F389173

General Info

Members Datasets Scaffolds Average Seq Length
289 215 578 267

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10021215|Ga0105237_100212151
Length 308
Sequence VYPARAIRHRFAVLNASKVAPGKRAALQHAFQGKKQMTRTLTMLAAGVGLVASLVAPAQAAPEVSLARFDCGTPQAPTAVNQRFSDTFAYGDLKIQFVFSCYLIKHDGDYMLWDTGHAMTAPNVAPKVSLVDYLAKIEVKPEQIKYIGISHYHADHTGQIASFPQATLLIGSREWDAISSPKPAEGVNFKPFESWIKGDSKVEPQPIDKDVFGDGTVIMLRTPGHTPGHSSLLVKLPEMGAVILTGDAVHFHENYDSDGVPAFNYDRAQTVASIERIKKIASSLKATVIIQHDARDVDKLPVFPAFAK

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
82 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
130 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
131 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
132 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
135 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
136 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
137 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
138 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
139 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
141 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
145 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
146 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
151 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
152 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
153 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
154 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
155 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
156 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
157 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
158 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
159 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
160 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
161 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
162 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
163 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
164 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
165 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
166 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
167 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
168 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
169 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
185 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
186 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
191 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
192 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
193 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
194 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
201 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
202 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
203 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
204 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
205 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
206 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
207 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
208 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
209 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
210 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
211 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
212 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
213 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
214 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
215 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.3
Nodule 0
Rhizoplane 6.57
Rhizosphere 81.31
Stem 0
Stem Tuber 0
Unclassified 5.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10021215 3300009545 Bacteria 6681
2 Ga0065712_10150429 3300005290 Unclassified 1374
3 Ga0065715_10161611 3300005293 Bacteria 1624
4 Ga0065707_10128727 3300005295 Bacteria 1948
5 Ga0070683_100129518 3300005329 Bacteria 2387
6 Ga0070690_100057930 3300005330 Bacteria 2487
7 Ga0070670_100247916 3300005331 Bacteria 1551
8 Ga0070680_100119307 3300005336 Bacteria 2201
9 Ga0070680_100350643 3300005336 Bacteria 1255
10 Ga0070682_100157268 3300005337 Bacteria 1566
11 Ga0068868_100014243 3300005338 Bacteria 5857
12 Ga0070660_100053002 3300005339 Bacteria 3128
13 Ga0070689_100002925 3300005340 Bacteria 11223
14 Ga0070687_100028027 3300005343 Bacteria 2727
15 Ga0070661_100073095 3300005344 Bacteria 2524
16 Ga0070661_100179396 3300005344 Bacteria 1611
17 Ga0070692_10092639 3300005345 Bacteria 1645
18 Ga0070668_100008601 3300005347 Bacteria 7582
19 Ga0070669_100677689 3300005353 Bacteria 869
20 Ga0070671_100060141 3300005355 Unclassified 3163
21 Ga0070671_100085875 3300005355 Bacteria 2632
22 Ga0070674_100051106 3300005356 Bacteria 2847
23 Ga0070674_100123496 3300005356 Bacteria 1920
24 Ga0070673_100059164 3300005364 Bacteria 3032
25 Ga0070659_100066166 3300005366 Bacteria 2863
26 Ga0070667_100324612 3300005367 Bacteria 1389
27 Ga0070703_10147757 3300005406 Bacteria 880
28 Ga0070709_10447469 3300005434 Bacteria 972
29 Ga0070710_10072901 3300005437 Bacteria 1984
30 Ga0070701_10125982 3300005438 Bacteria 1449
31 Ga0070705_100207620 3300005440 Unclassified 1348
32 Ga0070700_100136110 3300005441 Bacteria 1663
33 Ga0070694_100027696 3300005444 Bacteria 3683
34 Ga0070694_100357582 3300005444 Bacteria 1133
35 Ga0070662_100031915 3300005457 Bacteria 3700
36 Ga0070681_10024677 3300005458 Bacteria 6050
37 Ga0070681_10036784 3300005458 Bacteria 4915
38 Ga0070681_10152110 3300005458 Bacteria 2240
39 Ga0070706_100363299 3300005467 Bacteria 1349
40 Ga0070698_100031439 3300005471 Bacteria 5503
41 Ga0070679_100196168 3300005530 Bacteria 1986
42 Ga0070679_100581819 3300005530 Bacteria 1063
43 Ga0068853_100013191 3300005539 Bacteria 6744
44 Ga0068853_100514583 3300005539 Bacteria 1131
45 Ga0070672_100010871 3300005543 Bacteria 6329
46 Ga0070672_100193436 3300005543 Unclassified 1699
47 Ga0070695_100109883 3300005545 Bacteria 1869
48 Ga0070665_100135853 3300005548 Bacteria 2462
49 Ga0070665_100145856 3300005548 Bacteria 2370
50 Ga0070704_100120825 3300005549 Bacteria 2012
51 Ga0070704_100190939 3300005549 Bacteria 1646
52 Ga0068855_100184377 3300005563 Bacteria 2358
53 Ga0068855_100516383 3300005563 Bacteria 1296
54 Ga0068855_100664573 3300005563 Bacteria 1118
55 Ga0070664_100064445 3300005564 Bacteria 3125
56 Ga0068857_100041945 3300005577 Bacteria 4057
57 Ga0068856_100000985 3300005614 Bacteria 30399
58 Ga0068859_100794733 3300005617 Bacteria 1034
59 Ga0068864_100014161 3300005618 Bacteria 6619
60 Ga0068863_100018425 3300005841 Bacteria 6681
61 Ga0068863_100075096 3300005841 Unclassified 3198
62 Ga0068858_100300093 3300005842 Bacteria 1532
63 Ga0068858_100385179 3300005842 Bacteria 1346
64 Ga0068860_100201251 3300005843 Bacteria 1930
65 Ga0081540_1010465 3300005983 Bacteria 6275
66 Ga0070717_10525240 3300006028 Bacteria 1071
67 Ga0070712_100015239 3300006175 Bacteria 4944
68 Ga0070712_100068891 3300006175 Bacteria 2522
69 Ga0070712_100113168 3300006175 Bacteria 2029
70 Ga0075367_10150316 3300006178 Bacteria 1445
71 Ga0075366_10000856 3300006195 Bacteria 14683
72 Ga0097621_100221207 3300006237 Bacteria 1650
73 Ga0075370_10001184 3300006353 Bacteria 10978
74 Ga0068871_100136888 3300006358 Bacteria 2080
75 Ga0075433_10021275 3300006852 Bacteria 5439
76 Ga0075434_100029628 3300006871 Bacteria 5387
77 Ga0075434_100233610 3300006871 Bacteria 1858
78 Ga0068865_100015850 3300006881 Bacteria 4811
79 Ga0068865_100017213 3300006881 Bacteria 4645
80 Ga0097620_100794735 3300006931 Bacteria 1034
81 Ga0111539_10298620 3300009094 Bacteria 1875
82 Ga0111539_10483328 3300009094 Bacteria 1442
83 Ga0105245_10008473 3300009098 Bacteria 8974
84 Ga0105245_10118453 3300009098 Bacteria 2471
85 Ga0105245_10654982 3300009098 Bacteria 1081
86 Ga0105247_10076560 3300009101 Bacteria 2101
87 Ga0114129_10177422 3300009147 Bacteria 2901
88 Ga0105243_10899943 3300009148 Bacteria 880
89 Ga0105241_10437742 3300009174 Unclassified 1154
90 Ga0105242_10011481 3300009176 Bacteria 6810
91 Ga0105242_10158943 3300009176 Bacteria 1976
92 Ga0105242_10206922 3300009176 Bacteria 1746
93 Ga0105248_10034156 3300009177 Bacteria 5686
94 Ga0105248_10324277 3300009177 Bacteria 1735
95 Ga0105237_10008217 3300009545 Bacteria 11334
96 Ga0105237_10112062 3300009545 Bacteria 2720
97 Ga0105237_10143368 3300009545 Bacteria 2383
98 Ga0105238_10019087 3300009551 Bacteria 6985
99 Ga0105249_10307816 3300009553 Bacteria 1591
100 Ga0105239_10009421 3300010375 Bacteria 11009
101 Ga0105239_10060239 3300010375 Bacteria 4166
102 Ga0105239_10064415 3300010375 Bacteria 4024
103 Ga0105239_10454428 3300010375 Bacteria 1453
104 Ga0157374_10062548 3300013296 Bacteria 3489
105 Ga0157374_10499669 3300013296 Bacteria 1221
106 Ga0163162_10123363 3300013306 Bacteria 2696
107 Ga0163162_10159559 3300013306 Bacteria 2377
108 Ga0157375_10004608 3300013308 Bacteria 11984
109 Ga0157375_10021443 3300013308 Bacteria 5925
110 Ga0157375_10056667 3300013308 Bacteria 3871
111 Ga0157380_10176240 3300014326 Bacteria 1874
112 Ga0157380_10304503 3300014326 Bacteria 1470
113 Ga0182008_10009490 3300014497 Bacteria 5247
114 Ga0157379_10012985 3300014968 Bacteria 7289
115 Ga0157376_10065607 3300014969 Bacteria 3066
116 Ga0157376_10363934 3300014969 Bacteria 1388
117 Ga0163161_10073631 3300017792 Bacteria 2503
118 Ga0213876_10051131 3300021384 Bacteria 2184
119 Ga0209758_1012076 3300025297 Bacteria 4892
120 Ga0207697_10014350 3300025315 Bacteria 3286
121 Ga0207692_10054363 3300025898 Bacteria 2044
122 Ga0207688_10050847 3300025901 Bacteria 2321
123 Ga0207645_10000486 3300025907 Bacteria 32903
124 Ga0207705_10113378 3300025909 Bacteria 2005
125 Ga0207684_10052490 3300025910 Bacteria 3460
126 Ga0207684_10218354 3300025910 Bacteria 1645
127 Ga0207707_10004346 3300025912 Bacteria 12541
128 Ga0207707_10074223 3300025912 Bacteria 2966
129 Ga0207707_10123059 3300025912 Bacteria 2268
130 Ga0207695_10246064 3300025913 Bacteria 1688
131 Ga0207671_10191980 3300025914 Bacteria 1593
132 Ga0207671_10331725 3300025914 Bacteria 1205
133 Ga0207693_10007315 3300025915 Bacteria 9082
134 Ga0207693_10132880 3300025915 Bacteria 1956
135 Ga0207693_10149427 3300025915 Bacteria 1837
136 Ga0207663_10170001 3300025916 Bacteria 1547
137 Ga0207660_10036962 3300025917 Bacteria 3398
138 Ga0207662_10023296 3300025918 Bacteria 3557
139 Ga0207657_10015433 3300025919 Bacteria 7400
140 Ga0207652_10091077 3300025921 Bacteria 2681
141 Ga0207650_10148471 3300025925 Bacteria 1848
142 Ga0207659_10331713 3300025926 Bacteria 1258
143 Ga0207687_10081320 3300025927 Bacteria 2341
144 Ga0207690_10134261 3300025932 Bacteria 1815
145 Ga0207706_10001751 3300025933 Bacteria 21308
146 Ga0207706_10049251 3300025933 Bacteria 3724
147 Ga0207709_10103453 3300025935 Bacteria 1888
148 Ga0207669_10048086 3300025937 Bacteria 2532
149 Ga0207704_10041170 3300025938 Bacteria 2707
150 Ga0207691_10003087 3300025940 Bacteria 16245
151 Ga0207711_10397516 3300025941 Bacteria 1280
152 Ga0207689_10006991 3300025942 Bacteria 9918
153 Ga0207661_10073763 3300025944 Bacteria 2796
154 Ga0207679_10042150 3300025945 Bacteria 3278
155 Ga0207679_10448235 3300025945 Unclassified 1144
156 Ga0207667_10403070 3300025949 Bacteria 1392
157 Ga0207651_10065464 3300025960 Bacteria 2549
158 Ga0207712_10030302 3300025961 Bacteria 3636
159 Ga0207640_10020826 3300025981 Bacteria 3898
160 Ga0207703_10059871 3300026035 Bacteria 3111
161 Ga0207703_10617043 3300026035 Unclassified 1027
162 Ga0207703_10632922 3300026035 Bacteria 1014
163 Ga0207639_10412472 3300026041 Bacteria 1219
164 Ga0207678_10198451 3300026067 Bacteria 1715
165 Ga0207708_10005058 3300026075 Bacteria 9729
166 Ga0207702_10000101 3300026078 Bacteria 99845
167 Ga0207641_10314486 3300026088 Unclassified 1483
168 Ga0207676_10042479 3300026095 Bacteria 3497
169 Ga0207674_10048949 3300026116 Bacteria 4324
170 Ga0207674_10225767 3300026116 Bacteria 1821
171 Ga0207675_100003312 3300026118 Bacteria 15761
172 Ga0207683_10045885 3300026121 Bacteria 3822
173 Ga0207698_10030806 3300026142 Bacteria 3864
174 Ga0268266_10068786 3300028379 Bacteria 3067
175 Ga0268264_10023944 3300028381 Bacteria 4981
176 Ga0268264_10045789 3300028381 Bacteria 3633
177 Ga0265318_10025483 3300028577 Bacteria 2335
178 Ga0265338_10005067 3300028800 Bacteria 17389
179 Ga0265340_10050791 3300031247 Unclassified 2010
180 Ga0265331_10038941 3300031250 Bacteria 2321
181 Ga0307513_10024650 3300031456 Bacteria 6994
182 Ga0307513_10180907 3300031456 Bacteria 1972
183 Ga0307513_10200632 3300031456 Bacteria 1836
184 Ga0265313_10039231 3300031595 Bacteria 2351
185 Ga0307405_10173701 3300031731 Bacteria 1540
186 Ga0373929_0034120 3300035085 Bacteria 1102
187 Ga0373945_0001995 3300035116 Bacteria 6339
188 Ga0373943_0004342 3300035170 Bacteria 6432
189 Ga0373946_0001419 3300035171 Bacteria 8314
190 Ga0373931_0042299 3300035691 Bacteria 2395
191 Ga0373935_0046913 3300035692 Bacteria 2730
192 Ga0373933_0133429 3300035724 Bacteria 1563
193 Ga0373947_0005623 3300035725 Bacteria 7310
194 Ga0373925_0011072 3300037068 Bacteria 6551
195 Ga0373925_0238193 3300037068 Bacteria 1457
196 Ga0436365_0287696 3300039437 Bacteria 6976
197 Ga0436360_0053169 3300039438 Bacteria 1992
198 Ga0436361_0293828 3300039447 Bacteria 2415
199 Ga0436361_0400154 3300039447 Bacteria 1424
200 Ga0436361_0416739 3300039447 Bacteria 2734
201 Ga0436363_0675361 3300039450 Bacteria 1536
202 Ga0466963_0241063 3300044694 Bacteria 1268
203 Ga0495638_0009468 3300046460 Bacteria 6833
204 Ga0495638_0154331 3300046460 Bacteria 1330
205 Ga0495638_0208197 3300046460 Bacteria 1100
206 Ga0495651_0134347 3300046462 Bacteria 1802
207 Ga0495582_0021702 3300046473 Bacteria 3514
208 Ga0495585_0127363 3300046492 Bacteria 1343
209 Ga0495594_0209211 3300046499 Bacteria 1112
210 Ga0495608_0145959 3300046511 Unclassified 1509
211 Ga0495632_0046779 3300046519 Bacteria 2149
212 Ga0495652_0190800 3300046529 Unclassified 1564
213 Ga0495654_0056590 3300046530 Bacteria 1895
214 Ga0495587_0102293 3300046536 Bacteria 1650
215 Ga0495597_0091474 3300046542 Bacteria 1291
216 Ga0495656_0111316 3300046615 Bacteria 1281
217 Ga0495668_0043173 3300046616 Bacteria 2509
218 Ga0495657_0235126 3300046675 Unclassified 1107
219 Ga0495647_0027462 3300046681 Bacteria 2092
220 Ga0495658_0098806 3300046683 Bacteria 1739
221 Ga0495658_0261424 3300046683 Bacteria 1090
222 Ga0495624_0017639 3300046690 Bacteria 4786
223 Ga0495649_0004202 3300046694 Bacteria 9450
224 Ga0495680_0157536 3300047322 Bacteria 1651
225 Ga0495687_008112 3300047443 Bacteria 6061
226 Ga0495675_0166336 3300047444 Unclassified 1356
227 Ga0495673_0177320 3300047469 Bacteria 809
228 Ga0496100_0213828 3300048903 Bacteria 1412
229 Ga0496101_0130221 3300048904 Bacteria 1910
230 Ga0496102_0465541 3300048905 Bacteria 1185
231 Ga0496103_0334266 3300048906 Unclassified 974
232 Ga0496104_0247234 3300048907 Bacteria 1696
233 Ga0496105_0114784 3300048908 Bacteria 2222
234 Ga0496105_0256118 3300048908 Bacteria 1417
235 Ga0496106_0005142 3300048909 Bacteria 9697
236 Ga0496107_0044003 3300048910 Bacteria 3209
237 Ga0496107_0170503 3300048910 Bacteria 1615
238 Ga0496107_0412462 3300048910 Bacteria 1004
239 Ga0496108_0134871 3300048911 Bacteria 2123
240 Ga0496108_0430760 3300048911 Bacteria 1152
241 Ga0496109_0534553 3300048912 Bacteria 1106
242 Ga0496110_0029199 3300048913 Bacteria 4743
243 Ga0496110_0480176 3300048913 Bacteria 1132
244 Ga0496112_0136146 3300048915 Bacteria 2426
245 Ga0496113_0290231 3300048916 Bacteria 1308
246 Ga0496114_0089906 3300048917 Bacteria 2606
247 Ga0496117_0076934 3300048920 Bacteria 2210
248 Ga0496121_0004775 3300048924 Bacteria 17874
249 Ga0496126_0008695 3300048929 Bacteria 10903
250 Ga0496126_0039225 3300048929 Bacteria 4397
251 Ga0496126_0484886 3300048929 Unclassified 990
252 Ga0501047_0411594 3300049581 Bacteria 1184
253 Ga0501070_0027993 3300049586 Bacteria 4727
254 Ga0501080_0072157 3300049742 Bacteria 3212
255 Ga0501080_0379048 3300049742 Bacteria 1275
256 Ga0501044_0029209 3300049823 Bacteria 5815
257 nmdc:mga03683_188021_c1 3300050489 Bacteria 944
258 nmdc:mga0k408_1112_c1 3300050493 Bacteria 14734
259 nmdc:mga0k408_86921_c1 3300050493 Bacteria 1836
260 nmdc:mga06z11_123812_c1 3300050494 Bacteria 1445
261 nmdc:mga07m45_7757_c1 3300050496 Bacteria 5493
262 nmdc:mga05p37_443387_c1 3300050507 Bacteria 1505
263 nmdc:mga08y16_268552_c1 3300050511 Bacteria 1761
264 nmdc:mga08y16_436240_c1 3300050511 Bacteria 1337
265 nmdc:mga0n895_27338_c1 3300050512 Bacteria 5418
266 nmdc:mga0n895_304712_c1 3300050512 Bacteria 1615
267 nmdc:mga0rr50_60390_c1 3300050513 Bacteria 2851
268 nmdc:mga0a205_205663_c1 3300050515 Bacteria 1858
269 Ga0495601_0059751 3300053077 Bacteria 2418
270 Ga0495601_0216881 3300053077 Bacteria 1250
271 Ga0495601_0376098 3300053077 Bacteria 922
272 Ga0495595_0006707 3300053084 Bacteria 4698
273 Ga0495619_0037802 3300053085 Bacteria 3148
274 Ga0495619_0246655 3300053085 Unclassified 1237
275 Ga0500578_0047114 3300053086 Bacteria 2766
276 Ga0500643_001835 3300053087 Bacteria 11617
277 Ga0500644_0000602 3300053088 Bacteria 13665
278 Ga0500651_0021722 3300053093 Bacteria 4003
279 Ga0500651_0077795 3300053093 Bacteria 2058
280 Ga0500566_0186302 3300053094 Bacteria 1060
281 Ga0500641_0034656 3300053096 Bacteria 2011
282 Ga0500595_000006 3300053119 Bacteria 300857
283 Ga0500595_003790 3300053119 Bacteria 6954
284 Ga0500642_0002354 3300053130 Bacteria 5533
285 Ga0500658_0005391 3300053134 Bacteria 4757
286 Ga0500568_0097933 3300053139 Bacteria 1102
287 Ga0500604_0011616 3300053151 Bacteria 2368
288 Ga0500616_0000001 3300053153 Bacteria 1986011
289 Ga0500645_000106 3300053730 Bacteria 67066
290 Ga0105237_10021215
291 Ga0065712_10150429
292 Ga0065715_10161611
293 Ga0065707_10128727
294 Ga0070683_100129518
295 Ga0070690_100057930
296 Ga0070670_100247916
297 Ga0070680_100119307
298 Ga0070680_100350643
299 Ga0070682_100157268
300 Ga0068868_100014243
301 Ga0070660_100053002
302 Ga0070689_100002925
303 Ga0070687_100028027
304 Ga0070661_100073095
305 Ga0070661_100179396
306 Ga0070692_10092639
307 Ga0070668_100008601
308 Ga0070669_100677689
309 Ga0070671_100060141
310 Ga0070671_100085875
311 Ga0070674_100051106
312 Ga0070674_100123496
313 Ga0070673_100059164
314 Ga0070659_100066166
315 Ga0070667_100324612
316 Ga0070703_10147757
317 Ga0070709_10447469
318 Ga0070710_10072901
319 Ga0070701_10125982
320 Ga0070705_100207620
321 Ga0070700_100136110
322 Ga0070694_100027696
323 Ga0070694_100357582
324 Ga0070662_100031915
325 Ga0070681_10024677
326 Ga0070681_10036784
327 Ga0070681_10152110
328 Ga0070706_100363299
329 Ga0070698_100031439
330 Ga0070679_100196168
331 Ga0070679_100581819
332 Ga0068853_100013191
333 Ga0068853_100514583
334 Ga0070672_100010871
335 Ga0070672_100193436
336 Ga0070695_100109883
337 Ga0070665_100135853
338 Ga0070665_100145856
339 Ga0070704_100120825
340 Ga0070704_100190939
341 Ga0068855_100184377
342 Ga0068855_100516383
343 Ga0068855_100664573
344 Ga0070664_100064445
345 Ga0068857_100041945
346 Ga0068856_100000985
347 Ga0068859_100794733
348 Ga0068864_100014161
349 Ga0068863_100018425
350 Ga0068863_100075096
351 Ga0068858_100300093
352 Ga0068858_100385179
353 Ga0068860_100201251
354 Ga0081540_1010465
355 Ga0070717_10525240
356 Ga0070712_100015239
357 Ga0070712_100068891
358 Ga0070712_100113168
359 Ga0075367_10150316
360 Ga0075366_10000856
361 Ga0097621_100221207
362 Ga0075370_10001184
363 Ga0068871_100136888
364 Ga0075433_10021275
365 Ga0075434_100029628
366 Ga0075434_100233610
367 Ga0068865_100015850
368 Ga0068865_100017213
369 Ga0097620_100794735
370 Ga0111539_10298620
371 Ga0111539_10483328
372 Ga0105245_10008473
373 Ga0105245_10118453
374 Ga0105245_10654982
375 Ga0105247_10076560
376 Ga0114129_10177422
377 Ga0105243_10899943
378 Ga0105241_10437742
379 Ga0105242_10011481
380 Ga0105242_10158943
381 Ga0105242_10206922
382 Ga0105248_10034156
383 Ga0105248_10324277
384 Ga0105237_10008217
385 Ga0105237_10112062
386 Ga0105237_10143368
387 Ga0105238_10019087
388 Ga0105249_10307816
389 Ga0105239_10009421
390 Ga0105239_10060239
391 Ga0105239_10064415
392 Ga0105239_10454428
393 Ga0157374_10062548
394 Ga0157374_10499669
395 Ga0163162_10123363
396 Ga0163162_10159559
397 Ga0157375_10004608
398 Ga0157375_10021443
399 Ga0157375_10056667
400 Ga0157380_10176240
401 Ga0157380_10304503
402 Ga0182008_10009490
403 Ga0157379_10012985
404 Ga0157376_10065607
405 Ga0157376_10363934
406 Ga0163161_10073631
407 Ga0213876_10051131
408 Ga0209758_1012076
409 Ga0207697_10014350
410 Ga0207692_10054363
411 Ga0207688_10050847
412 Ga0207645_10000486
413 Ga0207705_10113378
414 Ga0207684_10052490
415 Ga0207684_10218354
416 Ga0207707_10004346
417 Ga0207707_10074223
418 Ga0207707_10123059
419 Ga0207695_10246064
420 Ga0207671_10191980
421 Ga0207671_10331725
422 Ga0207693_10007315
423 Ga0207693_10132880
424 Ga0207693_10149427
425 Ga0207663_10170001
426 Ga0207660_10036962
427 Ga0207662_10023296
428 Ga0207657_10015433
429 Ga0207652_10091077
430 Ga0207650_10148471
431 Ga0207659_10331713
432 Ga0207687_10081320
433 Ga0207690_10134261
434 Ga0207706_10001751
435 Ga0207706_10049251
436 Ga0207709_10103453
437 Ga0207669_10048086
438 Ga0207704_10041170
439 Ga0207691_10003087
440 Ga0207711_10397516
441 Ga0207689_10006991
442 Ga0207661_10073763
443 Ga0207679_10042150
444 Ga0207679_10448235
445 Ga0207667_10403070
446 Ga0207651_10065464
447 Ga0207712_10030302
448 Ga0207640_10020826
449 Ga0207703_10059871
450 Ga0207703_10617043
451 Ga0207703_10632922
452 Ga0207639_10412472
453 Ga0207678_10198451
454 Ga0207708_10005058
455 Ga0207702_10000101
456 Ga0207641_10314486
457 Ga0207676_10042479
458 Ga0207674_10048949
459 Ga0207674_10225767
460 Ga0207675_100003312
461 Ga0207683_10045885
462 Ga0207698_10030806
463 Ga0268266_10068786
464 Ga0268264_10023944
465 Ga0268264_10045789
466 Ga0265318_10025483
467 Ga0265338_10005067
468 Ga0265340_10050791
469 Ga0265331_10038941
470 Ga0307513_10024650
471 Ga0307513_10180907
472 Ga0307513_10200632
473 Ga0265313_10039231
474 Ga0307405_10173701
475 Ga0373929_0034120
476 Ga0373945_0001995
477 Ga0373943_0004342
478 Ga0373946_0001419
479 Ga0373931_0042299
480 Ga0373935_0046913
481 Ga0373933_0133429
482 Ga0373947_0005623
483 Ga0373925_0011072
484 Ga0373925_0238193
485 Ga0436365_0287696
486 Ga0436360_0053169
487 Ga0436361_0293828
488 Ga0436361_0400154
489 Ga0436361_0416739
490 Ga0436363_0675361
491 Ga0466963_0241063
492 Ga0495638_0009468
493 Ga0495638_0154331
494 Ga0495638_0208197
495 Ga0495651_0134347
496 Ga0495582_0021702
497 Ga0495585_0127363
498 Ga0495594_0209211
499 Ga0495608_0145959
500 Ga0495632_0046779
501 Ga0495652_0190800
502 Ga0495654_0056590
503 Ga0495587_0102293
504 Ga0495597_0091474
505 Ga0495656_0111316
506 Ga0495668_0043173
507 Ga0495657_0235126
508 Ga0495647_0027462
509 Ga0495658_0098806
510 Ga0495658_0261424
511 Ga0495624_0017639
512 Ga0495649_0004202
513 Ga0495680_0157536
514 Ga0495687_008112
515 Ga0495675_0166336
516 Ga0495673_0177320
517 Ga0496100_0213828
518 Ga0496101_0130221
519 Ga0496102_0465541
520 Ga0496103_0334266
521 Ga0496104_0247234
522 Ga0496105_0114784
523 Ga0496105_0256118
524 Ga0496106_0005142
525 Ga0496107_0044003
526 Ga0496107_0170503
527 Ga0496107_0412462
528 Ga0496108_0134871
529 Ga0496108_0430760
530 Ga0496109_0534553
531 Ga0496110_0029199
532 Ga0496110_0480176
533 Ga0496112_0136146
534 Ga0496113_0290231
535 Ga0496114_0089906
536 Ga0496117_0076934
537 Ga0496121_0004775
538 Ga0496126_0008695
539 Ga0496126_0039225
540 Ga0496126_0484886
541 Ga0501047_0411594
542 Ga0501070_0027993
543 Ga0501080_0072157
544 Ga0501080_0379048
545 Ga0501044_0029209
546 nmdc:mga03683_188021_c1
547 nmdc:mga0k408_1112_c1
548 nmdc:mga0k408_86921_c1
549 nmdc:mga06z11_123812_c1
550 nmdc:mga07m45_7757_c1
551 nmdc:mga05p37_443387_c1
552 nmdc:mga08y16_268552_c1
553 nmdc:mga08y16_436240_c1
554 nmdc:mga0n895_27338_c1
555 nmdc:mga0n895_304712_c1
556 nmdc:mga0rr50_60390_c1
557 nmdc:mga0a205_205663_c1
558 Ga0495601_0059751
559 Ga0495601_0216881
560 Ga0495601_0376098
561 Ga0495595_0006707
562 Ga0495619_0037802
563 Ga0495619_0246655
564 Ga0500578_0047114
565 Ga0500643_001835
566 Ga0500644_0000602
567 Ga0500651_0021722
568 Ga0500651_0077795
569 Ga0500566_0186302
570 Ga0500641_0034656
571 Ga0500595_000006
572 Ga0500595_003790
573 Ga0500642_0002354
574 Ga0500658_0005391
575 Ga0500568_0097933
576 Ga0500604_0011616
577 Ga0500616_0000001
578 Ga0500645_000106

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

98

292

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2br6-assembly1.cif.gz_A crystal structure of quorum-quenching n-acyl homoserine lactone lactonase 0.8677 26 268
2btn-assembly1.cif.gz_A crystal structure and catalytic mechanism of the quorum-quenching n- acyl homoserine lactone hydrolase 0.8645 26 268
2br6-assembly1.cif.gz_A crystal structure of quorum-quenching n-acyl homoserine lactone lactonase 0.8412 26 268
2r2d-assembly1.cif.gz_A structure of a quorum-quenching lactonase (aiib) from agrobacterium tumefaciens 0.8395 28 266
6n9i-assembly2.cif.gz_B structure of the quorum quenching lactonase from parageobacillus caldoxylosilyticus - free 0.8394 27 266
ID Description Score Start End Superfamily
3aj0A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8363 27 266 3.60.15.10
2r2dE00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8351 27 264 3.60.15.10
6n9qD00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8319 26 266 3.60.15.10
af_Q11123_1_182_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8099 63 256 3.60.15.10
5ehtA01 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7944 22 259 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A537A8F8-F1-model_v4 MBL fold metallo-hydrolase 0.9895 104 268 GO:0016787
AF-A0A3B0T689-F1-model_v4 MBL-fold metallo-hydrolase superfamily 0.9719 167 268 GO:0016787
AF-A0A537BIS2-F1-model_v4 N-acyl homoserine lactonase family protein 0.9645 22 268
AF-A0A537A8F8-F1-model_v4 MBL fold metallo-hydrolase 0.9606 104 268 GO:0016787
AF-A0A2N7SB80-F1-model_v4 deleted 0.9452 174 269

Map