F389253

General Info

Members Datasets Scaffolds Average Seq Length
289 235 286 144

Family's Representative Sequence

Representative Sequence 3300026142|Ga0207698_10147271|Ga0207698_101472712
Length 143
Sequence MTDIEIARPPLPPFTRETALAKVRAAEDAWNSRDPARVALAYTIDSEWRNRDQFFTGRDRLIKDLWAFTDNRIAVRFQYECWSAGQWYRCYGNEQWEFAANGLMRRREASINDVMIGEADRRFLWPAPGARPEGHAGLTGVNG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
3 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
9 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
51 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
52 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
53 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
61 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
76 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
78 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
79 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
80 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
81 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
82 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
83 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
84 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
85 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
86 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
126 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
127 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
128 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
134 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
135 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
138 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
141 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
142 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
143 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
144 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
145 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
146 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
147 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
148 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
149 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
150 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
151 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
152 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
153 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
154 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
157 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
158 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
159 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
160 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
161 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
162 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
165 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
166 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
167 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
168 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
169 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
170 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
171 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
172 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
173 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
174 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
175 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
176 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
177 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
178 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
179 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
180 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
181 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
182 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
183 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
186 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
187 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
188 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
189 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
192 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
193 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
194 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
195 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
196 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
197 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
198 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
207 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
208 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
209 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
210 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
211 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
212 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
213 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
214 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
215 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
220 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
221 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
222 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
223 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
224 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
225 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
226 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
227 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
228 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
229 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
230 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
231 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
232 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
233 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
234 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
235 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.96
Metatranscriptomes 0
Isolates 1.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.49
Nodule 2.42
Rhizoplane 3.81
Rhizosphere 71.63
Stem 0
Stem Tuber 0
Unclassified 8.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2372410 2162886007 Bacteria 912
2 JGI24737J22298_10015627 3300001990 Bacteria 2456
3 JGI24735J21928_10000048 3300002067 Bacteria 51228
4 JGI25156J39149_1000177 3300002705 Bacteria 46709
5 JGI25162J39368_1000220 3300002737 Bacteria 59297
6 JGI25164J39214_1000850 3300002772 Bacteria 10487
7 JGI25152J39213_1000378 3300002773 Bacteria 27329
8 JGI25150J39212_1000014 3300002774 Bacteria 170955
9 JGI25151J46595_10000042 3300003187 Bacteria 170955
10 JGI25165J46597_1000324 3300003214 Bacteria 57596
11 JGI25165J46597_1000942 3300003214 Bacteria 19937
12 JGI25153J46596_10000009 3300003215 Bacteria 340925
13 rootH1_10002470 3300003316 Bacteria 26710
14 rootL2_10010069 3300003322 Bacteria 20060
15 rootH1_10088094 3300003323 Bacteria 3827
16 Ga0065714_10005749 3300005288 Bacteria 4150
17 Ga0065714_10017573 3300005288 Bacteria 1320
18 Ga0070658_10040131 3300005327 Bacteria 3776
19 Ga0070677_10002593 3300005333 Bacteria 5789
20 Ga0068868_100006548 3300005338 Bacteria 8248
21 Ga0068868_100053626 3300005338 Bacteria 3177
22 Ga0070671_100026365 3300005355 Bacteria 4775
23 Ga0070667_100561752 3300005367 Bacteria 1049
24 Ga0070709_10015325 3300005434 Bacteria 4360
25 Ga0070714_101060955 3300005435 Bacteria 789
26 Ga0070711_100339872 3300005439 Bacteria 1204
27 Ga0070700_100012447 3300005441 Bacteria 4750
28 Ga0070694_100190452 3300005444 Bacteria 1523
29 Ga0070695_100004069 3300005545 Bacteria 8557
30 Ga0070695_100239117 3300005545 Bacteria 1316
31 Ga0070696_100729189 3300005546 Bacteria 810
32 Ga0070665_102486367 3300005548 Unclassified 519
33 Ga0068855_100004987 3300005563 Bacteria 16203
34 Ga0068855_100726891 3300005563 Bacteria 1060
35 Ga0068857_100110371 3300005577 Bacteria 2472
36 Ga0068856_100127935 3300005614 Bacteria 2544
37 Ga0068856_100208115 3300005614 Bacteria 1971
38 Ga0068856_102021572 3300005614 Bacteria 586
39 Ga0068852_100161488 3300005616 Bacteria 2093
40 Ga0068859_100039861 3300005617 Bacteria 4714
41 Ga0068859_100048025 3300005617 Bacteria 4288
42 Ga0068866_10135345 3300005718 Bacteria 1407
43 Ga0068860_100687319 3300005843 Bacteria 1032
44 Ga0081455_10095326 3300005937 Bacteria 2402
45 Ga0075365_10046567 3300006038 Bacteria 2849
46 Ga0075363_100001892 3300006048 Bacteria 8273
47 Ga0075363_100010033 3300006048 Bacteria 4476
48 Ga0075364_10006202 3300006051 Bacteria 7010
49 Ga0070712_100001011 3300006175 Bacteria 16932
50 Ga0075367_10227794 3300006178 Bacteria 1167
51 Ga0075369_10000904 3300006186 Bacteria 9826
52 Ga0075369_10037235 3300006186 Bacteria 2072
53 Ga0075366_10011521 3300006195 Bacteria 4993
54 Ga0097621_100055161 3300006237 Bacteria 3244
55 Ga0097621_101294812 3300006237 Bacteria 688
56 Ga0068865_100128839 3300006881 Bacteria 1893
57 Ga0075436_100209766 3300006914 Bacteria 1380
58 Ga0097620_100039860 3300006931 Bacteria 4714
59 Ga0097620_100048027 3300006931 Bacteria 4288
60 Ga0099824_1003113 3300006942 Bacteria 24226
61 Ga0099826_10024550 3300006948 Bacteria 4476
62 Ga0105244_10000108 3300009036 Bacteria 86321
63 Ga0105250_10012083 3300009092 Bacteria 3575
64 Ga0105240_10002512 3300009093 Bacteria 29474
65 Ga0105240_10069889 3300009093 Bacteria 4345
66 Ga0111539_10280241 3300009094 Bacteria 1940
67 Ga0105247_10166047 3300009101 Bacteria 1465
68 Ga0105243_10000007 3300009148 Bacteria 445042
69 Ga0105241_10013265 3300009174 Bacteria 6041
70 Ga0105241_10035848 3300009174 Bacteria 3731
71 Ga0105237_10881908 3300009545 Bacteria 901
72 Ga0123340_1029900 3300009763 Bacteria 3377
73 Ga0123342_1022538 3300009766 Bacteria 4247
74 Ga0105239_10022967 3300010375 Bacteria 6877
75 Ga0105239_10855860 3300010375 Bacteria 1043
76 Ga0157373_10003329 3300013100 Bacteria 12140
77 Ga0157371_10389762 3300013102 Bacteria 1018
78 Ga0157371_10402356 3300013102 Bacteria 1002
79 Ga0157370_10000505 3300013104 Bacteria 48631
80 Ga0157370_10487943 3300013104 Bacteria 1132
81 Ga0157370_10735775 3300013104 Bacteria 899
82 Ga0157369_10108483 3300013105 Bacteria 2953
83 Ga0157369_10650587 3300013105 Bacteria 1087
84 Ga0157369_11356488 3300013105 Bacteria 724
85 Ga0157374_10012550 3300013296 Bacteria 7373
86 Ga0157372_10000120 3300013307 Bacteria 83586
87 Ga0157372_10059789 3300013307 Bacteria 4263
88 Ga0157372_10103756 3300013307 Bacteria 3249
89 Ga0157372_10318345 3300013307 Bacteria 1811
90 Ga0163163_10852020 3300014325 Bacteria 975
91 Ga0157377_10038975 3300014745 Bacteria 2627
92 Ga0157379_10001994 3300014968 Bacteria 16910
93 Ga0157379_10750016 3300014968 Bacteria 919
94 Ga0157379_11388582 3300014968 Bacteria 680
95 Ga0157376_10002077 3300014969 Bacteria 13464
96 Ga0182006_1000005 3300015261 Bacteria 621201
97 Ga0163161_10011840 3300017792 Bacteria 6050
98 Ga0163161_10244702 3300017792 Bacteria 1396
99 Ga0213872_10049096 3300021361 Bacteria 1917
100 Ga0207427_100166 3300025231 Bacteria 73732
101 Ga0209437_100288 3300025233 Bacteria 73732
102 Ga0207425_1000023 3300025245 Bacteria 341339
103 Ga0209646_1002128 3300025246 Bacteria 4600
104 Ga0209026_1049244 3300025250 Bacteria 601
105 Ga0209759_1000033 3300025256 Bacteria 276117
106 Ga0209129_1000032 3300025258 Bacteria 341150
107 Ga0209233_1000284 3300025261 Bacteria 69746
108 Ga0209025_1000047 3300025294 Bacteria 341150
109 Ga0209758_1000145 3300025297 Bacteria 170553
110 Ga0207696_1019835 3300025711 Bacteria 2178
111 Ga0207655_1000128 3300025728 Bacteria 149987
112 Ga0207642_10155863 3300025899 Bacteria 1221
113 Ga0207647_10079677 3300025904 Bacteria 1966
114 Ga0207699_10056044 3300025906 Bacteria 2347
115 Ga0207645_10001554 3300025907 Bacteria 18786
116 Ga0207705_10018389 3300025909 Bacteria 4998
117 Ga0207705_10358300 3300025909 Bacteria 1125
118 Ga0207654_10133895 3300025911 Bacteria 1572
119 Ga0207695_10032792 3300025913 Bacteria 5678
120 Ga0207695_10315449 3300025913 Bacteria 1453
121 Ga0207695_11194976 3300025913 Bacteria 641
122 Ga0207671_10033625 3300025914 Bacteria 3813
123 Ga0207693_10000749 3300025915 Bacteria 29199
124 Ga0207694_10146453 3300025924 Bacteria 1901
125 Ga0207700_10099242 3300025928 Bacteria 2318
126 Ga0207664_10664354 3300025929 Bacteria 937
127 Ga0207644_10253271 3300025931 Unclassified 1405
128 Ga0207690_10022893 3300025932 Bacteria 3892
129 Ga0207686_10090322 3300025934 Bacteria 2021
130 Ga0207709_10000049 3300025935 Bacteria 237124
131 Ga0207704_10188275 3300025938 Bacteria 1499
132 Ga0207665_10605275 3300025939 Bacteria 856
133 Ga0207711_10781055 3300025941 Bacteria 890
134 Ga0207661_10071345 3300025944 Bacteria 2838
135 Ga0207679_10592405 3300025945 Bacteria 998
136 Ga0207640_10192778 3300025981 Bacteria 1537
137 Ga0207658_10338863 3300025986 Bacteria 1306
138 Ga0207658_10379605 3300025986 Bacteria 1237
139 Ga0207677_10020873 3300026023 Bacteria 3990
140 Ga0207703_10083711 3300026035 Bacteria 2666
141 Ga0207639_10099176 3300026041 Bacteria 2350
142 Ga0207708_10191849 3300026075 Bacteria 1627
143 Ga0207702_10373783 3300026078 Bacteria 1369
144 Ga0207702_12401700 3300026078 Bacteria 514
145 Ga0207641_10092124 3300026088 Bacteria 2654
146 Ga0207648_10299341 3300026089 Bacteria 1442
147 Ga0207676_12074442 3300026095 Bacteria 567
148 Ga0207674_10047246 3300026116 Bacteria 4414
149 Ga0207675_100234975 3300026118 Bacteria 1769
150 Ga0207683_10176199 3300026121 Bacteria 1938
151 Ga0207698_10147271 3300026142 Bacteria 2038
152 Ga0209282_1181361 3300027666 Bacteria 987
153 Ga0268266_10029986 3300028379 Bacteria 4622
154 Ga0307517_10142585 3300028786 Bacteria 1676
155 Ga0307511_10000024 3300030521 Bacteria 112616
156 Ga0307511_10000948 3300030521 Bacteria 30775
157 Ga0265327_10000338 3300031251 Bacteria 88898
158 Ga0307516_10426937 3300031730 Bacteria 983
159 Ga0307407_10336432 3300031903 Bacteria 1064
160 Ga0307409_100026982 3300031995 Bacteria 4061
161 Ga0307416_100452114 3300032002 Bacteria 1337
162 Ga0307416_100454284 3300032002 Bacteria 1334
163 Ga0307414_10063529 3300032004 Bacteria 2624
164 Ga0307414_10274047 3300032004 Bacteria 1415
165 Ga0307507_10114566 3300033179 Bacteria 2185
166 Ga0373939_0498084 3300035114 Bacteria 520
167 Ga0373960_0013451 3300035121 Bacteria 2054
168 Ga0373931_0024668 3300035691 Bacteria 3049
169 Ga0373927_0239349 3300035695 Bacteria 1193
170 Ga0395899_0081960 3300037312 Bacteria 2347
171 Ga0395898_0785869 3300037466 Bacteria 892
172 Ga0400487_38073 3300039110 Bacteria 6854
173 Ga0436361_0668197 3300039447 Bacteria 4567
174 Ga0436361_0905531 3300039447 Bacteria 3179
175 Ga0439466_0000384 3300041411 Bacteria 16945
176 Ga0451833_1065971 3300041491 Bacteria 791
177 Ga0439450_018443 3300042008 Bacteria 1466
178 Ga0439463_005186 3300042016 Bacteria 3238
179 Ga0439446_0053438 3300042156 Bacteria 1210
180 Ga0439460_0007710 3300042461 Bacteria 2700
181 Ga0466972_0091951 3300044658 Bacteria 1438
182 Ga0466965_0013063 3300044683 Bacteria 3914
183 Ga0466961_0004380 3300044693 Bacteria 8843
184 Ga0466964_0124135 3300044706 Bacteria 1167
185 Ga0466970_0228960 3300044765 Bacteria 1038
186 Ga0466957_0653983 3300044842 Bacteria 739
187 Ga0466959_0070060 3300045049 Bacteria 2540
188 Ga0451576_0134945 3300045051 Bacteria 2573
189 Ga0466958_0091063 3300045836 Bacteria 1887
190 Ga0495592_0406824 3300046454 Bacteria 861
191 Ga0495603_0023035 3300046455 Bacteria 3771
192 Ga0495629_0001043 3300046459 Bacteria 22199
193 Ga0495638_0246858 3300046460 Bacteria 986
194 Ga0495653_0439120 3300046463 Bacteria 823
195 Ga0495650_0001678 3300046471 Bacteria 20459
196 Ga0495580_0008647 3300046472 Bacteria 8073
197 Ga0495582_0078867 3300046473 Bacteria 1827
198 Ga0495639_0291044 3300046475 Bacteria 813
199 Ga0495662_0240322 3300046476 Bacteria 892
200 Ga0495585_0001092 3300046492 Bacteria 22350
201 Ga0495596_0001485 3300046500 Bacteria 13408
202 Ga0495583_0214817 3300046506 Bacteria 779
203 Ga0495616_0000819 3300046513 Bacteria 22682
204 Ga0495616_0089291 3300046513 Bacteria 1462
205 Ga0495618_0645524 3300046514 Bacteria 626
206 Ga0495630_0221723 3300046517 Bacteria 1444
207 Ga0495637_0305825 3300046520 Bacteria 563
208 Ga0495642_0010411 3300046528 Bacteria 3562
209 Ga0495665_0021745 3300046531 Bacteria 3450
210 Ga0495640_0082564 3300046533 Bacteria 2134
211 Ga0495586_0024069 3300046535 Bacteria 3253
212 Ga0495645_0011181 3300046543 Bacteria 6313
213 Ga0495645_0275457 3300046543 Bacteria 1109
214 Ga0495667_0103509 3300046559 Bacteria 1841
215 Ga0495634_0265516 3300046642 Bacteria 1046
216 Ga0495625_0015975 3300046660 Bacteria 5921
217 Ga0495625_0093508 3300046660 Bacteria 2076
218 Ga0495625_0163923 3300046660 Bacteria 1487
219 Ga0495635_0266683 3300046663 Bacteria 1152
220 Ga0495588_0107415 3300046674 Bacteria 1469
221 Ga0495658_0192556 3300046683 Bacteria 1268
222 Ga0495669_0002544 3300046684 Bacteria 7443
223 Ga0495669_0120868 3300046684 Bacteria 1227
224 Ga0495613_0030666 3300046689 Bacteria 3994
225 Ga0495613_0171637 3300046689 Bacteria 1539
226 Ga0495671_0203774 3300046692 Bacteria 959
227 Ga0495589_0012945 3300046794 Bacteria 4311
228 Ga0495660_0143551 3300046810 Bacteria 1185
229 Ga0495660_0248146 3300046810 Bacteria 827
230 Ga0495581_0018105 3300047315 Bacteria 4091
231 Ga0495581_0568056 3300047315 Bacteria 658
232 Ga0495672_0035598 3300047320 Bacteria 3066
233 Ga0495676_0618518 3300047321 Bacteria 704
234 Ga0495687_001602 3300047443 Bacteria 20428
235 Ga0495677_0179029 3300047445 Bacteria 821
236 Ga0495681_0071706 3300047470 Bacteria 1568
237 Ga0495684_0220440 3300047471 Bacteria 1391
238 Ga0495686_0000004 3300047472 Bacteria 869019
239 Ga0495686_0000154 3300047472 Bacteria 131970
240 Ga0495686_0000706 3300047472 Bacteria 44979
241 Ga0495686_0011013 3300047472 Bacteria 6397
242 Ga0495614_0094449 3300048089 Bacteria 1303
243 Ga0496100_0447601 3300048903 Bacteria 990
244 Ga0496100_0660062 3300048903 Bacteria 815
245 Ga0496101_0018594 3300048904 Bacteria 4728
246 Ga0496101_0592783 3300048904 Bacteria 876
247 Ga0496102_0128423 3300048905 Bacteria 2371
248 Ga0496103_0082162 3300048906 Bacteria 2027
249 Ga0496105_0024647 3300048908 Bacteria 4889
250 Ga0496105_0568443 3300048908 Unclassified 883
251 Ga0496105_1278548 3300048908 Bacteria 537
252 Ga0496110_0090396 3300048913 Bacteria 2737
253 Ga0496114_0454626 3300048917 Bacteria 1134
254 Ga0496117_0000086 3300048920 Bacteria 212331
255 Ga0496118_0000333 3300048921 Bacteria 80356
256 Ga0496119_0000037 3300048922 Bacteria 210912
257 Ga0496122_0001440 3300048925 Bacteria 38513
258 Ga0496123_0001544 3300048926 Bacteria 31765
259 Ga0496124_0000326 3300048927 Bacteria 87989
260 Ga0496124_0130312 3300048927 Bacteria 1999
261 Ga0496124_0251781 3300048927 Bacteria 1306
262 Ga0496125_0067736 3300048928 Bacteria 2811
263 Ga0496126_0002135 3300048929 Bacteria 27578
264 Ga0495678_005124 3300049459 Bacteria 7358
265 Ga0501046_0950375 3300049580 Bacteria 598
266 Ga0501047_0006770 3300049581 Bacteria 10769
267 Ga0501241_000449 3300049758 Bacteria 8976
268 Ga0501044_1041273 3300049823 Bacteria 689
269 nmdc:mga03n38_2250_c1 3300050490 Bacteria 5901
270 nmdc:mga03n38_977152_c1 3300050490 Bacteria 501
271 nmdc:mga00v17_10482_c1 3300050491 Bacteria 5062
272 nmdc:mga0yw44_106447_c1 3300050492 Bacteria 1793
273 nmdc:mga0k408_42372_c1 3300050493 Bacteria 2622
274 nmdc:mga08y16_716884_c1 3300050511 Bacteria 999
275 nmdc:mga0sz30_729_c1 3300050516 Bacteria 12085
276 Ga0500644_0000171 3300053088 Bacteria 41443
277 Ga0500646_0011929 3300053090 Bacteria 2239
278 Ga0500583_0017532 3300053092 Bacteria 2887
279 Ga0500651_0194594 3300053093 Bacteria 1199
280 Ga0500641_0000019 3300053096 Bacteria 123198
281 Ga0500652_168857 3300053131 Bacteria 901
282 Ga0500658_0000003 3300053134 Bacteria 512506
283 Ga0500588_0081537 3300053146 Bacteria 1083
284 Ga0500588_0136409 3300053146 Bacteria 878
285 Ga0500634_0188932 3300053161 Unclassified 918
286 Ga0466962_0043994 3300061719 Bacteria 2136

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013307 Ga0157372_10318345 Ga0157372_103183452 116
2 3300044842 Ga0466957_0653983 Ga0466957_0653983_284_691 116
3 3300049580 Ga0501046_0950375 Ga0501046_0950375_76_483 116
4 3300050490 nmdc:mga03n38_977152_c1 nmdc:mga03n38_977152_c1_47_454 116
5 3300025907 Ga0207645_10001554 Ga0207645_1000155413 118
6 3300005616 Ga0068852_100161488 Ga0068852_1001614883 119
7 3300026142 Ga0207698_10147271 Ga0207698_101472712 119
8 3300046455 Ga0495603_0023035 Ga0495603_0023035_542_961 120
9 3300046459 Ga0495629_0001043 Ga0495629_0001043_8520_8939 120
10 3300046471 Ga0495650_0001678 Ga0495650_0001678_5833_6252 120
11 3300046472 Ga0495580_0008647 Ga0495580_0008647_5097_5516 120
12 3300046473 Ga0495582_0078867 Ga0495582_0078867_159_578 120
13 3300046476 Ga0495662_0240322 Ga0495662_0240322_220_639 120
14 3300046528 Ga0495642_0010411 Ga0495642_0010411_2846_3265 120
15 3300046531 Ga0495665_0021745 Ga0495665_0021745_1853_2272 120
16 3300046535 Ga0495586_0024069 Ga0495586_0024069_1327_1746 120
17 3300046543 Ga0495645_0011181 Ga0495645_0011181_2237_2656 120
18 3300046559 Ga0495667_0103509 Ga0495667_0103509_99_518 120
19 3300046663 Ga0495635_0266683 Ga0495635_0266683_130_549 120
20 3300046674 Ga0495588_0107415 Ga0495588_0107415_219_638 120
21 3300046684 Ga0495669_0120868 Ga0495669_0120868_197_616 120
22 3300046689 Ga0495613_0171637 Ga0495613_0171637_994_1413 120
23 3300046692 Ga0495671_0203774 Ga0495671_0203774_168_587 120
24 3300046794 Ga0495589_0012945 Ga0495589_0012945_284_703 120
25 3300046810 Ga0495660_0248146 Ga0495660_0248146_392_811 120
26 3300047315 Ga0495581_0018105 Ga0495581_0018105_1047_1466 120
27 3300047470 Ga0495681_0071706 Ga0495681_0071706_715_1134 120
28 3300048089 Ga0495614_0094449 Ga0495614_0094449_867_1286 120
29 3300050492 nmdc:mga0yw44_106447_c1 nmdc:mga0yw44_106447_c1_22_486 120
30 3300006048 Ga0075363_100001892 Ga0075363_1000018924 121
31 3300006186 Ga0075369_10037235 Ga0075369_100372352 121
32 3300013105 Ga0157369_11356488 Ga0157369_113564881 125
33 3300013104 Ga0157370_10735775 Ga0157370_107357751 130
34 3300035114 Ga0373939_0498084 Ga0373939_0498084_28_477 130
35 3300046684 Ga0495669_0002544 Ga0495669_0002544_4732_5181 130
36 3300047445 Ga0495677_0179029 Ga0495677_0179029_356_805 130
37 3300053093 Ga0500651_0194594 Ga0500651_0194594_282_716 131
38 iso_pu_bacteria 2513237087 2513593997 131
39 iso_pu_bacteria 2874645413 2874648894 131
40 3300015261 Ga0182006_1000005 Ga0182006_1000005218 133
41 3300048927 Ga0496124_0000326 Ga0496124_0000326_84815_85276 133
42 3300017792 Ga0163161_10011840 Ga0163161_100118407 134
43 3300025899 Ga0207642_10155863 Ga0207642_101558632 134
44 3300025931 Ga0207644_10253271 Ga0207644_102532712 134
45 3300025934 Ga0207686_10090322 Ga0207686_100903222 134
46 3300025941 Ga0207711_10781055 Ga0207711_107810552 134
47 3300025986 Ga0207658_10338863 Ga0207658_103388631 134
48 3300026088 Ga0207641_10092124 Ga0207641_100921244 134
49 3300026089 Ga0207648_10299341 Ga0207648_102993412 134
50 3300026121 Ga0207683_10176199 Ga0207683_101761993 134
51 3300037312 Ga0395899_0081960 Ga0395899_0081960_1564_2007 134
52 3300048904 Ga0496101_0018594 Ga0496101_0018594_1277_1687 134
53 3300048908 Ga0496105_0568443 Ga0496105_0568443_235_645 134
54 iso_pu_bacteria 642555113 642620664 134
55 3300002737 JGI25162J39368_1000220 JGI25162J39368_100022055 135
56 3300002772 JGI25164J39214_1000850 JGI25164J39214_100085011 135
57 3300003214 JGI25165J46597_1000324 JGI25165J46597_100032456 135
58 3300003214 JGI25165J46597_1000942 JGI25165J46597_100094214 135
59 3300005333 Ga0070677_10002593 Ga0070677_100025935 135
60 3300005338 Ga0068868_100006548 Ga0068868_1000065483 135
61 3300005338 Ga0068868_100053626 Ga0068868_1000536263 135
62 3300005355 Ga0070671_100026365 Ga0070671_1000263651 135
63 3300005367 Ga0070667_100561752 Ga0070667_1005617521 135
64 3300005441 Ga0070700_100012447 Ga0070700_1000124472 135
65 3300005444 Ga0070694_100190452 Ga0070694_1001904521 135
66 3300005545 Ga0070695_100004069 Ga0070695_1000040699 135
67 3300005546 Ga0070696_100729189 Ga0070696_1007291891 135
68 3300005548 Ga0070665_102486367 Ga0070665_1024863671 135
69 3300005614 Ga0068856_100127935 Ga0068856_1001279352 135
70 3300005617 Ga0068859_100039861 Ga0068859_1000398613 135
71 3300005617 Ga0068859_100048025 Ga0068859_1000480252 135
72 3300005718 Ga0068866_10135345 Ga0068866_101353451 135
73 3300005843 Ga0068860_100687319 Ga0068860_1006873191 135
74 3300006237 Ga0097621_100055161 Ga0097621_1000551612 135
75 3300006881 Ga0068865_100128839 Ga0068865_1001288393 135
76 3300006931 Ga0097620_100039860 Ga0097620_1000398604 135
77 3300006931 Ga0097620_100048027 Ga0097620_1000480272 135
78 3300009094 Ga0111539_10280241 Ga0111539_102802412 135
79 3300009101 Ga0105247_10166047 Ga0105247_101660472 135
80 3300009545 Ga0105237_10881908 Ga0105237_108819082 135
81 3300010375 Ga0105239_10022967 Ga0105239_100229671 135
82 3300014968 Ga0157379_10001994 Ga0157379_100019942 135
83 3300014969 Ga0157376_10002077 Ga0157376_1000207712 135
84 3300017792 Ga0163161_10244702 Ga0163161_102447022 135
85 3300025231 Ga0207427_100166 Ga0207427_10016673 135
86 3300025233 Ga0209437_100288 Ga0209437_10028813 135
87 3300025261 Ga0209233_1000284 Ga0209233_10002849 135
88 3300025909 Ga0207705_10358300 Ga0207705_103583002 135
89 3300025929 Ga0207664_10664354 Ga0207664_106643542 135
90 3300025932 Ga0207690_10022893 Ga0207690_100228931 135
91 3300025938 Ga0207704_10188275 Ga0207704_101882751 135
92 3300025944 Ga0207661_10071345 Ga0207661_100713452 135
93 3300025945 Ga0207679_10592405 Ga0207679_105924052 135
94 3300025981 Ga0207640_10192778 Ga0207640_101927781 135
95 3300025986 Ga0207658_10379605 Ga0207658_103796053 135
96 3300026023 Ga0207677_10020873 Ga0207677_100208733 135
97 3300026035 Ga0207703_10083711 Ga0207703_100837113 135
98 3300026075 Ga0207708_10191849 Ga0207708_101918492 135
99 3300028379 Ga0268266_10029986 Ga0268266_100299865 135
100 3300041491 Ga0451833_1065971 Ga0451833_1065971_229_693 135
101 3300048908 Ga0496105_0024647 Ga0496105_0024647_1646_2110 135
102 3300048913 Ga0496110_0090396 Ga0496110_0090396_31_495 135
103 3300048917 Ga0496114_0454626 Ga0496114_0454626_251_715 135
104 3300050511 nmdc:mga08y16_716884_c1 nmdc:mga08y16_716884_c1_418_882 135
105 2162886007 SwRhRL2b_contig_2372410 SwRhRL2b_0796.00006260 136
106 3300001990 JGI24737J22298_10015627 JGI24737J22298_100156274 136
107 3300002067 JGI24735J21928_10000048 JGI24735J21928_1000004823 136
108 3300002705 JGI25156J39149_1000177 JGI25156J39149_100017720 136
109 3300002773 JGI25152J39213_1000378 JGI25152J39213_10003788 136
110 3300002774 JGI25150J39212_1000014 JGI25150J39212_100001475 136
111 3300003187 JGI25151J46595_10000042 JGI25151J46595_1000004275 136
112 3300003215 JGI25153J46596_10000009 JGI25153J46596_1000000975 136
113 3300003316 rootH1_10002470 rootH1_1000247015 136
114 3300003322 rootL2_10010069 rootL2_1001006914 136
115 3300003323 rootH1_10088094 rootH1_100880942 136
116 3300005288 Ga0065714_10005749 Ga0065714_100057495 136
117 3300005288 Ga0065714_10017573 Ga0065714_100175732 136
118 3300005327 Ga0070658_10040131 Ga0070658_100401312 136
119 3300005434 Ga0070709_10015325 Ga0070709_100153254 136
120 3300005435 Ga0070714_101060955 Ga0070714_1010609552 136
121 3300005439 Ga0070711_100339872 Ga0070711_1003398722 136
122 3300005545 Ga0070695_100239117 Ga0070695_1002391171 136
123 3300005563 Ga0068855_100004987 Ga0068855_1000049878 136
124 3300005563 Ga0068855_100726891 Ga0068855_1007268912 136
125 3300005577 Ga0068857_100110371 Ga0068857_1001103714 136
126 3300005614 Ga0068856_100208115 Ga0068856_1002081152 136
127 3300005614 Ga0068856_102021572 Ga0068856_1020215721 136
128 3300005937 Ga0081455_10095326 Ga0081455_100953263 136
129 3300006038 Ga0075365_10046567 Ga0075365_100465671 136
130 3300006048 Ga0075363_100010033 Ga0075363_1000100334 136
131 3300006051 Ga0075364_10006202 Ga0075364_100062029 136
132 3300006175 Ga0070712_100001011 Ga0070712_10000101111 136
133 3300006178 Ga0075367_10227794 Ga0075367_102277942 136
134 3300006186 Ga0075369_10000904 Ga0075369_1000090410 136
135 3300006195 Ga0075366_10011521 Ga0075366_100115214 136
136 3300006237 Ga0097621_101294812 Ga0097621_1012948122 136
137 3300006914 Ga0075436_100209766 Ga0075436_1002097662 136
138 3300006942 Ga0099824_1003113 Ga0099824_100311323 136
139 3300006948 Ga0099826_10024550 Ga0099826_100245506 136
140 3300009036 Ga0105244_10000108 Ga0105244_1000010819 136
141 3300009092 Ga0105250_10012083 Ga0105250_100120834 136
142 3300009093 Ga0105240_10002512 Ga0105240_100025124 136
143 3300009093 Ga0105240_10069889 Ga0105240_100698892 136
144 3300009148 Ga0105243_10000007 Ga0105243_10000007248 136
145 3300009174 Ga0105241_10013265 Ga0105241_100132654 136
146 3300009174 Ga0105241_10035848 Ga0105241_100358481 136
147 3300009763 Ga0123340_1029900 Ga0123340_10299003 136
148 3300009766 Ga0123342_1022538 Ga0123342_10225384 136
149 3300010375 Ga0105239_10855860 Ga0105239_108558601 136
150 3300013100 Ga0157373_10003329 Ga0157373_1000332914 136
151 3300013102 Ga0157371_10389762 Ga0157371_103897621 136
152 3300013102 Ga0157371_10402356 Ga0157371_104023561 136
153 3300013104 Ga0157370_10000505 Ga0157370_100005059 136
154 3300013104 Ga0157370_10487943 Ga0157370_104879432 136
155 3300013105 Ga0157369_10108483 Ga0157369_101084832 136
156 3300013105 Ga0157369_10650587 Ga0157369_106505872 136
157 3300013296 Ga0157374_10012550 Ga0157374_100125507 136
158 3300013307 Ga0157372_10000120 Ga0157372_1000012051 136
159 3300013307 Ga0157372_10059789 Ga0157372_100597896 136
160 3300013307 Ga0157372_10103756 Ga0157372_101037565 136
161 3300014325 Ga0163163_10852020 Ga0163163_108520202 136
162 3300014745 Ga0157377_10038975 Ga0157377_100389753 136
163 3300014968 Ga0157379_10750016 Ga0157379_107500162 136
164 3300014968 Ga0157379_11388582 Ga0157379_113885822 136
165 3300021361 Ga0213872_10049096 Ga0213872_100490962 136
166 3300025245 Ga0207425_1000023 Ga0207425_100002375 136
167 3300025246 Ga0209646_1002128 Ga0209646_10021283 136
168 3300025250 Ga0209026_1049244 Ga0209026_10492442 136
169 3300025256 Ga0209759_1000033 Ga0209759_1000033159 136
170 3300025258 Ga0209129_1000032 Ga0209129_1000032198 136
171 3300025294 Ga0209025_1000047 Ga0209025_1000047198 136
172 3300025297 Ga0209758_1000145 Ga0209758_100014575 136
173 3300025711 Ga0207696_1019835 Ga0207696_10198352 136
174 3300025728 Ga0207655_1000128 Ga0207655_100012847 136
175 3300025904 Ga0207647_10079677 Ga0207647_100796772 136
176 3300025906 Ga0207699_10056044 Ga0207699_100560441 136
177 3300025909 Ga0207705_10018389 Ga0207705_100183894 136
178 3300025911 Ga0207654_10133895 Ga0207654_101338952 136
179 3300025913 Ga0207695_10032792 Ga0207695_100327926 136
180 3300025913 Ga0207695_10315449 Ga0207695_103154492 136
181 3300025913 Ga0207695_11194976 Ga0207695_111949761 136
182 3300025914 Ga0207671_10033625 Ga0207671_100336252 136
183 3300025915 Ga0207693_10000749 Ga0207693_1000074921 136
184 3300025924 Ga0207694_10146453 Ga0207694_101464533 136
185 3300025928 Ga0207700_10099242 Ga0207700_100992422 136
186 3300025935 Ga0207709_10000049 Ga0207709_10000049145 136
187 3300025939 Ga0207665_10605275 Ga0207665_106052752 136
188 3300026041 Ga0207639_10099176 Ga0207639_100991762 136
189 3300026078 Ga0207702_10373783 Ga0207702_103737831 136
190 3300026078 Ga0207702_12401700 Ga0207702_124017001 136
191 3300026095 Ga0207676_12074442 Ga0207676_120744422 136
192 3300026116 Ga0207674_10047246 Ga0207674_100472465 136
193 3300026118 Ga0207675_100234975 Ga0207675_1002349753 136
194 3300027666 Ga0209282_1181361 Ga0209282_11813612 136
195 3300028786 Ga0307517_10142585 Ga0307517_101425852 136
196 3300030521 Ga0307511_10000024 Ga0307511_1000002450 136
197 3300030521 Ga0307511_10000948 Ga0307511_100009486 136
198 3300031251 Ga0265327_10000338 Ga0265327_1000033866 136
199 3300031730 Ga0307516_10426937 Ga0307516_104269373 136
200 3300031903 Ga0307407_10336432 Ga0307407_103364321 136
201 3300031995 Ga0307409_100026982 Ga0307409_1000269824 136
202 3300032002 Ga0307416_100452114 Ga0307416_1004521142 136
203 3300032002 Ga0307416_100454284 Ga0307416_1004542842 136
204 3300032004 Ga0307414_10063529 Ga0307414_100635292 136
205 3300032004 Ga0307414_10274047 Ga0307414_102740471 136
206 3300033179 Ga0307507_10114566 Ga0307507_101145662 136
207 3300035121 Ga0373960_0013451 Ga0373960_0013451_1243_1656 136
208 3300035691 Ga0373931_0024668 Ga0373931_0024668_678_1091 136
209 3300035695 Ga0373927_0239349 Ga0373927_0239349_160_633 136
210 3300037466 Ga0395898_0785869 Ga0395898_0785869_394_867 136
211 3300039110 Ga0400487_38073 Ga0400487_38073_3761_4267 136
212 3300039447 Ga0436361_0668197 Ga0436361_0668197_2890_3360 136
213 3300039447 Ga0436361_0905531 Ga0436361_0905531_1636_2109 136
214 3300041411 Ga0439466_0000384 Ga0439466_0000384_1143_1556 136
215 3300042008 Ga0439450_018443 Ga0439450_018443_615_1088 136
216 3300042016 Ga0439463_005186 Ga0439463_005186_1620_2093 136
217 3300042156 Ga0439446_0053438 Ga0439446_0053438_288_716 136
218 3300042461 Ga0439460_0007710 Ga0439460_0007710_1880_2353 136
219 3300044658 Ga0466972_0091951 Ga0466972_0091951_587_1048 136
220 3300044683 Ga0466965_0013063 Ga0466965_0013063_830_1291 136
221 3300044693 Ga0466961_0004380 Ga0466961_0004380_7692_8153 136
222 3300044706 Ga0466964_0124135 Ga0466964_0124135_13_474 136
223 3300044765 Ga0466970_0228960 Ga0466970_0228960_391_852 136
224 3300045049 Ga0466959_0070060 Ga0466959_0070060_1908_2369 136
225 3300045051 Ga0451576_0134945 Ga0451576_0134945_856_1281 136
226 3300045836 Ga0466958_0091063 Ga0466958_0091063_1383_1844 136
227 3300046454 Ga0495592_0406824 Ga0495592_0406824_394_825 136
228 3300046460 Ga0495638_0246858 Ga0495638_0246858_342_752 136
229 3300046463 Ga0495653_0439120 Ga0495653_0439120_70_501 136
230 3300046475 Ga0495639_0291044 Ga0495639_0291044_195_623 136
231 3300046492 Ga0495585_0001092 Ga0495585_0001092_13268_13678 136
232 3300046500 Ga0495596_0001485 Ga0495596_0001485_8178_8591 136
233 3300046506 Ga0495583_0214817 Ga0495583_0214817_88_549 136
234 3300046513 Ga0495616_0000819 Ga0495616_0000819_19354_19764 136
235 3300046513 Ga0495616_0089291 Ga0495616_0089291_26_436 136
236 3300046514 Ga0495618_0645524 Ga0495618_0645524_95_526 136
237 3300046517 Ga0495630_0221723 Ga0495630_0221723_456_884 136
238 3300046520 Ga0495637_0305825 Ga0495637_0305825_51_461 136
239 3300046533 Ga0495640_0082564 Ga0495640_0082564_665_1093 136
240 3300046543 Ga0495645_0275457 Ga0495645_0275457_90_521 136
241 3300046642 Ga0495634_0265516 Ga0495634_0265516_378_806 136
242 3300046660 Ga0495625_0015975 Ga0495625_0015975_558_968 136
243 3300046660 Ga0495625_0093508 Ga0495625_0093508_671_1084 136
244 3300046660 Ga0495625_0163923 Ga0495625_0163923_1055_1465 136
245 3300046683 Ga0495658_0192556 Ga0495658_0192556_670_1098 136
246 3300046689 Ga0495613_0030666 Ga0495613_0030666_3364_3792 136
247 3300046810 Ga0495660_0143551 Ga0495660_0143551_180_593 136
248 3300047315 Ga0495581_0568056 Ga0495581_0568056_170_598 136
249 3300047320 Ga0495672_0035598 Ga0495672_0035598_2121_2582 136
250 3300047321 Ga0495676_0618518 Ga0495676_0618518_75_503 136
251 3300047443 Ga0495687_001602 Ga0495687_001602_18806_19216 136
252 3300047471 Ga0495684_0220440 Ga0495684_0220440_637_1068 136
253 3300047472 Ga0495686_0000004 Ga0495686_0000004_24906_25316 136
254 3300047472 Ga0495686_0000154 Ga0495686_0000154_118949_119359 136
255 3300047472 Ga0495686_0000706 Ga0495686_0000706_29855_30268 136
256 3300047472 Ga0495686_0011013 Ga0495686_0011013_1861_2271 136
257 3300048903 Ga0496100_0447601 Ga0496100_0447601_530_940 136
258 3300048903 Ga0496100_0660062 Ga0496100_0660062_62_538 136
259 3300048904 Ga0496101_0592783 Ga0496101_0592783_380_790 136
260 3300048905 Ga0496102_0128423 Ga0496102_0128423_1894_2307 136
261 3300048906 Ga0496103_0082162 Ga0496103_0082162_1560_1973 136
262 3300048908 Ga0496105_1278548 Ga0496105_1278548_28_441 136
263 3300048920 Ga0496117_0000086 Ga0496117_0000086_139872_140285 136
264 3300048921 Ga0496118_0000333 Ga0496118_0000333_29043_29456 136
265 3300048922 Ga0496119_0000037 Ga0496119_0000037_139921_140334 136
266 3300048925 Ga0496122_0001440 Ga0496122_0001440_31238_31651 136
267 3300048926 Ga0496123_0001544 Ga0496123_0001544_6998_7411 136
268 3300048927 Ga0496124_0130312 Ga0496124_0130312_248_697 136
269 3300048927 Ga0496124_0251781 Ga0496124_0251781_259_669 136
270 3300048928 Ga0496125_0067736 Ga0496125_0067736_133_546 136
271 3300048929 Ga0496126_0002135 Ga0496126_0002135_16895_17305 136
272 3300049459 Ga0495678_005124 Ga0495678_005124_3551_3961 136
273 3300049581 Ga0501047_0006770 Ga0501047_0006770_9855_10325 136
274 3300049758 Ga0501241_000449 Ga0501241_000449_1252_1662 136
275 3300049823 Ga0501044_1041273 Ga0501044_1041273_134_604 136
276 3300050490 nmdc:mga03n38_2250_c1 nmdc:mga03n38_2250_c1_1943_2404 136
277 3300050491 nmdc:mga00v17_10482_c1 nmdc:mga00v17_10482_c1_737_1198 136
278 3300050493 nmdc:mga0k408_42372_c1 nmdc:mga0k408_42372_c1_815_1225 136
279 3300050516 nmdc:mga0sz30_729_c1 nmdc:mga0sz30_729_c1_7355_7816 136
280 3300053088 Ga0500644_0000171 Ga0500644_0000171_37969_38379 136
281 3300053090 Ga0500646_0011929 Ga0500646_0011929_881_1294 136
282 3300053092 Ga0500583_0017532 Ga0500583_0017532_949_1380 136
283 3300053096 Ga0500641_0000019 Ga0500641_0000019_107362_107775 136
284 3300053131 Ga0500652_168857 Ga0500652_168857_353_763 136
285 3300053134 Ga0500658_0000003 Ga0500658_0000003_311011_311424 136
286 3300053146 Ga0500588_0081537 Ga0500588_0081537_267_677 136
287 3300053146 Ga0500588_0136409 Ga0500588_0136409_397_828 136
288 3300053161 Ga0500634_0188932 Ga0500634_0188932_143_559 136
289 3300061719 Ga0466962_0043994 Ga0466962_0043994_1583_2044 136

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07080

DUF1348

Protein of unknown function (DUF1348)

12

62

0.97

PF07080

DUF1348

Protein of unknown function (DUF1348)

59

124

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2imj-assembly2.cif.gz_D x-ray crystal structure of protein pfl_3262 from pseudomonas fluorescens. northeast structural genomics consortium target plr14. 1 6 136
2imj-assembly2.cif.gz_D x-ray crystal structure of protein pfl_3262 from pseudomonas fluorescens. northeast structural genomics consortium target plr14. 0.9563 6 136
6f50-assembly2.cif.gz_B crystal structure of ketosteroid isomerase double variant v88i/l99v 0.8887 11 125
4pej-assembly1.cif.gz_A crystal structure of a computationally designed retro-aldolase, ra110.4 (cys free) 0.8868 21 125
3ebt-assembly1.cif.gz_A-2 crystal structure of a ntf2-like protein of unknown function (bpss0132) from burkholderia pseudomallei k96243 at 1.30 a resolution 0.8841 15 125
ID Description Score Start End Superfamily
2imjD01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 1 11 136 3.10.450.50
2imjD01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.905 11 136 3.10.450.50
5cxoA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.88 13 125 3.10.450.50
3ebtA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8734 15 125 3.10.450.50
5aigB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8727 15 125 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A529HV08-F1-model_v4 deleted 1.005 6 91
AF-A0A512HQ28-F1-model_v4 50S ribosomal protein L21 1.005 54 134
AF-A0A367HY18-F1-model_v4 Nuclear transport factor 2 family protein 1.004 6 136
AF-A0A2R5GW03-F1-model_v4 Uncharacterized protein 1.004 6 134
AF-A0A7V3I003-F1-model_v4 Nuclear transport factor 2 family protein 1.004 6 135

Feature Viewer

pLDDT pTM Quality
96.39 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map