10151543 3300025911 Bacteria 1489
102 Ga0207654_10257100 3300025911 Bacteria 1173
103 Ga0207707_10003386 3300025912 Bacteria 14153
104 Ga0207707_10182818 3300025912 Bacteria 1830
105 Ga0207695_10033092 3300025913 Bacteria 5647
106 Ga0207695_10057675 3300025913 Bacteria 4033
107 Ga0207695_10262543 3300025913 Bacteria 1624
108 Ga0207695_10425200 3300025913 Bacteria 1212
109 Ga0207695_11176817 3300025913 Unclassified 647
110 Ga0207695_11428133 3300025913 Bacteria 572
111 Ga0207671_10021843 3300025914 Bacteria 4849
112 Ga0207671_10377279 3300025914 Bacteria 1126
113 Ga0207671_10938987 3300025914 Bacteria 683
114 Ga0207660_10064063 3300025917 Bacteria 2652
115 Ga0207660_10128533 3300025917 Bacteria 1926
116 Ga0207657_10327746 3300025919 Bacteria 1210
117 Ga0207652_10036716 3300025921 Bacteria 4143
118 Ga0207652_10149941 3300025921 Unclassified 2088
119 Ga0207652_10165050 3300025921 Bacteria 1985
120 Ga0207652_10235284 3300025921 Bacteria 1651
121 Ga0207646_10189179 3300025922 Unclassified 1859
122 Ga0207694_10028836 3300025924 Bacteria 4233
123 Ga0207694_10046665 3300025924 Bacteria 3348
124 Ga0207694_10232007 3300025924 Bacteria 1507
125 Ga0207700_10414546 3300025928 Bacteria 1182
126 Ga0207700_10988526 3300025928 Bacteria 753
127 Ga0207700_11820427 3300025928 Unclassified 535
128 Ga0207644_10281131 3300025931 Bacteria 1336
129 Ga0207706_10192633 3300025933 Bacteria 1789
130 Ga0207686_10470896 3300025934 Bacteria 970
131 Ga0207704_10172536 3300025938 Bacteria 1553
132 Ga0207704_10179934 3300025938 Bacteria 1527
133 Ga0207704_10240778 3300025938 Bacteria 1352
134 Ga0207711_11639278 3300025941 Bacteria 587
135 Ga0207661_10973780 3300025944 Unclassified 781
136 Ga0207667_10003421 3300025949 Bacteria 19596
137 Ga0207667_10490388 3300025949 Archaea 1247
138 Ga0207668_10609543 3300025972 Bacteria 952
139 Ga0207668_10670827 3300025972 Bacteria 909
140 Ga0207640_10511100 3300025981 Bacteria 1002
141 Ga0207703_10032122 3300026035 Bacteria 4155
142 Ga0207703_10273662 3300026035 Bacteria 1531
143 Ga0207683_10747802 3300026121 Bacteria 907
144 Ga0268266_10184727 3300028379 Bacteria 1900
145 Ga0268266_10587650 3300028379 Bacteria 1069
146 Ga0265337_1066094 3300028556 Unclassified 997
147 Ga0265318_10090284 3300028577 Bacteria 1128
148 Ga0265338_10057557 3300028800 Bacteria 3438
149 Ga0265332_10032934 3300031238 Bacteria 2257
150 Ga0265320_10003861 3300031240 Bacteria 9927
151 Ga0265325_10147605 3300031241 Bacteria 1114
152 Ga0265339_10129995 3300031249 Unclassified 1289
153 Ga0265339_10158576 3300031249 Bacteria 1140
154 Ga0265331_10026027 3300031250 Bacteria 2947
155 Ga0265331_10034630 3300031250 Bacteria 2490
156 Ga0265316_10031849 3300031344 Bacteria 4309
157 Ga0265316_10227396 3300031344 Bacteria 1375
158 Ga0265316_10581844 3300031344 Bacteria 795
159 Ga0265316_10883076 3300031344 Bacteria 625
160 Ga0265313_10004940 3300031595 Bacteria 9985
161 Ga0265314_10007783 3300031711 Bacteria 9259
162 Ga0265314_10077627 3300031711 Bacteria 2202
163 Ga0265314_10136774 3300031711 Bacteria 1520
164 Ga0265314_10459345 3300031711 Bacteria 677
165 Ga0265342_10217661 3300031712 Bacteria 1030
166 Ga0307416_101008221 3300032002 Bacteria 936
167 Ga0373923_0216750 3300035111 Bacteria 889
168 Ga0373936_0135187 3300035113 Unclassified 1062
169 Ga0373954_0085956 3300035118 Bacteria 1506
170 Ga0373957_0121594 3300035120 Bacteria 1057
171 Ga0373955_0437084 3300035172 Unclassified 797
172 Ga0373927_0200816 3300035695 Bacteria 1309
173 Ga0373927_0314126 3300035695 Unclassified 1032
174 Ga0373933_0004352 3300035724 Bacteria 7776
175 Ga0373947_0194502 3300035725 Bacteria 1325
176 Ga0373947_0804012 3300035725 Unclassified 642
177 Ga0373937_0007696 3300036401 Bacteria 9339
178 Ga0373937_0414555 3300036401 Unclassified 1278
179 Ga0373937_0441195 3300036401 Unclassified 1236
180 Ga0373937_0611465 3300036401 Bacteria 1034
181 Ga0373937_0825408 3300036401 Bacteria 875
182 Ga0373937_1169237 3300036401 Bacteria 718
183 Ga0395899_0009754 3300037312 Bacteria 7368
184 Ga0395899_0335800 3300037312 Unclassified 1014
185 Ga0395900_0164372 3300037418 Bacteria 2262
186 Ga0395900_0338824 3300037418 Bacteria 1480
187 Ga0395898_0110444 3300037466 Bacteria 2635
188 Ga0395905_1627223 3300037471 Bacteria 551
189 Ga0436364_0583567 3300037853 Bacteria 704
190 Ga0436364_0852223 3300037853 Bacteria 5072
191 Ga0436364_1480641 3300037853 Bacteria 33054
192 Ga0395901_0037257 3300038443 Bacteria 5030
193 Ga0395901_0681053 3300038443 Bacteria 1028
194 Ga0436365_0318321 3300039437 Bacteria 1348
195 Ga0436365_1066783 3300039437 Bacteria 7641
196 Ga0436360_0148830 3300039438 Bacteria 1068
197 Ga0436360_0285033 3300039438 Bacteria 2403
198 Ga0436360_0772674 3300039438 Bacteria 1777
199 Ga0436360_0794891 3300039438 Bacteria 1702
200 Ga0436363_0864183 3300039450 Bacteria 1014
201 Ga0436362_0231581 3300039453 Bacteria 9446
202 Ga0453684_1775291 3300044712 Bacteria 628
203 Ga0466967_0466727 3300045976 Bacteria 1235
204 Ga0466967_0500968 3300045976 Bacteria 1192
205 Ga0466967_1645653 3300045976 Bacteria 639
206 Ga0495592_0090922 3300046454 Bacteria 2189
207 Ga0495651_0473140 3300046462 Bacteria 806
208 Ga0495653_0528014 3300046463 Bacteria 733
209 Ga0495650_0063350 3300046471 Bacteria 1475
210 Ga0495650_0180356 3300046471 Unclassified 743
211 Ga0495580_0792387 3300046472 Unclassified 615
212 Ga0495662_0342894 3300046476 Bacteria 734
213 Ga0495618_0185813 3300046514 Bacteria 1319
214 Ga0495628_0806074 3300046516 Unclassified 657
215 Ga0495640_0082358 3300046533 Bacteria 2137
216 Ga0495587_0099516 3300046536 Bacteria 1676
217 Ga0495587_0494974 3300046536 Bacteria 676
218 Ga0495609_0067270 3300046538 Bacteria 1578
219 Ga0495621_0154009 3300046539 Bacteria 906
220 Ga0495667_0309007 3300046559 Bacteria 1001
221 Ga0495625_0349466 3300046660 Bacteria 935
222 Ga0495635_0033094 3300046663 Bacteria 3586
223 Ga0495599_0080296 3300046678 Bacteria 2037
224 Ga0495623_0226167 3300046679 Bacteria 1064
225 Ga0495604_0292230 3300047317 Bacteria 1097
226 Ga0495674_0112997 3300047319 Bacteria 2301
227 Ga0495680_0043281 3300047322 Bacteria 3567
228 Ga0495680_0072738 3300047322 Bacteria 2615
229 Ga0495602_0070109 3300048088 Bacteria 3002
230 Ga0495602_0306215 3300048088 Bacteria 1161
231 Ga0496115_0853980 3300048918 Unclassified 705
232 Ga0496121_0121660 3300048924 Bacteria 1970
233 Ga0496126_0835865 3300048929 Bacteria 703
234 Ga0501031_0351461 3300049568 Bacteria 954
235 Ga0501033_0058683 3300049570 Bacteria 2842
236 Ga0501033_0270864 3300049570 Bacteria 1200
237 Ga0501034_0034781 3300049571 Bacteria 5109
238 Ga0501034_0325823 3300049571 Bacteria 1468
239 Ga0501034_0573176 3300049571 Bacteria 1036
240 Ga0501034_1014974 3300049571 Bacteria 713
241 Ga0501036_0129021 3300049572 Bacteria 2135
242 Ga0501036_0130067 3300049572 Bacteria 2126
243 Ga0501037_0100950 3300049573 Bacteria 2083
244 Ga0501037_0146903 3300049573 Bacteria 1686
245 Ga0501038_0306062 3300049574 Bacteria 1246
246 Ga0501043_0069597 3300049579 Bacteria 2764
247 Ga0501043_0692965 3300049579 Bacteria 745
248 Ga0501046_0072103 3300049580 Bacteria 2682
249 Ga0501046_0124724 3300049580 Bacteria 1957
250 Ga0501047_0150821 3300049581 Bacteria 2201
251 Ga0501047_0166506 3300049581 Bacteria 2074
252 Ga0501047_0188162 3300049581 Bacteria 1929
253 Ga0501047_0218106 3300049581 Bacteria 1764
254 Ga0501047_1072004 3300049581 Bacteria 619
255 Ga0501048_0163443 3300049582 Bacteria 1576
256 Ga0501072_0190944 3300049588 Bacteria 1634
257 Ga0501073_0441315 3300049589 Bacteria 900
258 Ga0501080_0549242 3300049742 Bacteria 1029
259 Ga0501080_1239208 3300049742 Unclassified 640
260 Ga0501083_0139136 3300049744 Bacteria 1590
261 Ga0501083_0267340 3300049744 Bacteria 1112
262 Ga0501083_0657165 3300049744 Bacteria 682
263 Ga0501035_0070097 3300049822 Bacteria 3106
264 Ga0501035_0309652 3300049822 Bacteria 1329
265 Ga0501035_0977986 3300049822 Bacteria 666
266 Ga0501044_0120877 3300049823 Bacteria 2620
267 Ga0501044_0137711 3300049823 Bacteria 2431
268 Ga0501044_0216862 3300049823 Bacteria 1865
269 Ga0501044_0248705 3300049823 Bacteria 1720
270 Ga0501044_0435577 3300049823 Bacteria 1219
271 Ga0501044_0477976 3300049823 Bacteria 1149
272 Ga0501044_0583767 3300049823 Bacteria 1012
273 Ga0495601_0023324 3300053077 Bacteria 3802
274 Ga0495595_0037298 3300053084 Bacteria 2209
275 Ga0495619_0037065 3300053085 Bacteria 3176
276 Ga0495619_0616773 3300053085 Bacteria 741
277 Ga0500643_000008 3300053087 Bacteria 457931
278 Ga0500646_0099141 3300053090 Bacteria 912
279 Ga0500595_007009 3300053119 Bacteria 4721
280 Ga0500595_030599 3300053119 Bacteria 1812
281 Ga0500642_0001910 3300053130 Bacteria 6028
282 Ga0500568_0036191 3300053139 Bacteria 2010
283 Ga0500568_0159466 3300053139 Unclassified 833
284 Ga0500573_0000051 3300053140 Bacteria 95469
285 Ga0500627_0011978 3300053158 Bacteria 3229
286 Ga0501084_0195236 3300054114 Bacteria 1708
287 Ga0501082_0257952 3300060353 Bacteria 1516
288 2929200791 2929199973 Bacteria 7260745
289 8055914007 8055909800 Bacteria 7278581
290 Ga0466963_0224223
291 rootH1_10127027
292 Ga0055529_1026782
293 Ga0070658_10041944
294 Ga0070658_10597414
295 Ga0070683_101176398
296 Ga0070680_100041168
297 Ga0070680_100116052
298 Ga0070680_100908305
299 Ga0070661_100211492
300 Ga0070668_101425043
301 Ga0070659_100287806
302 Ga0070667_100035365
303 Ga0070713_100892021
304 Ga0070713_101513233
305 Ga0070678_100512371
306 Ga0070681_10169210
307 Ga0070681_10402187
308 Ga0068867_100004061
309 Ga0070707_100098611
310 Ga0070707_100732208
311 Ga0070698_100125389
312 Ga0070699_100066186
313 Ga0070679_100092286
314 Ga0070679_100126523
315 Ga0070679_100134247
316 Ga0070679_100590682
317 Ga0070684_100935592
318 Ga0070697_100218263
319 Ga0070697_100709702
320 Ga0068853_100970443
321 Ga0070665_100054837
322 Ga0070665_100354482
323 Ga0068855_100018848
324 Ga0068855_100590925
325 Ga0068855_100722835
326 Ga0070664_100954337
327 Ga0068864_100330102
328 Ga0068866_10081421
329 Ga0068858_100039962
330 Ga0068858_100318792
331 Ga0097621_100007594
332 Ga0097621_100660547
333 Ga0068871_100005443
334 Ga0068871_100189293
335 Ga0075433_10868558
336 Ga0068865_100003297
337 Ga0068865_100201004
338 Ga0068865_100483286
339 Ga0099795_10001428
340 Ga0105240_10118365
341 Ga0105240_10157510
342 Ga0105240_10228389
343 Ga0105240_10336820
344 Ga0105240_10562512
345 Ga0105240_10945125
346 Ga0105241_10345812
347 Ga0105242_10008748
348 Ga0105248_10471822
349 Ga0105248_10690445
350 Ga0105237_10093805
351 Ga0105237_10356732
352 Ga0105237_10365442
353 Ga0105237_10570313
354 Ga0105237_11097028
355 Ga0105238_10021638
356 Ga0105238_10114191
357 Ga0105238_10115199
358 Ga0105238_10135136
359 Ga0105249_11108893
360 Ga0099796_10006327
361 Ga0105239_10234969
362 Ga0105239_10364797
363 Ga0105239_10393364
364 Ga0105239_10610382
365 Ga0105239_11139499
366 Ga0157369_10197143
367 Ga0157369_11791240
368 Ga0157374_10063725
369 Ga0157374_10066634
370 Ga0157372_11653627
371 Ga0157375_10069442
372 Ga0163163_11794804
373 Ga0157379_10136742
374 Ga0157379_10172063
375 Ga0157376_10068347
376 Ga0157376_10439691
377 Ga0157376_10500214
378 Ga0163161_10019379
379 Ga0213876_10016748
380 Ga0213875_10000189
381 Ga0224712_10097721
382 Ga0228598_1011231
383 Ga0209455_1011940
384 Ga0209758_1000032
385 Ga0207642_10011336
386 Ga0207647_10050782
387 Ga0207645_10208279
388 Ga0207705_10236090
389 Ga0207705_10417791
390 Ga0207654_10151543
391 Ga0207654_10257100
392 Ga0207707_10003386
393 Ga0207707_10182818
394 Ga0207695_10033092
395 Ga0207695_10057675
396 Ga0207695_10262543
397 Ga0207695_10425200
398 Ga0207695_11176817
399 Ga0207695_11428133
400 Ga0207671_10021843
401 Ga0207671_10377279
402 Ga0207671_10938987
403 Ga0207660_10064063
404 Ga0207660_10128533
405 Ga0207657_10327746
406 Ga0207652_10036716
407 Ga0207652_10149941
408 Ga0207652_10165050
409 Ga0207652_10235284
410 Ga0207646_10189179
411 Ga0207694_10028836
412 Ga0207694_10046665
413 Ga0207694_10232007
414 Ga0207700_10414546
415 Ga0207700_10988526
416 Ga0207700_11820427
417 Ga0207644_10281131
418 Ga0207706_10192633
419 Ga0207686_10470896
420 Ga0207704_10172536
421 Ga0207704_10179934
422 Ga0207704_10240778
423 Ga0207711_11639278
424 Ga0207661_10973780
425 Ga0207667_10003421
426 Ga0207667_10490388
427 Ga0207668_10609543
428 Ga0207668_10670827
429 Ga0207640_10511100
430 Ga0207703_10032122
431 Ga0207703_10273662
432 Ga0207683_10747802
433 Ga0268266_10184727
434 Ga0268266_10587650
435 Ga0265337_1066094
436 Ga0265318_10090284
437 Ga0265338_10057557
438 Ga0265332_10032934
439 Ga0265320_10003861
440 Ga0265325_10147605
441 Ga0265339_10129995
442 Ga0265339_10158576
443 Ga0265331_10026027
444 Ga0265331_10034630
445 Ga0265316_10031849
446 Ga0265316_10227396
447 Ga0265316_10581844
448 Ga0265316_10883076
449 Ga0265313_10004940
450 Ga0265314_10007783
451 Ga0265314_10077627
452 Ga0265314_10136774
453 Ga0265314_10459345
454 Ga0265342_10217661
455 Ga0307416_101008221
456 Ga0373923_0216750
457 Ga0373936_0135187
458 Ga0373954_0085956
459 Ga0373957_0121594
460 Ga0373955_0437084
461 Ga0373927_0200816
462 Ga0373927_0314126
463 Ga0373933_0004352
464 Ga0373947_0194502
465 Ga0373947_0804012
466 Ga0373937_0007696
467 Ga0373937_0414555
468 Ga0373937_0441195
469 Ga0373937_0611465
470 Ga0373937_0825408
471 Ga0373937_1169237
472 Ga0395899_0009754
473 Ga0395899_0335800
474 Ga0395900_0164372
475 Ga0395900_0338824
476 Ga0395898_0110444
477 Ga0395905_1627223
478 Ga0436364_0583567
479 Ga0436364_0852223
480 Ga0436364_1480641
481 Ga0395901_0037257
482 Ga0395901_0681053
483 Ga0436365_0318321
484 Ga0436365_1066783
485 Ga0436360_0148830
486 Ga0436360_0285033
487 Ga0436360_0772674
488 Ga0436360_0794891
489 Ga0436363_0864183
490 Ga0436362_0231581
491 Ga0453684_1775291
492 Ga0466967_0466727
493 Ga0466967_0500968
494 Ga0466967_1645653
495 Ga0495592_0090922
496 Ga0495651_0473140
497 Ga0495653_0528014
498 Ga0495650_0063350
499 Ga0495650_0180356
500 Ga0495580_0792387
501 Ga0495662_0342894
502 Ga0495618_0185813
503 Ga0495628_0806074
504 Ga0495640_0082358
505 Ga0495587_0099516
506 Ga0495587_0494974
507 Ga0495609_0067270
508 Ga0495621_0154009
509 Ga0495667_0309007
510 Ga0495625_0349466
511 Ga0495635_0033094
512 Ga0495599_0080296
513 Ga0495623_0226167
514 Ga0495604_0292230
515 Ga0495674_0112997
516 Ga0495680_0043281
517 Ga0495680_0072738
518 Ga0495602_0070109
519 Ga0495602_0306215
520 Ga0496115_0853980
521 Ga0496121_0121660
522 Ga0496126_0835865
523 Ga0501031_0351461
524 Ga0501033_0058683
525 Ga0501033_0270864
526 Ga0501034_0034781
527 Ga0501034_0325823
528 Ga0501034_0573176
529 Ga0501034_1014974
530 Ga0501036_0129021
531 Ga0501036_0130067
532 Ga0501037_0100950
533 Ga0501037_0146903
534 Ga0501038_0306062
535 Ga0501043_0069597
536 Ga0501043_0692965
537 Ga0501046_0072103
538 Ga0501046_0124724
539 Ga0501047_0150821
540 Ga0501047_0166506
541 Ga0501047_0188162
542 Ga0501047_0218106
543 Ga0501047_1072004
544 Ga0501048_0163443
545 Ga0501072_0190944
546 Ga0501073_0441315
547 Ga0501080_0549242
548 Ga0501080_1239208
549 Ga0501083_0139136
550 Ga0501083_0267340
551 Ga0501083_0657165
552 Ga0501035_0070097
553 Ga0501035_0309652
554 Ga0501035_0977986
555 Ga0501044_0120877
556 Ga0501044_0137711
557 Ga0501044_0216862
558 Ga0501044_0248705
559 Ga0501044_0435577
560 Ga0501044_0477976
561 Ga0501044_0583767
562 Ga0495601_0023324
563 Ga0495595_0037298
564 Ga0495619_0037065
565 Ga0495619_0616773
566 Ga0500643_000008
567 Ga0500646_0099141
568 Ga0500595_007009
569 Ga0500595_030599
570 Ga0500642_0001910
571 Ga0500568_0036191
572 Ga0500568_0159466
573 Ga0500573_0000051
574 Ga0500627_0011978
575 Ga0501084_0195236
576 Ga0501082_0257952
577 2929200791
578 8055914007

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02639

DUF188

Uncharacterized BCR, YaiI/YqxD family COG1671

34

165

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gk4-assembly1.cif.gz_A the crystal structure of the dna/pantothenate metabolism flavoprotein from streptococcus pneumoniae 0.7025 1 71
4fd3-assembly1.cif.gz_A crystal structure of apo-formed ymtoar1 0.6808 1 34
5l4l-assembly1.cif.gz_A polyketide ketoreductase simc7 - ternary complex with nadp+ and 7-oxo-sd8 0.6408 3 90
2dwc-assembly1.cif.gz_A crystal structure of probable phosphoribosylglycinamide formyl transferase from pyrococcus horikoshii ot3 complexed with adp 0.6343 2 89
2dwc-assembly1.cif.gz_B crystal structure of probable phosphoribosylglycinamide formyl transferase from pyrococcus horikoshii ot3 complexed with adp 0.6296 2 88
ID Description Score Start End Superfamily
af_P0A8D3_17_146_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9548 17 144 3.40.50.1010
af_P0A8D3_17_146_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9337 17 144 3.40.50.1010
af_Q2G0B6_16_147_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.923 17 144 3.40.50.1010
af_Q2G0B6_16_147_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8901 17 144 3.40.50.1010
3qvrA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.7442 3 48 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A7Z9K412-F1-model_v4 YaiI/YqxD family protein 0.9924 1 101
AF-A0A4Q3YRC8-F1-model_v4 YaiI/YqxD family protein 0.9883 2 103
AF-A0A3N5UPU7-F1-model_v4 YaiI/YqxD family protein 0.9837 1 97
AF-A0A833LGF9-F1-model_v4 YaiI/YqxD family protein 0.9814 3 103
AF-A0A850KI89-F1-model_v4 DUF188 domain-containing protein 0.9799 1 109

Map