F389151

General Info

Members Datasets Scaffolds Average Seq Length
289 165 578 164

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10008003|Ga0105247_100080031
Length 188
Sequence MRAARXXXXPPDDARIDVRDRCPVEPVSETPTEALDYAVLSLAYGAALAGLASQARRREPIPAQDLVPLSAATFALSKLVVHEKVETWLRRPFVEERVDGTRPKGRRLRYAIGELLSCTRCIGAWSALGLVGLRTASPSVSRTVTTVLAVSAAGDFLQSSFTLLCNRANAERRRAEAPGPALEPQRTR

Samples

Sample ID Description Type Environment
1 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
111 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
112 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
113 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
114 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
115 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
116 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
117 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
118 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
119 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
122 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
123 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
124 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
125 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
126 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
127 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
146 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
147 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
148 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
149 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
152 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
153 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
154 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
155 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
156 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
157 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
164 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
165 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.31
Metatranscriptomes 0.69
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.69
Nodule 0
Rhizoplane 5.19
Rhizosphere 93.08
Stem 0
Stem Tuber 0
Unclassified 21.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105247_10008003 3300009101 Bacteria 6459
2 JGI25406J46586_10019723 3300003203 Bacteria 2739
3 JGI25407J50210_10028311 3300003373 Unclassified 1454
4 Ga0070683_100068161 3300005329 Bacteria 3315
5 Ga0070683_100092064 3300005329 Bacteria 2847
6 Ga0070683_100359286 3300005329 Bacteria 1387
7 Ga0070683_100758414 3300005329 Unclassified 930
8 Ga0070690_101273760 3300005330 Unclassified 588
9 Ga0068869_100083830 3300005334 Bacteria 2385
10 Ga0070680_100428378 3300005336 Unclassified 1129
11 Ga0070682_100050197 3300005337 Bacteria 2604
12 Ga0068868_100014918 3300005338 Bacteria 5736
13 Ga0068868_101004251 3300005338 Bacteria 763
14 Ga0070660_100285915 3300005339 Bacteria 1350
15 Ga0070691_10394721 3300005341 Bacteria 778
16 Ga0070687_100126011 3300005343 Bacteria 1472
17 Ga0070661_101161252 3300005344 Bacteria 645
18 Ga0070692_10141986 3300005345 Bacteria 1360
19 Ga0070692_10371592 3300005345 Unclassified 894
20 Ga0070692_10451624 3300005345 Bacteria 823
21 Ga0070671_100797711 3300005355 Bacteria 822
22 Ga0070674_100210350 3300005356 Bacteria 1507
23 Ga0070674_101540647 3300005356 Bacteria 598
24 Ga0070673_100170362 3300005364 Bacteria 1858
25 Ga0070673_101521994 3300005364 Bacteria 631
26 Ga0070688_100429668 3300005365 Bacteria 983
27 Ga0070659_100043655 3300005366 Bacteria 3506
28 Ga0070659_100232700 3300005366 Bacteria 1523
29 Ga0070659_100364830 3300005366 Bacteria 1214
30 Ga0070659_100546119 3300005366 Bacteria 992
31 Ga0070701_10040805 3300005438 Bacteria 2361
32 Ga0070700_100003774 3300005441 Bacteria 7842
33 Ga0070700_100347726 3300005441 Bacteria 1098
34 Ga0070700_101701568 3300005441 Unclassified 541
35 Ga0070678_100354605 3300005456 Bacteria 1262
36 Ga0070678_100868000 3300005456 Bacteria 823
37 Ga0070681_10227615 3300005458 Bacteria 1779
38 Ga0070681_10505504 3300005458 Bacteria 1122
39 Ga0068867_100556935 3300005459 Bacteria 994
40 Ga0068867_101421936 3300005459 Unclassified 644
41 Ga0070684_100386058 3300005535 Bacteria 1290
42 Ga0070684_100442772 3300005535 Bacteria 1200
43 Ga0070684_101217758 3300005535 Unclassified 708
44 Ga0070672_100620353 3300005543 Bacteria 943
45 Ga0070665_101024935 3300005548 Unclassified 837
46 Ga0070664_100182018 3300005564 Bacteria 1868
47 Ga0070664_100300064 3300005564 Unclassified 1451
48 Ga0068857_101825943 3300005577 Unclassified 595
49 Ga0070702_100003631 3300005615 Bacteria 6940
50 Ga0070702_100195375 3300005615 Unclassified 1335
51 Ga0068852_100097428 3300005616 Bacteria 2646
52 Ga0068852_100281019 3300005616 Unclassified 1605
53 Ga0068852_100496870 3300005616 Bacteria 1214
54 Ga0068859_101848934 3300005617 Bacteria 667
55 Ga0068864_100524642 3300005618 Bacteria 1142
56 Ga0068866_10048874 3300005718 Bacteria 2141
57 Ga0068866_10284465 3300005718 Unclassified 1026
58 Ga0068861_100034151 3300005719 Bacteria 3760
59 Ga0068851_10328640 3300005834 Bacteria 885
60 Ga0068851_10416420 3300005834 Unclassified 793
61 Ga0068870_10088159 3300005840 Bacteria 1729
62 Ga0068870_10274764 3300005840 Bacteria 1054
63 Ga0068870_10935997 3300005840 Bacteria 614
64 Ga0068858_100072861 3300005842 Bacteria 3188
65 Ga0068860_100280597 3300005843 Bacteria 1628
66 Ga0068862_100361526 3300005844 Bacteria 1349
67 Ga0081538_10008690 3300005981 Bacteria 8583
68 Ga0081538_10075404 3300005981 Bacteria 1830
69 Ga0081538_10224000 3300005981 Unclassified 742
70 Ga0081539_10006124 3300005985 Bacteria 11722
71 Ga0075364_10526531 3300006051 Bacteria 808
72 Ga0075428_100130007 3300006844 Bacteria 2739
73 Ga0068865_100028805 3300006881 Bacteria 3679
74 Ga0068865_101231972 3300006881 Bacteria 663
75 Ga0097620_101849216 3300006931 Bacteria 667
76 Ga0111539_10069371 3300009094 Bacteria 4162
77 Ga0111539_10367687 3300009094 Unclassified 1674
78 Ga0105245_10518364 3300009098 Bacteria 1210
79 Ga0105245_10531900 3300009098 Bacteria 1195
80 Ga0105245_10604937 3300009098 Bacteria 1123
81 Ga0105245_10712415 3300009098 Bacteria 1037
82 Ga0105245_11102882 3300009098 Bacteria 840
83 Ga0114129_11042016 3300009147 Bacteria 1028
84 Ga0105243_10218746 3300009148 Bacteria 1682
85 Ga0105243_11181892 3300009148 Bacteria 777
86 Ga0105242_10553787 3300009176 Unclassified 1103
87 Ga0105242_12939218 3300009176 Bacteria 527
88 Ga0105248_12840086 3300009177 Unclassified 552
89 Ga0105237_11183955 3300009545 Unclassified 771
90 Ga0105249_10573585 3300009553 Bacteria 1181
91 Ga0105249_11665107 3300009553 Bacteria 711
92 Ga0163162_12178292 3300013306 Bacteria 636
93 Ga0157375_10202137 3300013308 Bacteria 2143
94 Ga0157375_11118358 3300013308 Bacteria 923
95 Ga0163163_10911819 3300014325 Unclassified 942
96 Ga0157380_10712698 3300014326 Unclassified 1010
97 Ga0157380_12518932 3300014326 Unclassified 580
98 Ga0157377_10081812 3300014745 Bacteria 1889
99 Ga0157377_10376682 3300014745 Bacteria 960
100 Ga0157377_10909241 3300014745 Bacteria 659
101 Ga0157379_10574061 3300014968 Bacteria 1051
102 Ga0163161_10733840 3300017792 Bacteria 825
103 Ga0197907_11189523 3300020069 Unclassified 1316
104 Ga0206353_11220525 3300020082 Bacteria 2417
105 Ga0207642_10014637 3300025899 Bacteria 2900
106 Ga0207642_10132073 3300025899 Unclassified 1304
107 Ga0207688_10044093 3300025901 Bacteria 2486
108 Ga0207643_10091796 3300025908 Bacteria 1771
109 Ga0207643_10373808 3300025908 Bacteria 898
110 Ga0207643_10717174 3300025908 Bacteria 647
111 Ga0207643_10899170 3300025908 Unclassified 574
112 Ga0207707_10285008 3300025912 Bacteria 1430
113 Ga0207662_10068528 3300025918 Bacteria 2142
114 Ga0207657_10225473 3300025919 Unclassified 1500
115 Ga0207652_10183721 3300025921 Unclassified 1880
116 Ga0207687_10673863 3300025927 Bacteria 876
117 Ga0207690_10052942 3300025932 Unclassified 2721
118 Ga0207690_10424920 3300025932 Bacteria 1064
119 Ga0207706_10494005 3300025933 Unclassified 1057
120 Ga0207706_11419319 3300025933 Unclassified 569
121 Ga0207686_10977585 3300025934 Bacteria 686
122 Ga0207709_10112178 3300025935 Bacteria 1825
123 Ga0207709_10195598 3300025935 Bacteria 1440
124 Ga0207669_10554510 3300025937 Bacteria 928
125 Ga0207704_10046488 3300025938 Bacteria 2587
126 Ga0207691_10068731 3300025940 Bacteria 3200
127 Ga0207689_10190557 3300025942 Bacteria 1692
128 Ga0207689_10268220 3300025942 Bacteria 1413
129 Ga0207689_10273377 3300025942 Bacteria 1399
130 Ga0207689_11404577 3300025942 Bacteria 585
131 Ga0207661_10060775 3300025944 Bacteria 3051
132 Ga0207661_10623553 3300025944 Bacteria 991
133 Ga0207679_10139115 3300025945 Bacteria 1960
134 Ga0207712_11057184 3300025961 Bacteria 721
135 Ga0207640_11549452 3300025981 Unclassified 596
136 Ga0207677_10072331 3300026023 Bacteria 2437
137 Ga0207703_10203453 3300026035 Bacteria 1761
138 Ga0207678_10731754 3300026067 Bacteria 872
139 Ga0207678_10845517 3300026067 Bacteria 808
140 Ga0207708_10106511 3300026075 Bacteria 2174
141 Ga0207708_11605218 3300026075 Unclassified 571
142 Ga0207648_10234426 3300026089 Bacteria 1633
143 Ga0207648_11271886 3300026089 Unclassified 691
144 Ga0207676_10501525 3300026095 Bacteria 1153
145 Ga0207675_100142575 3300026118 Bacteria 2277
146 Ga0207675_100841257 3300026118 Bacteria 932
147 Ga0207683_10294448 3300026121 Bacteria 1484
148 Ga0207683_10744090 3300026121 Bacteria 909
149 Ga0207683_10982764 3300026121 Bacteria 784
150 Ga0207698_10212510 3300026142 Unclassified 1741
151 Ga0207698_10227230 3300026142 Bacteria 1691
152 Ga0207698_10471095 3300026142 Bacteria 1216
153 Ga0207428_10007997 3300027907 Bacteria 9600
154 Ga0268265_11337017 3300028380 Bacteria 717
155 Ga0268264_10505410 3300028381 Bacteria 1179
156 Ga0307408_100772669 3300031548 Bacteria 870
157 Ga0307405_10077445 3300031731 Bacteria 2161
158 Ga0307413_10074223 3300031824 Bacteria 2153
159 Ga0307410_10031793 3300031852 Bacteria 3391
160 Ga0307410_10163597 3300031852 Bacteria 1670
161 Ga0307410_10818782 3300031852 Unclassified 793
162 Ga0307406_10013575 3300031901 Bacteria 4668
163 Ga0307406_10144258 3300031901 Bacteria 1690
164 Ga0307406_10207511 3300031901 Bacteria 1447
165 Ga0307406_10355576 3300031901 Bacteria 1146
166 Ga0307406_11349118 3300031901 Bacteria 624
167 Ga0307407_10093784 3300031903 Bacteria 1846
168 Ga0307407_10292744 3300031903 Bacteria 1132
169 Ga0307412_10665243 3300031911 Unclassified 890
170 Ga0307412_11075795 3300031911 Bacteria 714
171 Ga0307409_100030901 3300031995 Bacteria 3856
172 Ga0307409_100396714 3300031995 Bacteria 1316
173 Ga0307409_100667990 3300031995 Bacteria 1035
174 Ga0307409_100886777 3300031995 Bacteria 905
175 Ga0307409_101957713 3300031995 Bacteria 616
176 Ga0307416_100013958 3300032002 Bacteria 5480
177 Ga0307416_100030344 3300032002 Bacteria 4055
178 Ga0307416_100067784 3300032002 Bacteria 2945
179 Ga0307416_100844492 3300032002 Unclassified 1014
180 Ga0307416_100852139 3300032002 Bacteria 1009
181 Ga0307416_101010950 3300032002 Unclassified 935
182 Ga0307411_10047028 3300032005 Bacteria 2787
183 Ga0307411_10614438 3300032005 Bacteria 936
184 Ga0307415_100017193 3300032126 Bacteria 4330
185 Ga0307415_100045990 3300032126 Bacteria 2930
186 Ga0307415_100147802 3300032126 Bacteria 1804
187 Ga0395899_0449754 3300037312 Bacteria 844
188 Ga0395898_0200180 3300037466 Bacteria 1907
189 Ga0395901_0339790 3300038443 Bacteria 1551
190 Ga0451791_0225370 3300041451 Bacteria 1164
191 Ga0451835_0057155 3300041492 Unclassified 632
192 Ga0451837_0496509 3300041494 Bacteria 1589
193 Ga0451853_4086314 3300041512 Unclassified 751
194 Ga0466965_0287538 3300044683 Unclassified 889
195 Ga0466963_0015382 3300044694 Bacteria 4736
196 Ga0466963_0052555 3300044694 Bacteria 2704
197 Ga0466963_0093855 3300044694 Bacteria 2046
198 Ga0466963_0465405 3300044694 Bacteria 892
199 Ga0466971_0162417 3300044719 Bacteria 1046
200 Ga0466970_0495235 3300044765 Bacteria 703
201 Ga0466957_0028287 3300044842 Bacteria 3337
202 Ga0466960_0000071 3300044901 Bacteria 33077
203 Ga0466967_0007431 3300045976 Bacteria 7903
204 Ga0466967_0030140 3300045976 Bacteria 4550
205 Ga0466967_0039393 3300045976 Bacteria 4063
206 Ga0466967_0061091 3300045976 Bacteria 3342
207 Ga0466967_0111214 3300045976 Bacteria 2517
208 Ga0466967_0116993 3300045976 Bacteria 2456
209 Ga0466967_0130528 3300045976 Bacteria 2332
210 Ga0466967_0133883 3300045976 Bacteria 2303
211 Ga0466967_0223864 3300045976 Bacteria 1789
212 Ga0466967_0546164 3300045976 Bacteria 1140
213 Ga0466967_0731050 3300045976 Bacteria 981
214 Ga0466967_0995319 3300045976 Unclassified 835
215 Ga0466967_1413533 3300045976 Bacteria 693
216 Ga0495653_0345368 3300046463 Bacteria 958
217 Ga0495620_0130507 3300046515 Bacteria 986
218 Ga0496101_0354100 3300048904 Bacteria 1154
219 Ga0496102_0247458 3300048905 Bacteria 1681
220 Ga0496103_0488084 3300048906 Unclassified 789
221 Ga0496104_0517221 3300048907 Bacteria 1105
222 Ga0496106_0223770 3300048909 Bacteria 1501
223 Ga0496108_0347466 3300048911 Bacteria 1294
224 Ga0496108_0795055 3300048911 Unclassified 816
225 Ga0496109_0087440 3300048912 Bacteria 2879
226 Ga0496109_0899996 3300048912 Unclassified 823
227 Ga0496110_1187863 3300048913 Bacteria 672
228 Ga0496110_1567623 3300048913 Bacteria 569
229 Ga0496111_0034721 3300048914 Bacteria 3602
230 Ga0496112_0202666 3300048915 Bacteria 1943
231 Ga0496112_0520927 3300048915 Bacteria 1123
232 Ga0501031_0064694 3300049568 Unclassified 2382
233 Ga0501031_0179180 3300049568 Bacteria 1384
234 Ga0501031_0199968 3300049568 Bacteria 1304
235 Ga0501032_0128526 3300049569 Unclassified 1673
236 Ga0501034_0910777 3300049571 Bacteria 767
237 Ga0501036_0060999 3300049572 Bacteria 3194
238 Ga0501036_0505626 3300049572 Bacteria 1005
239 Ga0501037_0528340 3300049573 Bacteria 798
240 Ga0501037_0799228 3300049573 Unclassified 623
241 Ga0501039_0081009 3300049575 Bacteria 2527
242 Ga0501039_0429617 3300049575 Bacteria 1037
243 Ga0501040_0079353 3300049576 Bacteria 2272
244 Ga0501041_0215224 3300049577 Unclassified 1205
245 Ga0501042_0039468 3300049578 Bacteria 3355
246 Ga0501042_0453040 3300049578 Unclassified 930
247 Ga0501043_0497563 3300049579 Unclassified 911
248 Ga0501046_0139336 3300049580 Bacteria 1837
249 Ga0501048_0071587 3300049582 Bacteria 2448
250 Ga0501048_0099358 3300049582 Unclassified 2053
251 Ga0501048_0113681 3300049582 Bacteria 1912
252 Ga0501069_0120235 3300049585 Bacteria 1500
253 Ga0501070_0131878 3300049586 Unclassified 2064
254 Ga0501071_0091385 3300049587 Bacteria 2236
255 Ga0501071_0093310 3300049587 Bacteria 2213
256 Ga0501071_0228523 3300049587 Bacteria 1401
257 Ga0501072_0063406 3300049588 Bacteria 2915
258 Ga0501072_0064374 3300049588 Bacteria 2891
259 Ga0501073_0854234 3300049589 Unclassified 627
260 Ga0501074_0633571 3300049590 Unclassified 756
261 Ga0501075_0092705 3300049591 Bacteria 2293
262 Ga0501076_0069763 3300049592 Bacteria 2809
263 Ga0501076_0078052 3300049592 Bacteria 2657
264 Ga0501077_0071120 3300049593 Bacteria 2205
265 Ga0501079_0055499 3300049741 Bacteria 3057
266 Ga0501079_0155244 3300049741 Bacteria 1784
267 Ga0501080_0231746 3300049742 Bacteria 1688
268 Ga0501081_0100135 3300049743 Bacteria 2048
269 Ga0501081_0178209 3300049743 Bacteria 1536
270 Ga0501035_0109222 3300049822 Bacteria 2425
271 Ga0501035_0497714 3300049822 Unclassified 1003
272 Ga0501045_0154478 3300049824 Bacteria 1707
273 Ga0501045_0217664 3300049824 Bacteria 1422
274 Ga0501045_0487679 3300049824 Unclassified 915
275 nmdc:mga09592_329086_c1 3300050508 Unclassified 1323
276 nmdc:mga08y16_290850_c1 3300050511 Bacteria 1684
277 nmdc:mga08y16_66134_c1 3300050511 Bacteria 3773
278 Ga0500616_0004097 3300053153 Bacteria 10584
279 Ga0501084_0206352 3300054114 Bacteria 1658
280 Ga0501084_0380742 3300054114 Unclassified 1192
281 Ga0501084_0667043 3300054114 Bacteria 878
282 Ga0501084_1264620 3300054114 Unclassified 619
283 Ga0501082_0480902 3300060353 Bacteria 1085
284 Ga0501082_0887998 3300060353 Bacteria 780
285 Ga0466962_0009699 3300061719 Bacteria 4619
286 Ga0466962_0063313 3300061719 Bacteria 1766
287 Ga0466962_0332581 3300061719 Bacteria 755
288 Ga0530510_0019193 3300061734 Bacteria 4850
289 Ga0530510_0223936 3300061734 Unclassified 1398
290 Ga0105247_10008003
291 JGI25406J46586_10019723
292 JGI25407J50210_10028311
293 Ga0070683_100068161
294 Ga0070683_100092064
295 Ga0070683_100359286
296 Ga0070683_100758414
297 Ga0070690_101273760
298 Ga0068869_100083830
299 Ga0070680_100428378
300 Ga0070682_100050197
301 Ga0068868_100014918
302 Ga0068868_101004251
303 Ga0070660_100285915
304 Ga0070691_10394721
305 Ga0070687_100126011
306 Ga0070661_101161252
307 Ga0070692_10141986
308 Ga0070692_10371592
309 Ga0070692_10451624
310 Ga0070671_100797711
311 Ga0070674_100210350
312 Ga0070674_101540647
313 Ga0070673_100170362
314 Ga0070673_101521994
315 Ga0070688_100429668
316 Ga0070659_100043655
317 Ga0070659_100232700
318 Ga0070659_100364830
319 Ga0070659_100546119
320 Ga0070701_10040805
321 Ga0070700_100003774
322 Ga0070700_100347726
323 Ga0070700_101701568
324 Ga0070678_100354605
325 Ga0070678_100868000
326 Ga0070681_10227615
327 Ga0070681_10505504
328 Ga0068867_100556935
329 Ga0068867_101421936
330 Ga0070684_100386058
331 Ga0070684_100442772
332 Ga0070684_101217758
333 Ga0070672_100620353
334 Ga0070665_101024935
335 Ga0070664_100182018
336 Ga0070664_100300064
337 Ga0068857_101825943
338 Ga0070702_100003631
339 Ga0070702_100195375
340 Ga0068852_100097428
341 Ga0068852_100281019
342 Ga0068852_100496870
343 Ga0068859_101848934
344 Ga0068864_100524642
345 Ga0068866_10048874
346 Ga0068866_10284465
347 Ga0068861_100034151
348 Ga0068851_10328640
349 Ga0068851_10416420
350 Ga0068870_10088159
351 Ga0068870_10274764
352 Ga0068870_10935997
353 Ga0068858_100072861
354 Ga0068860_100280597
355 Ga0068862_100361526
356 Ga0081538_10008690
357 Ga0081538_10075404
358 Ga0081538_10224000
359 Ga0081539_10006124
360 Ga0075364_10526531
361 Ga0075428_100130007
362 Ga0068865_100028805
363 Ga0068865_101231972
364 Ga0097620_101849216
365 Ga0111539_10069371
366 Ga0111539_10367687
367 Ga0105245_10518364
368 Ga0105245_10531900
369 Ga0105245_10604937
370 Ga0105245_10712415
371 Ga0105245_11102882
372 Ga0114129_11042016
373 Ga0105243_10218746
374 Ga0105243_11181892
375 Ga0105242_10553787
376 Ga0105242_12939218
377 Ga0105248_12840086
378 Ga0105237_11183955
379 Ga0105249_10573585
380 Ga0105249_11665107
381 Ga0163162_12178292
382 Ga0157375_10202137
383 Ga0157375_11118358
384 Ga0163163_10911819
385 Ga0157380_10712698
386 Ga0157380_12518932
387 Ga0157377_10081812
388 Ga0157377_10376682
389 Ga0157377_10909241
390 Ga0157379_10574061
391 Ga0163161_10733840
392 Ga0197907_11189523
393 Ga0206353_11220525
394 Ga0207642_10014637
395 Ga0207642_10132073
396 Ga0207688_10044093
397 Ga0207643_10091796
398 Ga0207643_10373808
399 Ga0207643_10717174
400 Ga0207643_10899170
401 Ga0207707_10285008
402 Ga0207662_10068528
403 Ga0207657_10225473
404 Ga0207652_10183721
405 Ga0207687_10673863
406 Ga0207690_10052942
407 Ga0207690_10424920
408 Ga0207706_10494005
409 Ga0207706_11419319
410 Ga0207686_10977585
411 Ga0207709_10112178
412 Ga0207709_10195598
413 Ga0207669_10554510
414 Ga0207704_10046488
415 Ga0207691_10068731
416 Ga0207689_10190557
417 Ga0207689_10268220
418 Ga0207689_10273377
419 Ga0207689_11404577
420 Ga0207661_10060775
421 Ga0207661_10623553
422 Ga0207679_10139115
423 Ga0207712_11057184
424 Ga0207640_11549452
425 Ga0207677_10072331
426 Ga0207703_10203453
427 Ga0207678_10731754
428 Ga0207678_10845517
429 Ga0207708_10106511
430 Ga0207708_11605218
431 Ga0207648_10234426
432 Ga0207648_11271886
433 Ga0207676_10501525
434 Ga0207675_100142575
435 Ga0207675_100841257
436 Ga0207683_10294448
437 Ga0207683_10744090
438 Ga0207683_10982764
439 Ga0207698_10212510
440 Ga0207698_10227230
441 Ga0207698_10471095
442 Ga0207428_10007997
443 Ga0268265_11337017
444 Ga0268264_10505410
445 Ga0307408_100772669
446 Ga0307405_10077445
447 Ga0307413_10074223
448 Ga0307410_10031793
449 Ga0307410_10163597
450 Ga0307410_10818782
451 Ga0307406_10013575
452 Ga0307406_10144258
453 Ga0307406_10207511
454 Ga0307406_10355576
455 Ga0307406_11349118
456 Ga0307407_10093784
457 Ga0307407_10292744
458 Ga0307412_10665243
459 Ga0307412_11075795
460 Ga0307409_100030901
461 Ga0307409_100396714
462 Ga0307409_100667990
463 Ga0307409_100886777
464 Ga0307409_101957713
465 Ga0307416_100013958
466 Ga0307416_100030344
467 Ga0307416_100067784
468 Ga0307416_100844492
469 Ga0307416_100852139
470 Ga0307416_101010950
471 Ga0307411_10047028
472 Ga0307411_10614438
473 Ga0307415_100017193
474 Ga0307415_100045990
475 Ga0307415_100147802
476 Ga0395899_0449754
477 Ga0395898_0200180
478 Ga0395901_0339790
479 Ga0451791_0225370
480 Ga0451835_0057155
481 Ga0451837_0496509
482 Ga0451853_4086314
483 Ga0466965_0287538
484 Ga0466963_0015382
485 Ga0466963_0052555
486 Ga0466963_0093855
487 Ga0466963_0465405
488 Ga0466971_0162417
489 Ga0466970_0495235
490 Ga0466957_0028287
491 Ga0466960_0000071
492 Ga0466967_0007431
493 Ga0466967_0030140
494 Ga0466967_0039393
495 Ga0466967_0061091
496 Ga0466967_0111214
497 Ga0466967_0116993
498 Ga0466967_0130528
499 Ga0466967_0133883
500 Ga0466967_0223864
501 Ga0466967_0546164
502 Ga0466967_0731050
503 Ga0466967_0995319
504 Ga0466967_1413533
505 Ga0495653_0345368
506 Ga0495620_0130507
507 Ga0496101_0354100
508 Ga0496102_0247458
509 Ga0496103_0488084
510 Ga0496104_0517221
511 Ga0496106_0223770
512 Ga0496108_0347466
513 Ga0496108_0795055
514 Ga0496109_0087440
515 Ga0496109_0899996
516 Ga0496110_1187863
517 Ga0496110_1567623
518 Ga0496111_0034721
519 Ga0496112_0202666
520 Ga0496112_0520927
521 Ga0501031_0064694
522 Ga0501031_0179180
523 Ga0501031_0199968
524 Ga0501032_0128526
525 Ga0501034_0910777
526 Ga0501036_0060999
527 Ga0501036_0505626
528 Ga0501037_0528340
529 Ga0501037_0799228
530 Ga0501039_0081009
531 Ga0501039_0429617
532 Ga0501040_0079353
533 Ga0501041_0215224
534 Ga0501042_0039468
535 Ga0501042_0453040
536 Ga0501043_0497563
537 Ga0501046_0139336
538 Ga0501048_0071587
539 Ga0501048_0099358
540 Ga0501048_0113681
541 Ga0501069_0120235
542 Ga0501070_0131878
543 Ga0501071_0091385
544 Ga0501071_0093310
545 Ga0501071_0228523
546 Ga0501072_0063406
547 Ga0501072_0064374
548 Ga0501073_0854234
549 Ga0501074_0633571
550 Ga0501075_0092705
551 Ga0501076_0069763
552 Ga0501076_0078052
553 Ga0501077_0071120
554 Ga0501079_0055499
555 Ga0501079_0155244
556 Ga0501080_0231746
557 Ga0501081_0100135
558 Ga0501081_0178209
559 Ga0501035_0109222
560 Ga0501035_0497714
561 Ga0501045_0154478
562 Ga0501045_0217664
563 Ga0501045_0487679
564 nmdc:mga09592_329086_c1
565 nmdc:mga08y16_290850_c1
566 nmdc:mga08y16_66134_c1
567 Ga0500616_0004097
568 Ga0501084_0206352
569 Ga0501084_0380742
570 Ga0501084_0667043
571 Ga0501084_1264620
572 Ga0501082_0480902
573 Ga0501082_0887998
574 Ga0466962_0009699
575 Ga0466962_0063313
576 Ga0466962_0332581
577 Ga0530510_0019193
578 Ga0530510_0223936

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07098

DUF1360

Protein of unknown function (DUF1360)

68

161

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wwj-assembly1.cif.gz_A unda, an oxygen-activating, non-heme iron dependent desaturase/decarboxylase 0.4462 46 141
3o2r-assembly2.cif.gz_D structural flexibility in region involved in dimer formation of nuclease domain of ribonuclase iii (rnc) from campylobacter jejuni 0.4184 44 117
6bbh-assembly1.cif.gz_B the crac channel orai in an unlatched-closed conformation; k163w loss-of-function mutation 0.3815 12 144
6c66-assembly1.cif.gz_I crispr rna-guided surveillance complex, pre-nicking 0.378 50 128
2fj9-assembly1.cif.gz_A high resolution crystal structure of the unliganded human acbp 0.3615 22 99
ID Description Score Start End Superfamily
af_A1A5Z0_198_339_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.4844 3 101 1.20.140.150
2x1dC02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.4463 19 104 1.10.10.2120
2x1dC02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.4358 19 104 1.10.10.2120
af_Q18655_109_492_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4144 47 121 1.20.1250.20
2a11A00 Mainly Alpha;Orthogonal Bundle;Ribonuclease iii, N-terminal Endonuclease Domain; Chain A;Ribonuclease III domain 0.3988 21 121 1.10.1520.10
ID Description Score Start End GO Terms
AF-A0A1F6EZ43-F1-model_v4 DUF1360 domain-containing protein 0.8742 14 143 GO:0016020
AF-A0A7V9K3V5-F1-model_v4 DUF1360 domain-containing protein 0.8621 6 146
AF-A0A7W0PS24-F1-model_v4 DUF1360 domain-containing protein 0.8599 6 144
AF-K2GSP7-F1-model_v4 DUF1360 domain-containing protein 0.8581 14 145 GO:0016020
AF-A0A7W0UA16-F1-model_v4 DUF1360 domain-containing protein 0.855 1 140

Map