F389200

General Info

Members Datasets Scaffolds Average Seq Length
289 178 289 389

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10018465|Ga0163163_100184651
Length 430
Sequence MVPFGRNHQGAKHKDPRPKTKDQNRNDHHPVSTSTFIDTVDSATGSGPMMRASVLCDVARLEIRDVPRPVIASHEVLVRVAAVGICGTDAHIFAGHANYNTNERGQPIPLALQPQILGHEISGTIEEVGQGVSDLRPGDRVVIDQGLNCVSRRRERLCDYCRTGDSHQCEFYREHGITGLPGGLADFIAVPAVNAVKITTNLSFISAALVEPLGCVIHSSDTVAKTRTRYSFTADKPDQRVRSVLICGAGPAGLLFIQYLRNVIGYSGSLCVSDPNKRKRALAKKLGADQAIDPTASDLIEVVREHSSGKGVEYLIEASGAGEVFASIPGLVCKQAAVLLYGHGHAGTDLSVMNNILFKEPQIVASVGASGGFDADGRPMVYKRALSLIENKQIDVEAFITHHYKSFEQVSAALSGGMQEEDYVKGVVVL

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
128 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
129 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
134 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
140 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
145 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
146 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
147 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
148 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
149 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
150 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
151 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
152 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
153 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
154 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
155 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
156 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
157 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
158 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
159 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
160 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
161 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
162 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
163 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
164 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
165 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
166 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
169 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
175 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
176 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
177 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
178 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.73
Rhizosphere 97.92
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10000011 3300002459 Bacteria 117978
2 JGI25406J46586_10028402 3300003203 Bacteria 2132
3 rootL2_10136754 3300003322 Bacteria 6816
4 Ga0065714_10064458 3300005288 Bacteria 67915
5 Ga0065712_10000114 3300005290 Bacteria 191810
6 Ga0065712_10093786 3300005290 Bacteria 2279
7 Ga0065715_10014801 3300005293 Unclassified 1905
8 Ga0065715_10088985 3300005293 Bacteria 18286
9 Ga0070690_100002306 3300005330 Bacteria 10235
10 Ga0070690_100014710 3300005330 Unclassified 4647
11 Ga0070690_100030351 3300005330 Bacteria 3359
12 Ga0070670_100000559 3300005331 Bacteria 29535
13 Ga0070670_100025439 3300005331 Bacteria 5094
14 Ga0070670_100098866 3300005331 Bacteria 2511
15 Ga0068869_100057867 3300005334 Bacteria 2832
16 Ga0068869_100087114 3300005334 Unclassified 2342
17 Ga0070666_10020475 3300005335 Bacteria 4276
18 Ga0070680_100307703 3300005336 Bacteria 1344
19 Ga0068868_100006189 3300005338 Bacteria 8465
20 Ga0070689_100040540 3300005340 Bacteria 3571
21 Ga0070687_100041742 3300005343 Bacteria 2320
22 Ga0070687_100071817 3300005343 Bacteria 1861
23 Ga0070692_10121080 3300005345 Unclassified 1459
24 Ga0070669_100011749 3300005353 Bacteria 6212
25 Ga0070671_100096764 3300005355 Unclassified 2475
26 Ga0070673_100026606 3300005364 Bacteria 4275
27 Ga0070673_100027521 3300005364 Bacteria 4216
28 Ga0070688_100038260 3300005365 Unclassified 2928
29 Ga0070659_100002068 3300005366 Bacteria 14319
30 Ga0070705_100039574 3300005440 Bacteria 2676
31 Ga0070705_100155310 3300005440 Bacteria 1523
32 Ga0070700_100000027 3300005441 Bacteria 123461
33 Ga0070700_100030281 3300005441 Bacteria 3234
34 Ga0070694_100010320 3300005444 Bacteria 5759
35 Ga0070694_100022043 3300005444 Bacteria 4079
36 Ga0070708_100000865 3300005445 Bacteria 22857
37 Ga0070708_100011648 3300005445 Bacteria 7159
38 Ga0070678_100116463 3300005456 Unclassified 2100
39 Ga0070662_100273332 3300005457 Bacteria 1365
40 Ga0070681_10002169 3300005458 Bacteria 17858
41 Ga0068867_100133089 3300005459 Bacteria 1935
42 Ga0068867_100146107 3300005459 Bacteria 1853
43 Ga0070685_10043774 3300005466 Unclassified 2561
44 Ga0070706_100000001 3300005467 Bacteria 342302
45 Ga0070706_100006305 3300005467 Bacteria 11209
46 Ga0070707_100034895 3300005468 Bacteria 4796
47 Ga0070707_100126130 3300005468 Unclassified 2487
48 Ga0070707_100274725 3300005468 Bacteria 1638
49 Ga0070698_100008881 3300005471 Bacteria 10804
50 Ga0070698_100021418 3300005471 Bacteria 6771
51 Ga0070699_100001536 3300005518 Bacteria 21100
52 Ga0070699_100003708 3300005518 Bacteria 13505
53 Ga0070699_100216865 3300005518 Unclassified 1705
54 Ga0070679_100007285 3300005530 Bacteria 10330
55 Ga0070684_100331588 3300005535 Unclassified 1398
56 Ga0070697_100017185 3300005536 Bacteria 5687
57 Ga0070697_100309926 3300005536 Bacteria 1358
58 Ga0070672_100106841 3300005543 Bacteria 2277
59 Ga0070686_100005282 3300005544 Bacteria 7140
60 Ga0070695_100036461 3300005545 Unclassified 3095
61 Ga0070695_100064768 3300005545 Unclassified 2378
62 Ga0070696_100043485 3300005546 Bacteria 3108
63 Ga0070693_100016560 3300005547 Unclassified 3818
64 Ga0070693_100053669 3300005547 Bacteria 2315
65 Ga0070665_100131978 3300005548 Bacteria 2500
66 Ga0070704_100008596 3300005549 Bacteria 6134
67 Ga0070664_100011106 3300005564 Bacteria 7302
68 Ga0068857_100004188 3300005577 Bacteria 12143
69 Ga0068854_100271366 3300005578 Bacteria 1362
70 Ga0068859_100005394 3300005617 Bacteria 13002
71 Ga0068859_100014385 3300005617 Bacteria 7939
72 Ga0068859_100016285 3300005617 Bacteria 7468
73 Ga0068859_100069957 3300005617 Bacteria 3545
74 Ga0068859_100095122 3300005617 Bacteria 3032
75 Ga0068859_100103696 3300005617 Bacteria 2902
76 Ga0068859_100117979 3300005617 Bacteria 2719
77 Ga0068864_100206066 3300005618 Unclassified 1809
78 Ga0068861_100064495 3300005719 Unclassified 2818
79 Ga0068861_100072483 3300005719 Unclassified 2673
80 Ga0068863_100058052 3300005841 Unclassified 3662
81 Ga0068863_100127110 3300005841 Bacteria 2432
82 Ga0068863_100306713 3300005841 Bacteria 1540
83 Ga0068858_100082890 3300005842 Bacteria 2981
84 Ga0068858_100114591 3300005842 Unclassified 2519
85 Ga0068860_100149102 3300005843 Unclassified 2252
86 Ga0068862_100020488 3300005844 Bacteria 5524
87 Ga0068862_100056387 3300005844 Bacteria 3366
88 Ga0068862_100081308 3300005844 Bacteria 2811
89 Ga0081539_10001896 3300005985 Bacteria 32432
90 Ga0081539_10005701 3300005985 Bacteria 12479
91 Ga0097621_100024721 3300006237 Bacteria 4694
92 Ga0068871_100012493 3300006358 Bacteria 6264
93 Ga0068871_100020802 3300006358 Bacteria 5032
94 Ga0075428_100249946 3300006844 Bacteria 1911
95 Ga0075430_100034377 3300006846 Bacteria 4302
96 Ga0075431_100046870 3300006847 Bacteria 4457
97 Ga0075433_10059219 3300006852 Bacteria 3351
98 Ga0075433_10061780 3300006852 Bacteria 3282
99 Ga0075429_100023746 3300006880 Bacteria 5320
100 Ga0075436_100126545 3300006914 Bacteria 1790
101 Ga0097620_100005394 3300006931 Bacteria 13002
102 Ga0097620_100014384 3300006931 Bacteria 7939
103 Ga0097620_100016287 3300006931 Bacteria 7468
104 Ga0097620_100069959 3300006931 Bacteria 3545
105 Ga0097620_100095117 3300006931 Bacteria 3032
106 Ga0097620_100103694 3300006931 Bacteria 2902
107 Ga0097620_100117984 3300006931 Bacteria 2719
108 Ga0099794_10001881 3300007265 Bacteria 7533
109 Ga0111539_10014989 3300009094 Bacteria 9660
110 Ga0111539_10019663 3300009094 Bacteria 8329
111 Ga0105247_10040214 3300009101 Bacteria 2857
112 Ga0114129_10003442 3300009147 Bacteria 22256
113 Ga0114129_10045648 3300009147 Bacteria 6158
114 Ga0114129_10061060 3300009147 Bacteria 5268
115 Ga0114129_10062463 3300009147 Bacteria 5203
116 Ga0114129_10527297 3300009147 Bacteria 1539
117 Ga0105243_10000119 3300009148 Bacteria 91258
118 Ga0105243_10002987 3300009148 Bacteria 13979
119 Ga0105242_10000514 3300009176 Bacteria 30424
120 Ga0105242_10030711 3300009176 Bacteria 4291
121 Ga0105242_10086738 3300009176 Bacteria 2627
122 Ga0105242_10257579 3300009176 Bacteria 1575
123 Ga0105248_10004476 3300009177 Bacteria 15458
124 Ga0105248_10004972 3300009177 Bacteria 14692
125 Ga0105248_10020479 3300009177 Bacteria 7329
126 Ga0105248_10030593 3300009177 Bacteria 6012
127 Ga0105237_10002230 3300009545 Bacteria 24218
128 Ga0105249_10032088 3300009553 Bacteria 4752
129 Ga0105249_10038668 3300009553 Bacteria 4329
130 Ga0105249_10056064 3300009553 Bacteria 3608
131 Ga0105246_10070071 3300011119 Bacteria 2465
132 Ga0157373_10002373 3300013100 Bacteria 14303
133 Ga0157374_10031731 3300013296 Bacteria 4805
134 Ga0157374_10077437 3300013296 Bacteria 3147
135 Ga0157378_10002134 3300013297 Bacteria 17569
136 Ga0157378_10009344 3300013297 Bacteria 8540
137 Ga0157378_10019816 3300013297 Bacteria 5915
138 Ga0163162_10002798 3300013306 Bacteria 16586
139 Ga0163162_10011194 3300013306 Bacteria 8743
140 Ga0163162_10013662 3300013306 Bacteria 7934
141 Ga0163162_10057415 3300013306 Bacteria 3920
142 Ga0163162_10209389 3300013306 Bacteria 2079
143 Ga0157375_10040600 3300013308 Unclassified 4487
144 Ga0157375_10051794 3300013308 Bacteria 4034
145 Ga0157375_10191654 3300013308 Bacteria 2199
146 Ga0157375_10326267 3300013308 Unclassified 1700
147 Ga0163163_10000278 3300014325 Bacteria 51079
148 Ga0163163_10004532 3300014325 Bacteria 11861
149 Ga0163163_10004786 3300014325 Bacteria 11619
150 Ga0163163_10011145 3300014325 Bacteria 8139
151 Ga0163163_10018465 3300014325 Bacteria 6530
152 Ga0163163_10029263 3300014325 Bacteria 5298
153 Ga0157380_10004575 3300014326 Bacteria 9604
154 Ga0157380_10297299 3300014326 Bacteria 1485
155 Ga0157377_10026741 3300014745 Bacteria 3091
156 Ga0157377_10039101 3300014745 Bacteria 2622
157 Ga0157376_10009507 3300014969 Bacteria 7064
158 Ga0157376_10018549 3300014969 Bacteria 5338
159 Ga0163161_10024804 3300017792 Bacteria 4238
160 Ga0163161_10165062 3300017792 Bacteria 1690
161 Ga0207710_10093516 3300025900 Bacteria 1410
162 Ga0207680_10014664 3300025903 Bacteria 4066
163 Ga0207645_10084642 3300025907 Bacteria 2035
164 Ga0207684_10035921 3300025910 Bacteria 4206
165 Ga0207707_10064226 3300025912 Bacteria 3195
166 Ga0207707_10104394 3300025912 Unclassified 2477
167 Ga0207671_10037160 3300025914 Unclassified 3612
168 Ga0207662_10009045 3300025918 Bacteria 5471
169 Ga0207662_10050930 3300025918 Bacteria 2462
170 Ga0207652_10048043 3300025921 Bacteria 3647
171 Ga0207646_10087857 3300025922 Bacteria 2781
172 Ga0207646_10272133 3300025922 Unclassified 1531
173 Ga0207681_10062089 3300025923 Unclassified 2571
174 Ga0207650_10000001 3300025925 Bacteria 1545726
175 Ga0207650_10141870 3300025925 Unclassified 1889
176 Ga0207690_10016101 3300025932 Unclassified 4545
177 Ga0207686_10000114 3300025934 Bacteria 64832
178 Ga0207686_10000762 3300025934 Bacteria 19805
179 Ga0207686_10000765 3300025934 Bacteria 19778
180 Ga0207709_10000162 3300025935 Bacteria 91279
181 Ga0207709_10004166 3300025935 Bacteria 8416
182 Ga0207691_10058210 3300025940 Unclassified 3515
183 Ga0207711_10020270 3300025941 Bacteria 5541
184 Ga0207711_10063697 3300025941 Bacteria 3184
185 Ga0207711_10071494 3300025941 Bacteria 3010
186 Ga0207711_10178763 3300025941 Bacteria 1928
187 Ga0207689_10004034 3300025942 Bacteria 13342
188 Ga0207689_10062200 3300025942 Bacteria 3070
189 Ga0207679_10140617 3300025945 Bacteria 1951
190 Ga0207712_10011534 3300025961 Archaea 5633
191 Ga0207712_10138289 3300025961 Unclassified 1866
192 Ga0207712_10161739 3300025961 Bacteria 1741
193 Ga0207712_10192903 3300025961 Bacteria 1609
194 Ga0207677_10099044 3300026023 Bacteria 2140
195 Ga0207703_10066752 3300026035 Bacteria 2960
196 Ga0207703_10274240 3300026035 Bacteria 1529
197 Ga0207639_10041008 3300026041 Unclassified 3460
198 Ga0207708_10000055 3300026075 Bacteria 103534
199 Ga0207708_10006957 3300026075 Bacteria 8366
200 Ga0207708_10062057 3300026075 Unclassified 2855
201 Ga0207708_10084678 3300026075 Bacteria 2438
202 Ga0207708_10168871 3300026075 Bacteria 1731
203 Ga0207641_10112106 3300026088 Unclassified 2420
204 Ga0207641_10318697 3300026088 Bacteria 1474
205 Ga0207648_10020424 3300026089 Bacteria 5964
206 Ga0207648_10162882 3300026089 Bacteria 1970
207 Ga0207676_10023041 3300026095 Unclassified 4587
208 Ga0207676_10040450 3300026095 Bacteria 3573
209 Ga0207676_10054912 3300026095 Bacteria 3123
210 Ga0207676_10124790 3300026095 Bacteria 2178
211 Ga0207674_10002475 3300026116 Bacteria 23302
212 Ga0207674_10473518 3300026116 Bacteria 1210
213 Ga0207675_100003364 3300026118 Bacteria 15627
214 Ga0207675_100005381 3300026118 Bacteria 12281
215 Ga0207675_100008722 3300026118 Bacteria 9526
216 Ga0207683_10022384 3300026121 Bacteria 5424
217 Ga0209588_1006020 3300027671 Bacteria 3502
218 Ga0207428_10011057 3300027907 Bacteria 8020
219 Ga0207428_10029696 3300027907 Bacteria 4527
220 Ga0268265_10279102 3300028380 Bacteria 1494
221 Ga0268264_10270897 3300028381 Bacteria 1586
222 Ga0307408_100016113 3300031548 Bacteria 4984
223 Ga0307405_10006601 3300031731 Bacteria 5721
224 Ga0307413_10270267 3300031824 Bacteria 1272
225 Ga0307410_10078166 3300031852 Bacteria 2315
226 Ga0307406_10013711 3300031901 Bacteria 4649
227 Ga0307407_10014280 3300031903 Bacteria 3884
228 Ga0307416_100012440 3300032002 Bacteria 5733
229 Ga0307414_10007034 3300032004 Bacteria 6307
230 Ga0307411_10070719 3300032005 Bacteria 2362
231 Ga0307415_100036316 3300032126 Bacteria 3227
232 Ga0307415_100154307 3300032126 Bacteria 1771
233 Ga0373940_0028231 3300035088 Bacteria 1480
234 Ga0373951_0003590 3300035091 Bacteria 3743
235 Ga0373927_0004058 3300035695 Bacteria 10340
236 Ga0395905_0076222 3300037471 Bacteria 3143
237 Ga0395901_0493346 3300038443 Bacteria 1248
238 Ga0451576_0184166 3300045051 Bacteria 2181
239 Ga0495594_0002601 3300046499 Bacteria 9382
240 Ga0495613_0088635 3300046689 Bacteria 2242
241 Ga0496105_0357316 3300048908 Bacteria 1166
242 Ga0496106_0002329 3300048909 Bacteria 14162
243 Ga0496109_0169195 3300048912 Bacteria 2050
244 Ga0496112_0147931 3300048915 Unclassified 2317
245 Ga0496114_0048604 3300048917 Bacteria 3529
246 Ga0501032_0073921 3300049569 Bacteria 2271
247 Ga0501034_0204426 3300049571 Bacteria 1932
248 Ga0501043_0033031 3300049579 Unclassified 4070
249 Ga0501047_0000693 3300049581 Bacteria 35200
250 Ga0501075_0057959 3300049591 Bacteria 2917
251 Ga0501076_0313018 3300049592 Unclassified 1288
252 Ga0501198_003174 3300049649 Bacteria 2238
253 Ga0501202_004091 3300049652 Bacteria 2539
254 Ga0501207_000376 3300049654 Bacteria 4897
255 Ga0501208_001695 3300049655 Bacteria 2153
256 Ga0501209_035688 3300049656 Unclassified 1289
257 Ga0501216_003279 3300049660 Bacteria 2352
258 Ga0501217_002078 3300049661 Bacteria 3881
259 Ga0501223_003204 3300049663 Bacteria 3576
260 Ga0501224_000823 3300049664 Bacteria 3941
261 Ga0501227_002081 3300049665 Bacteria 4434
262 Ga0501230_003973 3300049667 Unclassified 2002
263 Ga0501233_003294 3300049668 Bacteria 2900
264 Ga0501235_005573 3300049669 Bacteria 2739
265 Ga0501243_005375 3300049675 Bacteria 1924
266 Ga0501257_011084 3300049686 Bacteria 2053
267 Ga0501221_001390 3300049704 Bacteria 3986
268 Ga0501225_0001037 3300049705 Bacteria 8725
269 Ga0501229_002993 3300049706 Bacteria 2008
270 Ga0501234_004429 3300049707 Bacteria 2210
271 Ga0501279_005402 3300049775 Bacteria 1678
272 Ga0501035_0001002 3300049822 Bacteria 29849
273 Ga0501044_0001167 3300049823 Bacteria 31129
274 Ga0501212_002621 3300049851 Bacteria 2186
275 Ga0501226_000545 3300049853 Bacteria 5183
276 nmdc:mga05p37_90286_c1 3300050507 Bacteria 3776
277 nmdc:mga09592_57282_c1 3300050508 Unclassified 3293
278 nmdc:mga06r32_32763_c1 3300050510 Bacteria 4892
279 nmdc:mga08y16_189924_c1 3300050511 Bacteria 2131
280 nmdc:mga08y16_21755_c1 3300050511 Bacteria 6768
281 nmdc:mga08y16_29842_c1 3300050511 Bacteria 5743
282 nmdc:mga08y16_84354_c1 3300050511 Bacteria 3312
283 nmdc:mga0n895_174536_c1 3300050512 Bacteria 2180
284 nmdc:mga0n895_250427_c1 3300050512 Bacteria 1798
285 nmdc:mga0rr50_175503_c1 3300050513 Bacteria 1749
286 nmdc:mga08x19_86135_c1 3300050514 Bacteria 2068
287 nmdc:mga0a205_136508_c1 3300050515 Bacteria 2353
288 nmdc:mga0a205_76599_c1 3300050515 Unclassified 3233
289 Ga0530510_0079623 3300061734 Bacteria 2383

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0204426 Ga0501034_0204426_637_1824 348
2 3300048908 Ga0496105_0357316 Ga0496105_0357316_69_1154 353
3 3300049569 Ga0501032_0073921 Ga0501032_0073921_38_1180 361
4 3300049579 Ga0501043_0033031 Ga0501043_0033031_300_1442 361
5 3300049581 Ga0501047_0000693 Ga0501047_0000693_14935_16077 361
6 3300049822 Ga0501035_0001002 Ga0501035_0001002_28407_29549 361
7 3300049823 Ga0501044_0001167 Ga0501044_0001167_14283_15425 361
8 3300009147 Ga0114129_10061060 Ga0114129_100610602 363
9 3300050507 nmdc:mga05p37_90286_c1 nmdc:mga05p37_90286_c1_44_1234 363
10 3300006914 Ga0075436_100126545 Ga0075436_1001265452 366
11 3300050514 nmdc:mga08x19_86135_c1 nmdc:mga08x19_86135_c1_279_1436 366
12 3300006237 Ga0097621_100024721 Ga0097621_1000247215 369
13 3300006358 Ga0068871_100020802 Ga0068871_1000208022 369
14 3300025903 Ga0207680_10014664 Ga0207680_100146644 369
15 3300026023 Ga0207677_10099044 Ga0207677_100990442 369
16 3300038443 Ga0395901_0493346 Ga0395901_0493346_12_1124 369
17 3300049686 Ga0501257_011084 Ga0501257_011084_20_1141 369
18 3300005445 Ga0070708_100011648 Ga0070708_1000116484 370
19 3300005468 Ga0070707_100274725 Ga0070707_1002747252 370
20 3300048917 Ga0496114_0048604 Ga0496114_0048604_2063_3199 370
21 3300005330 Ga0070690_100030351 Ga0070690_1000303512 371
22 3300005440 Ga0070705_100039574 Ga0070705_1000395742 371
23 3300005444 Ga0070694_100022043 Ga0070694_1000220433 371
24 3300005546 Ga0070696_100043485 Ga0070696_1000434853 371
25 3300005547 Ga0070693_100016560 Ga0070693_1000165603 371
26 3300005842 Ga0068858_100114591 Ga0068858_1001145913 371
27 3300009545 Ga0105237_10002230 Ga0105237_1000223021 371
28 3300025914 Ga0207671_10037160 Ga0207671_100371603 371
29 3300025922 Ga0207646_10087857 Ga0207646_100878573 371
30 3300032126 Ga0307415_100154307 Ga0307415_1001543072 371
31 3300046499 Ga0495594_0002601 Ga0495594_0002601_68_1258 371
32 3300049591 Ga0501075_0057959 Ga0501075_0057959_989_2128 371
33 3300003203 JGI25406J46586_10028402 JGI25406J46586_100284022 372
34 3300005985 Ga0081539_10005701 Ga0081539_100057017 372
35 3300006852 Ga0075433_10059219 Ga0075433_100592193 372
36 3300025907 Ga0207645_10084642 Ga0207645_100846422 372
37 3300035695 Ga0373927_0004058 Ga0373927_0004058_2775_3917 372
38 3300046689 Ga0495613_0088635 Ga0495613_0088635_220_1413 372
39 3300048915 Ga0496112_0147931 Ga0496112_0147931_748_1914 372
40 3300005288 Ga0065714_10064458 Ga0065714_1006445856 373
41 3300005290 Ga0065712_10000114 Ga0065712_1000011433 373
42 3300005290 Ga0065712_10093786 Ga0065712_100937861 373
43 3300005293 Ga0065715_10014801 Ga0065715_100148012 373
44 3300005293 Ga0065715_10088985 Ga0065715_1008898512 373
45 3300005330 Ga0070690_100014710 Ga0070690_1000147103 373
46 3300005334 Ga0068869_100057867 Ga0068869_1000578672 373
47 3300005334 Ga0068869_100087114 Ga0068869_1000871142 373
48 3300005335 Ga0070666_10020475 Ga0070666_100204754 373
49 3300005336 Ga0070680_100307703 Ga0070680_1003077031 373
50 3300005338 Ga0068868_100006189 Ga0068868_1000061896 373
51 3300005340 Ga0070689_100040540 Ga0070689_1000405404 373
52 3300005343 Ga0070687_100041742 Ga0070687_1000417422 373
53 3300005345 Ga0070692_10121080 Ga0070692_101210801 373
54 3300005355 Ga0070671_100096764 Ga0070671_1000967642 373
55 3300005364 Ga0070673_100026606 Ga0070673_1000266063 373
56 3300005364 Ga0070673_100027521 Ga0070673_1000275211 373
57 3300005365 Ga0070688_100038260 Ga0070688_1000382603 373
58 3300005440 Ga0070705_100155310 Ga0070705_1001553101 373
59 3300005444 Ga0070694_100010320 Ga0070694_1000103202 373
60 3300005445 Ga0070708_100000865 Ga0070708_1000008658 373
61 3300005456 Ga0070678_100116463 Ga0070678_1001164632 373
62 3300005457 Ga0070662_100273332 Ga0070662_1002733322 373
63 3300005459 Ga0068867_100146107 Ga0068867_1001461072 373
64 3300005466 Ga0070685_10043774 Ga0070685_100437742 373
65 3300005467 Ga0070706_100006305 Ga0070706_10000630510 373
66 3300005468 Ga0070707_100034895 Ga0070707_1000348952 373
67 3300005468 Ga0070707_100126130 Ga0070707_1001261302 373
68 3300005471 Ga0070698_100008881 Ga0070698_1000088812 373
69 3300005471 Ga0070698_100021418 Ga0070698_1000214183 373
70 3300005518 Ga0070699_100003708 Ga0070699_1000037084 373
71 3300005518 Ga0070699_100216865 Ga0070699_1002168651 373
72 3300005536 Ga0070697_100017185 Ga0070697_1000171853 373
73 3300005536 Ga0070697_100309926 Ga0070697_1003099261 373
74 3300005543 Ga0070672_100106841 Ga0070672_1001068412 373
75 3300005545 Ga0070695_100036461 Ga0070695_1000364612 373
76 3300005545 Ga0070695_100064768 Ga0070695_1000647682 373
77 3300005547 Ga0070693_100053669 Ga0070693_1000536691 373
78 3300005548 Ga0070665_100131978 Ga0070665_1001319783 373
79 3300005617 Ga0068859_100014385 Ga0068859_1000143851 373
80 3300005617 Ga0068859_100016285 Ga0068859_1000162855 373
81 3300005617 Ga0068859_100069957 Ga0068859_1000699573 373
82 3300005617 Ga0068859_100095122 Ga0068859_1000951222 373
83 3300005617 Ga0068859_100117979 Ga0068859_1001179792 373
84 3300005618 Ga0068864_100206066 Ga0068864_1002060662 373
85 3300005719 Ga0068861_100072483 Ga0068861_1000724832 373
86 3300005841 Ga0068863_100127110 Ga0068863_1001271102 373
87 3300005841 Ga0068863_100306713 Ga0068863_1003067132 373
88 3300005842 Ga0068858_100082890 Ga0068858_1000828902 373
89 3300005843 Ga0068860_100149102 Ga0068860_1001491022 373
90 3300005844 Ga0068862_100056387 Ga0068862_1000563872 373
91 3300006358 Ga0068871_100012493 Ga0068871_1000124934 373
92 3300006844 Ga0075428_100249946 Ga0075428_1002499462 373
93 3300006846 Ga0075430_100034377 Ga0075430_1000343772 373
94 3300006847 Ga0075431_100046870 Ga0075431_1000468703 373
95 3300006880 Ga0075429_100023746 Ga0075429_1000237466 373
96 3300006931 Ga0097620_100014384 Ga0097620_1000143846 373
97 3300006931 Ga0097620_100016287 Ga0097620_1000162875 373
98 3300006931 Ga0097620_100069959 Ga0097620_1000699593 373
99 3300006931 Ga0097620_100095117 Ga0097620_1000951172 373
100 3300006931 Ga0097620_100117984 Ga0097620_1001179843 373
101 3300007265 Ga0099794_10001881 Ga0099794_100018815 373
102 3300009094 Ga0111539_10014989 Ga0111539_100149895 373
103 3300009147 Ga0114129_10003442 Ga0114129_100034427 373
104 3300009147 Ga0114129_10527297 Ga0114129_105272972 373
105 3300009148 Ga0105243_10000119 Ga0105243_100001199 373
106 3300009148 Ga0105243_10002987 Ga0105243_100029876 373
107 3300009176 Ga0105242_10000514 Ga0105242_100005147 373
108 3300009176 Ga0105242_10030711 Ga0105242_100307114 373
109 3300009176 Ga0105242_10086738 Ga0105242_100867381 373
110 3300009177 Ga0105248_10004972 Ga0105248_100049723 373
111 3300009553 Ga0105249_10038668 Ga0105249_100386682 373
112 3300009553 Ga0105249_10056064 Ga0105249_100560643 373
113 3300011119 Ga0105246_10070071 Ga0105246_100700711 373
114 3300013100 Ga0157373_10002373 Ga0157373_100023737 373
115 3300013296 Ga0157374_10031731 Ga0157374_100317312 373
116 3300013296 Ga0157374_10077437 Ga0157374_100774373 373
117 3300013297 Ga0157378_10002134 Ga0157378_100021346 373
118 3300013297 Ga0157378_10019816 Ga0157378_100198165 373
119 3300013306 Ga0163162_10002798 Ga0163162_100027984 373
120 3300013306 Ga0163162_10013662 Ga0163162_100136624 373
121 3300013306 Ga0163162_10209389 Ga0163162_102093892 373
122 3300013308 Ga0157375_10040600 Ga0157375_100406002 373
123 3300013308 Ga0157375_10051794 Ga0157375_100517944 373
124 3300013308 Ga0157375_10191654 Ga0157375_101916541 373
125 3300013308 Ga0157375_10326267 Ga0157375_103262672 373
126 3300014325 Ga0163163_10004532 Ga0163163_100045328 373
127 3300014325 Ga0163163_10004786 Ga0163163_100047863 373
128 3300014325 Ga0163163_10018465 Ga0163163_100184651 373
129 3300014325 Ga0163163_10029263 Ga0163163_100292635 373
130 3300014745 Ga0157377_10026741 Ga0157377_100267413 373
131 3300014745 Ga0157377_10039101 Ga0157377_100391012 373
132 3300014969 Ga0157376_10009507 Ga0157376_100095072 373
133 3300014969 Ga0157376_10018549 Ga0157376_100185494 373
134 3300017792 Ga0163161_10024804 Ga0163161_100248043 373
135 3300025910 Ga0207684_10035921 Ga0207684_100359212 373
136 3300025918 Ga0207662_10009045 Ga0207662_100090454 373
137 3300025918 Ga0207662_10050930 Ga0207662_100509302 373
138 3300025922 Ga0207646_10272133 Ga0207646_102721332 373
139 3300025925 Ga0207650_10141870 Ga0207650_101418701 373
140 3300025934 Ga0207686_10000114 Ga0207686_100001148 373
141 3300025934 Ga0207686_10000762 Ga0207686_100007628 373
142 3300025934 Ga0207686_10000765 Ga0207686_100007657 373
143 3300025935 Ga0207709_10000162 Ga0207709_100001629 373
144 3300025935 Ga0207709_10004166 Ga0207709_100041662 373
145 3300025940 Ga0207691_10058210 Ga0207691_100582101 373
146 3300025941 Ga0207711_10071494 Ga0207711_100714942 373
147 3300025942 Ga0207689_10004034 Ga0207689_100040345 373
148 3300025942 Ga0207689_10062200 Ga0207689_100622003 373
149 3300025945 Ga0207679_10140617 Ga0207679_101406172 373
150 3300025961 Ga0207712_10161739 Ga0207712_101617392 373
151 3300025961 Ga0207712_10192903 Ga0207712_101929031 373
152 3300026035 Ga0207703_10066752 Ga0207703_100667523 373
153 3300026075 Ga0207708_10062057 Ga0207708_100620573 373
154 3300026088 Ga0207641_10318697 Ga0207641_103186972 373
155 3300026089 Ga0207648_10020424 Ga0207648_100204243 373
156 3300026095 Ga0207676_10054912 Ga0207676_100549123 373
157 3300026095 Ga0207676_10124790 Ga0207676_101247902 373
158 3300026116 Ga0207674_10473518 Ga0207674_104735181 373
159 3300026118 Ga0207675_100003364 Ga0207675_1000033648 373
160 3300026118 Ga0207675_100005381 Ga0207675_1000053815 373
161 3300026121 Ga0207683_10022384 Ga0207683_100223843 373
162 3300027671 Ga0209588_1006020 Ga0209588_10060203 373
163 3300027907 Ga0207428_10011057 Ga0207428_100110574 373
164 3300028381 Ga0268264_10270897 Ga0268264_102708972 373
165 3300035088 Ga0373940_0028231 Ga0373940_0028231_296_1432 373
166 3300048909 Ga0496106_0002329 Ga0496106_0002329_3932_5077 373
167 3300048912 Ga0496109_0169195 Ga0496109_0169195_579_1736 373
168 3300049592 Ga0501076_0313018 Ga0501076_0313018_81_1238 373
169 3300050508 nmdc:mga09592_57282_c1 nmdc:mga09592_57282_c1_1513_2673 373
170 3300050510 nmdc:mga06r32_32763_c1 nmdc:mga06r32_32763_c1_2379_3536 373
171 3300050511 nmdc:mga08y16_189924_c1 nmdc:mga08y16_189924_c1_952_2112 373
172 3300050511 nmdc:mga08y16_29842_c1 nmdc:mga08y16_29842_c1_2784_3941 373
173 3300050511 nmdc:mga08y16_84354_c1 nmdc:mga08y16_84354_c1_1106_2311 373
174 3300050512 nmdc:mga0n895_174536_c1 nmdc:mga0n895_174536_c1_775_1980 373
175 3300050513 nmdc:mga0rr50_175503_c1 nmdc:mga0rr50_175503_c1_189_1334 373
176 3300061734 Ga0530510_0079623 Ga0530510_0079623_1079_2248 373
177 3300003322 rootL2_10136754 rootL2_101367545 374
178 3300005366 Ga0070659_100002068 Ga0070659_1000020683 374
179 3300005458 Ga0070681_10002169 Ga0070681_100021697 374
180 3300005530 Ga0070679_100007285 Ga0070679_1000072856 374
181 3300005535 Ga0070684_100331588 Ga0070684_1003315881 374
182 3300005564 Ga0070664_100011106 Ga0070664_1000111065 374
183 3300005577 Ga0068857_100004188 Ga0068857_1000041887 374
184 3300009147 Ga0114129_10062463 Ga0114129_100624634 374
185 3300009177 Ga0105248_10020479 Ga0105248_100204792 374
186 3300013306 Ga0163162_10011194 Ga0163162_100111944 374
187 3300014325 Ga0163163_10011145 Ga0163163_100111455 374
188 3300025912 Ga0207707_10064226 Ga0207707_100642263 374
189 3300025921 Ga0207652_10048043 Ga0207652_100480433 374
190 3300025932 Ga0207690_10016101 Ga0207690_100161013 374
191 3300025941 Ga0207711_10178763 Ga0207711_101787632 374
192 3300026041 Ga0207639_10041008 Ga0207639_100410082 374
193 3300026095 Ga0207676_10023041 Ga0207676_100230413 374
194 3300026116 Ga0207674_10002475 Ga0207674_100024757 374
195 3300005330 Ga0070690_100002306 Ga0070690_1000023065 375
196 3300005353 Ga0070669_100011749 Ga0070669_1000117496 375
197 3300005441 Ga0070700_100030281 Ga0070700_1000302812 375
198 3300005459 Ga0068867_100133089 Ga0068867_1001330891 375
199 3300005544 Ga0070686_100005282 Ga0070686_1000052822 375
200 3300005549 Ga0070704_100008596 Ga0070704_1000085963 375
201 3300005617 Ga0068859_100103696 Ga0068859_1001036962 375
202 3300005719 Ga0068861_100064495 Ga0068861_1000644952 375
203 3300005844 Ga0068862_100020488 Ga0068862_1000204884 375
204 3300005844 Ga0068862_100081308 Ga0068862_1000813082 375
205 3300006931 Ga0097620_100103694 Ga0097620_1001036942 375
206 3300009176 Ga0105242_10257579 Ga0105242_102575791 375
207 3300013297 Ga0157378_10009344 Ga0157378_100093444 375
208 3300014326 Ga0157380_10004575 Ga0157380_100045754 375
209 3300017792 Ga0163161_10165062 Ga0163161_101650621 375
210 3300025923 Ga0207681_10062089 Ga0207681_100620892 375
211 3300025961 Ga0207712_10138289 Ga0207712_101382892 375
212 3300026035 Ga0207703_10274240 Ga0207703_102742402 375
213 3300026075 Ga0207708_10006957 Ga0207708_100069576 375
214 3300026075 Ga0207708_10084678 Ga0207708_100846782 375
215 3300026075 Ga0207708_10168871 Ga0207708_101688712 375
216 3300026089 Ga0207648_10162882 Ga0207648_101628822 375
217 3300026118 Ga0207675_100008722 Ga0207675_1000087223 375
218 3300028380 Ga0268265_10279102 Ga0268265_102791022 375
219 3300037471 Ga0395905_0076222 Ga0395905_0076222_1498_2649 375
220 3300032005 Ga0307411_10070719 Ga0307411_100707191 376
221 3300049656 Ga0501209_035688 Ga0501209_035688_35_1180 376
222 3300049851 Ga0501212_002621 Ga0501212_002621_746_1900 376
223 3300050512 nmdc:mga0n895_250427_c1 nmdc:mga0n895_250427_c1_344_1483 376
224 3300050515 nmdc:mga0a205_76599_c1 nmdc:mga0a205_76599_c1_225_1364 376
225 3300005441 Ga0070700_100000027 Ga0070700_10000002786 377
226 3300005518 Ga0070699_100001536 Ga0070699_1000015369 377
227 3300005578 Ga0068854_100271366 Ga0068854_1002713661 377
228 3300005617 Ga0068859_100005394 Ga0068859_1000053944 377
229 3300006931 Ga0097620_100005394 Ga0097620_1000053944 377
230 3300009101 Ga0105247_10040214 Ga0105247_100402143 377
231 3300009177 Ga0105248_10004476 Ga0105248_100044769 377
232 3300025900 Ga0207710_10093516 Ga0207710_100935162 377
233 3300025941 Ga0207711_10063697 Ga0207711_100636973 377
234 3300026075 Ga0207708_10000055 Ga0207708_1000005521 377
235 3300031548 Ga0307408_100016113 Ga0307408_1000161134 377
236 3300031731 Ga0307405_10006601 Ga0307405_100066012 377
237 3300031824 Ga0307413_10270267 Ga0307413_102702671 377
238 3300031852 Ga0307410_10078166 Ga0307410_100781661 377
239 3300031901 Ga0307406_10013711 Ga0307406_100137115 377
240 3300031903 Ga0307407_10014280 Ga0307407_100142804 377
241 3300032002 Ga0307416_100012440 Ga0307416_1000124403 377
242 3300032004 Ga0307414_10007034 Ga0307414_100070344 377
243 3300032126 Ga0307415_100036316 Ga0307415_1000363161 377
244 3300049649 Ga0501198_003174 Ga0501198_003174_792_1949 377
245 3300049652 Ga0501202_004091 Ga0501202_004091_1052_2209 377
246 3300049654 Ga0501207_000376 Ga0501207_000376_510_1667 377
247 3300049655 Ga0501208_001695 Ga0501208_001695_705_1862 377
248 3300049660 Ga0501216_003279 Ga0501216_003279_180_1337 377
249 3300049661 Ga0501217_002078 Ga0501217_002078_624_1781 377
250 3300049663 Ga0501223_003204 Ga0501223_003204_571_1728 377
251 3300049664 Ga0501224_000823 Ga0501224_000823_2042_3199 377
252 3300049665 Ga0501227_002081 Ga0501227_002081_743_1900 377
253 3300049667 Ga0501230_003973 Ga0501230_003973_582_1739 377
254 3300049668 Ga0501233_003294 Ga0501233_003294_758_1915 377
255 3300049669 Ga0501235_005573 Ga0501235_005573_454_1611 377
256 3300049675 Ga0501243_005375 Ga0501243_005375_376_1533 377
257 3300049704 Ga0501221_001390 Ga0501221_001390_2206_3363 377
258 3300049705 Ga0501225_0001037 Ga0501225_0001037_2868_4025 377
259 3300049706 Ga0501229_002993 Ga0501229_002993_832_1989 377
260 3300049707 Ga0501234_004429 Ga0501234_004429_954_2111 377
261 3300049775 Ga0501279_005402 Ga0501279_005402_356_1513 377
262 3300049853 Ga0501226_000545 Ga0501226_000545_949_2106 377
263 3300005331 Ga0070670_100098866 Ga0070670_1000988662 378
264 3300005841 Ga0068863_100058052 Ga0068863_1000580522 378
265 3300006852 Ga0075433_10061780 Ga0075433_100617802 378
266 3300009147 Ga0114129_10045648 Ga0114129_100456483 378
267 3300025912 Ga0207707_10104394 Ga0207707_101043943 378
268 3300026088 Ga0207641_10112106 Ga0207641_101121062 378
269 3300026095 Ga0207676_10040450 Ga0207676_100404502 378
270 3300045051 Ga0451576_0184166 Ga0451576_0184166_65_1282 378
271 3300050515 nmdc:mga0a205_136508_c1 nmdc:mga0a205_136508_c1_989_2155 378
272 3300002459 JGI24751J29686_10000011 JGI24751J29686_1000001127 379
273 3300005331 Ga0070670_100000559 Ga0070670_1000005598 379
274 3300005331 Ga0070670_100025439 Ga0070670_1000254393 379
275 3300005343 Ga0070687_100071817 Ga0070687_1000718172 379
276 3300005467 Ga0070706_100000001 Ga0070706_10000000172 379
277 3300005985 Ga0081539_10001896 Ga0081539_1000189627 379
278 3300009094 Ga0111539_10019663 Ga0111539_100196633 379
279 3300009177 Ga0105248_10030593 Ga0105248_100305932 379
280 3300009553 Ga0105249_10032088 Ga0105249_100320882 379
281 3300013306 Ga0163162_10057415 Ga0163162_100574152 379
282 3300014325 Ga0163163_10000278 Ga0163163_100002788 379
283 3300014326 Ga0157380_10297299 Ga0157380_102972991 379
284 3300025925 Ga0207650_10000001 Ga0207650_10000001756 379
285 3300025941 Ga0207711_10020270 Ga0207711_100202705 379
286 3300025961 Ga0207712_10011534 Ga0207712_100115344 379
287 3300027907 Ga0207428_10029696 Ga0207428_100296964 379
288 3300035091 Ga0373951_0003590 Ga0373951_0003590_1549_2760 379
289 3300050511 nmdc:mga08y16_21755_c1 nmdc:mga08y16_21755_c1_2597_3817 379

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

251

391

0.88

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

72

200

0.87

PF16912

Glu_dehyd_C

Glucose dehydrogenase C-terminus

205

430

0.64

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ilk-assembly1.cif.gz_A crystal structure of short chain alcohol dehydrogenase (rspb) from e. coli cft073 (efi target efi-506413) complexed with cofactor nadh 0.8812 1 372
1llu-assembly1.cif.gz_A the ternary complex of pseudomonas aeruginosa alcohol dehydrogenase with its coenzyme and weak substrate 0.8763 1 372
6n7l-assembly3.cif.gz_K crystal structure of an alcohol dehydrogenase from elizabethkingia anophelis nuhp1 0.8746 1 372
7kc2-assembly1.cif.gz_A symmetry in yeast alcohol dehydrogenase 1 -closed form with nadh 0.8728 2 372
5env-assembly1.cif.gz_A yeast alcohol dehydrogenase with bound coenzyme 0.8692 2 372
ID Description Score Start End Superfamily
af_P39400_4_147_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9314 1 163 3.90.180.10
af_P39400_4_147_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9253 1 163 3.90.180.10
4ilkB01 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9212 1 372 3.90.180.10
af_P38105_1_147_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9203 1 163 3.90.180.10
5vm2B01 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9148 2 373 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A7C7YQE3-F1-model_v4 Alcohol dehydrogenase-like N-terminal domain-containing protein 0.9396 1 268 GO:0008270
GO:0016491
AF-A0A2D5M915-F1-model_v4 deleted 0.9376 1 375
AF-A0A7Z9UWM0-F1-model_v4 Alcohol dehydrogenase-like C-terminal domain-containing protein 0.9341 161 379 GO:0016491
AF-A0A353FIF5-F1-model_v4 Alcohol dehydrogenase 0.9306 2 372 GO:0008270
GO:0016491
AF-A0A2D5M915-F1-model_v4 deleted 0.9257 1 375

Feature Viewer

pLDDT pTM Quality
91.24 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map