F389139

General Info

Members Datasets Scaffolds Average Seq Length
289 162 578 141

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10587480|Ga0105240_105874801
Length 145
Sequence MTMAMLLTNPFDALFEFQQALDQLRQSDWLEASPSGQGAFPPLNVFRKGDDVVVITEVPGINKSDLRIEAKGRTLRIAGTKAAGRAYDGKASVHRLERRGGTFDRAISLPIEIDADGIKAECRDGILALLVPRAERDKPRTIAIS

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
84 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
92 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
129 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
139 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
140 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
141 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
142 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
148 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
149 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
150 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
151 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
152 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
153 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
154 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
155 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
156 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
157 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
158 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.08
Metatranscriptomes 15.57
Isolates 0.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.84
Nodule 0
Rhizoplane 1.73
Rhizosphere 92.73
Stem 0
Stem Tuber 0
Unclassified 43.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10587480 3300009093 Bacteria 1228
2 JGI25406J46586_10044453 3300003203 Bacteria 1538
3 Ga0065712_10240447 3300005290 Bacteria 986
4 Ga0065715_10289320 3300005293 Bacteria 1067
5 Ga0070683_100413502 3300005329 Unclassified 1286
6 Ga0070683_100750361 3300005329 Bacteria 935
7 Ga0068869_101717264 3300005334 Unclassified 560
8 Ga0070666_10247013 3300005335 Unclassified 1263
9 Ga0070680_100518528 3300005336 Bacteria 1020
10 Ga0068868_101763034 3300005338 Unclassified 584
11 Ga0070687_100731584 3300005343 Unclassified 694
12 Ga0070661_101022837 3300005344 Bacteria 686
13 Ga0070675_100705016 3300005354 Bacteria 919
14 Ga0070675_101408355 3300005354 Bacteria 643
15 Ga0070671_100179149 3300005355 Bacteria 1794
16 Ga0070671_100480289 3300005355 Bacteria 1068
17 Ga0070673_101048838 3300005364 Bacteria 760
18 Ga0070709_10974289 3300005434 Unclassified 674
19 Ga0070714_100115483 3300005435 Bacteria 2382
20 Ga0070714_100198265 3300005435 Unclassified 1835
21 Ga0070714_100549451 3300005435 Bacteria 1105
22 Ga0070714_100800531 3300005435 Unclassified 913
23 Ga0070713_100003889 3300005436 Bacteria 9901
24 Ga0070713_100120255 3300005436 Bacteria 2302
25 Ga0070710_10208624 3300005437 Bacteria 1237
26 Ga0070710_10399633 3300005437 Unclassified 921
27 Ga0070711_100073009 3300005439 Bacteria 2423
28 Ga0070711_101619812 3300005439 Bacteria 566
29 Ga0070705_100929214 3300005440 Unclassified 701
30 Ga0070705_101138449 3300005440 Bacteria 640
31 Ga0070708_100064262 3300005445 Unclassified 3287
32 Ga0070708_100821821 3300005445 Unclassified 873
33 Ga0070681_10014357 3300005458 Bacteria 7883
34 Ga0070681_10554757 3300005458 Bacteria 1063
35 Ga0070681_10596962 3300005458 Bacteria 1018
36 Ga0070706_100197400 3300005467 Bacteria 1880
37 Ga0070706_100451371 3300005467 Unclassified 1196
38 Ga0070706_100660772 3300005467 Unclassified 970
39 Ga0070707_100439694 3300005468 Bacteria 1265
40 Ga0070707_100477590 3300005468 Unclassified 1208
41 Ga0070698_100000092 3300005471 Bacteria 71585
42 Ga0070698_100130880 3300005471 Bacteria 2464
43 Ga0070699_100242976 3300005518 Bacteria 1608
44 Ga0070699_100512907 3300005518 Unclassified 1090
45 Ga0070679_100532888 3300005530 Bacteria 1118
46 Ga0070679_101244507 3300005530 Unclassified 690
47 Ga0070679_101968280 3300005530 Unclassified 533
48 Ga0070684_100750974 3300005535 Unclassified 911
49 Ga0070684_101367992 3300005535 Unclassified 666
50 Ga0070697_100084917 3300005536 Bacteria 2611
51 Ga0070697_100116216 3300005536 Unclassified 2234
52 Ga0070697_100309046 3300005536 Unclassified 1360
53 Ga0070697_101489368 3300005536 Unclassified 605
54 Ga0070696_100310634 3300005546 Bacteria 1210
55 Ga0070696_100446094 3300005546 Unclassified 1020
56 Ga0070665_100363685 3300005548 Bacteria 1453
57 Ga0070665_100507456 3300005548 Bacteria 1217
58 Ga0070665_101192839 3300005548 Unclassified 772
59 Ga0068855_100325252 3300005563 Bacteria 1698
60 Ga0068855_101102253 3300005563 Unclassified 830
61 Ga0068855_101651205 3300005563 Bacteria 654
62 Ga0070664_101197222 3300005564 Bacteria 717
63 Ga0068854_100090301 3300005578 Bacteria 2278
64 Ga0068854_100406280 3300005578 Bacteria 1128
65 Ga0068856_100164314 3300005614 Unclassified 2231
66 Ga0068856_100356963 3300005614 Bacteria 1480
67 Ga0068852_100439400 3300005616 Unclassified 1290
68 Ga0068859_102294995 3300005617 Unclassified 595
69 Ga0068864_102199855 3300005618 Bacteria 558
70 Ga0068858_100379642 3300005842 Bacteria 1356
71 Ga0068858_100626814 3300005842 Unclassified 1044
72 Ga0068860_100888058 3300005843 Unclassified 907
73 Ga0068860_101887500 3300005843 Unclassified 619
74 Ga0081540_1045763 3300005983 Unclassified 2217
75 Ga0081539_10010736 3300005985 Bacteria 7381
76 Ga0070717_11067141 3300006028 Unclassified 736
77 Ga0075365_10032690 3300006038 Unclassified 3347
78 Ga0075368_10229447 3300006042 Unclassified 790
79 Ga0075364_10467364 3300006051 Unclassified 862
80 Ga0070715_10498161 3300006163 Unclassified 697
81 Ga0070716_100517002 3300006173 Unclassified 884
82 Ga0070716_100805455 3300006173 Unclassified 728
83 Ga0070712_100659950 3300006175 Bacteria 889
84 Ga0075362_10348362 3300006177 Unclassified 741
85 Ga0075367_10088392 3300006178 Unclassified 1883
86 Ga0075367_10141757 3300006178 Bacteria 1489
87 Ga0075366_10355764 3300006195 Unclassified 899
88 Ga0097621_101266771 3300006237 Unclassified 696
89 Ga0068871_100960644 3300006358 Unclassified 794
90 Ga0075433_10209532 3300006852 Bacteria 1732
91 Ga0075434_100268833 3300006871 Bacteria 1724
92 Ga0075434_101159594 3300006871 Unclassified 785
93 Ga0068865_101160885 3300006881 Bacteria 682
94 Ga0075436_100097374 3300006914 Bacteria 2047
95 Ga0075436_100115146 3300006914 Unclassified 1878
96 Ga0075436_100538615 3300006914 Bacteria 856
97 Ga0097620_100291779 3300006931 Unclassified 1724
98 Ga0097620_101453925 3300006931 Unclassified 756
99 Ga0075435_100338013 3300007076 Bacteria 1290
100 Ga0099795_10058875 3300007788 Bacteria 1419
101 Ga0105240_10181668 3300009093 Bacteria 2482
102 Ga0105240_10462416 3300009093 Bacteria 1417
103 Ga0111539_10703372 3300009094 Bacteria 1176
104 Ga0111539_10863077 3300009094 Unclassified 1053
105 Ga0105247_10291042 3300009101 Bacteria 1130
106 Ga0105247_10449451 3300009101 Unclassified 929
107 Ga0105241_10310799 3300009174 Bacteria 1356
108 Ga0105242_12401776 3300009176 Bacteria 575
109 Ga0105248_10229590 3300009177 Bacteria 2089
110 Ga0105248_10552861 3300009177 Bacteria 1299
111 Ga0105248_11279168 3300009177 Unclassified 830
112 Ga0105248_11419334 3300009177 Bacteria 786
113 Ga0105237_10430121 3300009545 Unclassified 1326
114 Ga0105238_10112112 3300009551 Bacteria 2707
115 Ga0105239_13149478 3300010375 Unclassified 537
116 Ga0157373_10309681 3300013100 Unclassified 1122
117 Ga0157373_11371458 3300013100 Bacteria 537
118 Ga0157371_10143306 3300013102 Bacteria 1702
119 Ga0157371_10892277 3300013102 Bacteria 674
120 Ga0157370_10012027 3300013104 Bacteria 9013
121 Ga0157370_10973850 3300013104 Bacteria 768
122 Ga0157370_10998767 3300013104 Bacteria 758
123 Ga0157374_10224735 3300013296 Unclassified 1843
124 Ga0157378_12681942 3300013297 Unclassified 551
125 Ga0163162_11575074 3300013306 Unclassified 749
126 Ga0157372_10682401 3300013307 Unclassified 1196
127 Ga0157372_11101767 3300013307 Bacteria 919
128 Ga0157375_10620345 3300013308 Unclassified 1239
129 Ga0163163_10293495 3300014325 Bacteria 1678
130 Ga0182008_10065437 3300014497 Unclassified 1788
131 Ga0182008_10139488 3300014497 Bacteria 1212
132 Ga0182008_10668063 3300014497 Unclassified 590
133 Ga0182008_10692845 3300014497 Unclassified 581
134 Ga0157379_11384386 3300014968 Bacteria 681
135 Ga0157376_10574761 3300014969 Bacteria 1118
136 Ga0157376_10702909 3300014969 Bacteria 1016
137 Ga0206349_1581792 3300020075 Unclassified 1370
138 Ga0206349_1647924 3300020075 Bacteria 721
139 Ga0206349_1691875 3300020075 Unclassified 1155
140 Ga0206349_1842890 3300020075 Unclassified 1162
141 Ga0206355_1541175 3300020076 Bacteria 573
142 Ga0206351_10204106 3300020077 Bacteria 980
143 Ga0206351_10209877 3300020077 Unclassified 1497
144 Ga0206351_10638935 3300020077 Bacteria 1709
145 Ga0206351_10874121 3300020077 Unclassified 595
146 Ga0206351_11006376 3300020077 Unclassified 695
147 Ga0206350_10052145 3300020080 Unclassified 1429
148 Ga0206350_10313076 3300020080 Unclassified 1251
149 Ga0206350_10698167 3300020080 Unclassified 1163
150 Ga0206350_10973851 3300020080 Bacteria 1299
151 Ga0206350_11010630 3300020080 Bacteria 1089
152 Ga0206350_11129126 3300020080 Unclassified 1101
153 Ga0206350_11354576 3300020080 Bacteria 1175
154 Ga0206350_11585257 3300020080 Unclassified 1169
155 Ga0206354_10790053 3300020081 Bacteria 1123
156 Ga0206353_11186336 3300020082 Unclassified 504
157 Ga0154015_1080716 3300020610 Unclassified 1040
158 Ga0154015_1105344 3300020610 Bacteria 1320
159 Ga0154015_1158577 3300020610 Unclassified 1203
160 Ga0154015_1275511 3300020610 Bacteria 1786
161 Ga0154015_1460974 3300020610 Unclassified 556
162 Ga0213872_10197987 3300021361 Unclassified 862
163 Ga0213876_10021198 3300021384 Unclassified 3436
164 Ga0213871_10000384 3300021441 Bacteria 5823
165 Ga0224712_10019803 3300022467 Bacteria 2275
166 Ga0224712_10032959 3300022467 Bacteria 1892
167 Ga0224712_10034269 3300022467 Bacteria 1866
168 Ga0224712_10046295 3300022467 Bacteria 1669
169 Ga0224712_10050192 3300022467 Unclassified 1620
170 Ga0224712_10057964 3300022467 Unclassified 1532
171 Ga0224712_10058792 3300022467 Bacteria 1524
172 Ga0224712_10074559 3300022467 Bacteria 1386
173 Ga0224712_10083882 3300022467 Bacteria 1321
174 Ga0224712_10084669 3300022467 Bacteria 1316
175 Ga0224712_10088986 3300022467 Unclassified 1290
176 Ga0224712_10089886 3300022467 Bacteria 1284
177 Ga0224712_10093706 3300022467 Unclassified 1262
178 Ga0224712_10099539 3300022467 Unclassified 1230
179 Ga0224712_10099607 3300022467 Bacteria 1230
180 Ga0224712_10109045 3300022467 Bacteria 1185
181 Ga0207692_11103296 3300025898 Bacteria 526
182 Ga0207647_10061154 3300025904 Bacteria 2300
183 Ga0207685_10773190 3300025905 Unclassified 527
184 Ga0207699_10217338 3300025906 Bacteria 1303
185 Ga0207699_10217861 3300025906 Bacteria 1302
186 Ga0207684_10194738 3300025910 Bacteria 1748
187 Ga0207654_11396527 3300025911 Bacteria 511
188 Ga0207707_10013089 3300025912 Bacteria 7227
189 Ga0207707_10680483 3300025912 Bacteria 865
190 Ga0207707_10723725 3300025912 Unclassified 834
191 Ga0207695_10330364 3300025913 Bacteria 1413
192 Ga0207693_10187663 3300025915 Bacteria 1627
193 Ga0207693_10516921 3300025915 Bacteria 932
194 Ga0207663_10245211 3300025916 Bacteria 1316
195 Ga0207660_10945803 3300025917 Bacteria 703
196 Ga0207649_10515885 3300025920 Bacteria 911
197 Ga0207652_10008801 3300025921 Bacteria 8129
198 Ga0207652_10480571 3300025921 Bacteria 1119
199 Ga0207652_11899716 3300025921 Unclassified 501
200 Ga0207646_11826048 3300025922 Unclassified 519
201 Ga0207694_10208265 3300025924 Unclassified 1592
202 Ga0207694_10854931 3300025924 Bacteria 769
203 Ga0207659_10416867 3300025926 Bacteria 1125
204 Ga0207700_10118470 3300025928 Unclassified 2143
205 Ga0207700_10346312 3300025928 Bacteria 1293
206 Ga0207700_11796879 3300025928 Unclassified 539
207 Ga0207664_10033179 3300025929 Bacteria 3964
208 Ga0207664_10418668 3300025929 Bacteria 1193
209 Ga0207664_10599059 3300025929 Unclassified 990
210 Ga0207664_10880752 3300025929 Unclassified 804
211 Ga0207644_10131136 3300025931 Bacteria 1919
212 Ga0207644_10951253 3300025931 Unclassified 720
213 Ga0207665_11438727 3300025939 Unclassified 548
214 Ga0207711_10575435 3300025941 Bacteria 1051
215 Ga0207711_10638831 3300025941 Bacteria 993
216 Ga0207661_10430435 3300025944 Unclassified 1199
217 Ga0207679_10165059 3300025945 Unclassified 1817
218 Ga0207679_10972768 3300025945 Bacteria 778
219 Ga0207667_10272586 3300025949 Bacteria 1730
220 Ga0207667_10280840 3300025949 Bacteria 1701
221 Ga0207667_10749678 3300025949 Unclassified 976
222 Ga0207667_11387635 3300025949 Bacteria 676
223 Ga0207651_10809092 3300025960 Bacteria 831
224 Ga0207640_10187933 3300025981 Unclassified 1555
225 Ga0207640_10300449 3300025981 Unclassified 1270
226 Ga0207703_10176164 3300026035 Bacteria 1884
227 Ga0207703_11190644 3300026035 Unclassified 732
228 Ga0207639_10759355 3300026041 Bacteria 902
229 Ga0207702_10112693 3300026078 Unclassified 2421
230 Ga0207702_11644506 3300026078 Bacteria 635
231 Ga0207674_10429288 3300026116 Unclassified 1277
232 Ga0207698_10303437 3300026142 Unclassified 1487
233 Ga0209813_10170511 3300027866 Unclassified 790
234 Ga0207428_10307226 3300027907 Bacteria 1173
235 Ga0268266_10205990 3300028379 Bacteria 1802
236 Ga0268266_10555611 3300028379 Bacteria 1100
237 Ga0268266_11763906 3300028379 Unclassified 594
238 Ga0268264_11529100 3300028381 Unclassified 678
239 Ga0265334_10050966 3300028573 Unclassified 1588
240 Ga0265340_10112129 3300031247 Unclassified 1260
241 Ga0373937_0667170 3300036401 Unclassified 986
242 Ga0373925_0329500 3300037068 Bacteria 1237
243 Ga0395899_0060714 3300037312 Unclassified 2785
244 Ga0395899_0086733 3300037312 Bacteria 2273
245 Ga0395899_0447212 3300037312 Unclassified 847
246 Ga0395900_0019785 3300037418 Bacteria 6862
247 Ga0395900_0391575 3300037418 Bacteria 1355
248 Ga0395900_0606198 3300037418 Unclassified 1035
249 Ga0395898_0285405 3300037466 Bacteria 1574
250 Ga0395898_0967452 3300037466 Bacteria 788
251 Ga0395905_0180983 3300037471 Bacteria 1979
252 Ga0395901_0017114 3300038443 Bacteria 7391
253 Ga0395901_0026768 3300038443 Bacteria 5921
254 Ga0395901_0186199 3300038443 Bacteria 2177
255 Ga0395901_1537526 3300038443 Bacteria 620
256 Ga0436365_1687166 3300039437 Bacteria 7196
257 Ga0436360_0725030 3300039438 Bacteria 1187
258 Ga0436360_1135922 3300039438 Bacteria 19629
259 Ga0436361_0121777 3300039447 Bacteria 3452
260 Ga0436361_0942340 3300039447 Bacteria 8582
261 Ga0436362_0218288 3300039453 Unclassified 761
262 Ga0466963_0815459 3300044694 Unclassified 658
263 Ga0466960_1042283 3300044901 Bacteria 504
264 Ga0496104_0415907 3300048907 Bacteria 1257
265 Ga0496109_0633781 3300048912 Bacteria 1006
266 Ga0496112_0462601 3300048915 Unclassified 1206
267 Ga0496112_0637242 3300048915 Bacteria 996
268 Ga0496113_1519332 3300048916 Unclassified 517
269 Ga0501034_0392869 3300049571 Bacteria 1311
270 nmdc:mga03683_682712_c1 3300050489 Unclassified 507
271 nmdc:mga00v17_123167_c2 3300050491 Unclassified 1113
272 nmdc:mga0yw44_6642_c1 3300050492 Bacteria 5608
273 nmdc:mga06z11_106599_c1 3300050494 Bacteria 1545
274 nmdc:mga06z11_265483_c1 3300050494 Unclassified 1014
275 nmdc:mga04h51_197103_c1 3300050495 Unclassified 790
276 nmdc:mga08y16_278013_c1 3300050511 Bacteria 1727
277 nmdc:mga0n895_1170208_c1 3300050512 Unclassified 744
278 nmdc:mga0n895_258377_c1 3300050512 Bacteria 1768
279 nmdc:mga0rr50_1550883_c1 3300050513 Unclassified 559
280 nmdc:mga0rr50_380270_c1 3300050513 Bacteria 1190
281 nmdc:mga0rr50_511223_c1 3300050513 Bacteria 1022
282 nmdc:mga08x19_303536_c1 3300050514 Bacteria 1109
283 nmdc:mga08x19_463244_c1 3300050514 Bacteria 893
284 nmdc:mga0a205_364748_c1 3300050515 Bacteria 1311
285 Ga0587083_0243291 3300059505 Unclassified 533
286 Ga0587085_043461 3300059506 Unclassified 792
287 Ga0587075_090455 3300059644 Bacteria 597
288 Ga0587076_075320 3300059645 Unclassified 709
289 2883292369 2883291878 Bacteria 5894118
290 Ga0105240_10587480
291 JGI25406J46586_10044453
292 Ga0065712_10240447
293 Ga0065715_10289320
294 Ga0070683_100413502
295 Ga0070683_100750361
296 Ga0068869_101717264
297 Ga0070666_10247013
298 Ga0070680_100518528
299 Ga0068868_101763034
300 Ga0070687_100731584
301 Ga0070661_101022837
302 Ga0070675_100705016
303 Ga0070675_101408355
304 Ga0070671_100179149
305 Ga0070671_100480289
306 Ga0070673_101048838
307 Ga0070709_10974289
308 Ga0070714_100115483
309 Ga0070714_100198265
310 Ga0070714_100549451
311 Ga0070714_100800531
312 Ga0070713_100003889
313 Ga0070713_100120255
314 Ga0070710_10208624
315 Ga0070710_10399633
316 Ga0070711_100073009
317 Ga0070711_101619812
318 Ga0070705_100929214
319 Ga0070705_101138449
320 Ga0070708_100064262
321 Ga0070708_100821821
322 Ga0070681_10014357
323 Ga0070681_10554757
324 Ga0070681_10596962
325 Ga0070706_100197400
326 Ga0070706_100451371
327 Ga0070706_100660772
328 Ga0070707_100439694
329 Ga0070707_100477590
330 Ga0070698_100000092
331 Ga0070698_100130880
332 Ga0070699_100242976
333 Ga0070699_100512907
334 Ga0070679_100532888
335 Ga0070679_101244507
336 Ga0070679_101968280
337 Ga0070684_100750974
338 Ga0070684_101367992
339 Ga0070697_100084917
340 Ga0070697_100116216
341 Ga0070697_100309046
342 Ga0070697_101489368
343 Ga0070696_100310634
344 Ga0070696_100446094
345 Ga0070665_100363685
346 Ga0070665_100507456
347 Ga0070665_101192839
348 Ga0068855_100325252
349 Ga0068855_101102253
350 Ga0068855_101651205
351 Ga0070664_101197222
352 Ga0068854_100090301
353 Ga0068854_100406280
354 Ga0068856_100164314
355 Ga0068856_100356963
356 Ga0068852_100439400
357 Ga0068859_102294995
358 Ga0068864_102199855
359 Ga0068858_100379642
360 Ga0068858_100626814
361 Ga0068860_100888058
362 Ga0068860_101887500
363 Ga0081540_1045763
364 Ga0081539_10010736
365 Ga0070717_11067141
366 Ga0075365_10032690
367 Ga0075368_10229447
368 Ga0075364_10467364
369 Ga0070715_10498161
370 Ga0070716_100517002
371 Ga0070716_100805455
372 Ga0070712_100659950
373 Ga0075362_10348362
374 Ga0075367_10088392
375 Ga0075367_10141757
376 Ga0075366_10355764
377 Ga0097621_101266771
378 Ga0068871_100960644
379 Ga0075433_10209532
380 Ga0075434_100268833
381 Ga0075434_101159594
382 Ga0068865_101160885
383 Ga0075436_100097374
384 Ga0075436_100115146
385 Ga0075436_100538615
386 Ga0097620_100291779
387 Ga0097620_101453925
388 Ga0075435_100338013
389 Ga0099795_10058875
390 Ga0105240_10181668
391 Ga0105240_10462416
392 Ga0111539_10703372
393 Ga0111539_10863077
394 Ga0105247_10291042
395 Ga0105247_10449451
396 Ga0105241_10310799
397 Ga0105242_12401776
398 Ga0105248_10229590
399 Ga0105248_10552861
400 Ga0105248_11279168
401 Ga0105248_11419334
402 Ga0105237_10430121
403 Ga0105238_10112112
404 Ga0105239_13149478
405 Ga0157373_10309681
406 Ga0157373_11371458
407 Ga0157371_10143306
408 Ga0157371_10892277
409 Ga0157370_10012027
410 Ga0157370_10973850
411 Ga0157370_10998767
412 Ga0157374_10224735
413 Ga0157378_12681942
414 Ga0163162_11575074
415 Ga0157372_10682401
416 Ga0157372_11101767
417 Ga0157375_10620345
418 Ga0163163_10293495
419 Ga0182008_10065437
420 Ga0182008_10139488
421 Ga0182008_10668063
422 Ga0182008_10692845
423 Ga0157379_11384386
424 Ga0157376_10574761
425 Ga0157376_10702909
426 Ga0206349_1581792
427 Ga0206349_1647924
428 Ga0206349_1691875
429 Ga0206349_1842890
430 Ga0206355_1541175
431 Ga0206351_10204106
432 Ga0206351_10209877
433 Ga0206351_10638935
434 Ga0206351_10874121
435 Ga0206351_11006376
436 Ga0206350_10052145
437 Ga0206350_10313076
438 Ga0206350_10698167
439 Ga0206350_10973851
440 Ga0206350_11010630
441 Ga0206350_11129126
442 Ga0206350_11354576
443 Ga0206350_11585257
444 Ga0206354_10790053
445 Ga0206353_11186336
446 Ga0154015_1080716
447 Ga0154015_1105344
448 Ga0154015_1158577
449 Ga0154015_1275511
450 Ga0154015_1460974
451 Ga0213872_10197987
452 Ga0213876_10021198
453 Ga0213871_10000384
454 Ga0224712_10019803
455 Ga0224712_10032959
456 Ga0224712_10034269
457 Ga0224712_10046295
458 Ga0224712_10050192
459 Ga0224712_10057964
460 Ga0224712_10058792
461 Ga0224712_10074559
462 Ga0224712_10083882
463 Ga0224712_10084669
464 Ga0224712_10088986
465 Ga0224712_10089886
466 Ga0224712_10093706
467 Ga0224712_10099539
468 Ga0224712_10099607
469 Ga0224712_10109045
470 Ga0207692_11103296
471 Ga0207647_10061154
472 Ga0207685_10773190
473 Ga0207699_10217338
474 Ga0207699_10217861
475 Ga0207684_10194738
476 Ga0207654_11396527
477 Ga0207707_10013089
478 Ga0207707_10680483
479 Ga0207707_10723725
480 Ga0207695_10330364
481 Ga0207693_10187663
482 Ga0207693_10516921
483 Ga0207663_10245211
484 Ga0207660_10945803
485 Ga0207649_10515885
486 Ga0207652_10008801
487 Ga0207652_10480571
488 Ga0207652_11899716
489 Ga0207646_11826048
490 Ga0207694_10208265
491 Ga0207694_10854931
492 Ga0207659_10416867
493 Ga0207700_10118470
494 Ga0207700_10346312
495 Ga0207700_11796879
496 Ga0207664_10033179
497 Ga0207664_10418668
498 Ga0207664_10599059
499 Ga0207664_10880752
500 Ga0207644_10131136
501 Ga0207644_10951253
502 Ga0207665_11438727
503 Ga0207711_10575435
504 Ga0207711_10638831
505 Ga0207661_10430435
506 Ga0207679_10165059
507 Ga0207679_10972768
508 Ga0207667_10272586
509 Ga0207667_10280840
510 Ga0207667_10749678
511 Ga0207667_11387635
512 Ga0207651_10809092
513 Ga0207640_10187933
514 Ga0207640_10300449
515 Ga0207703_10176164
516 Ga0207703_11190644
517 Ga0207639_10759355
518 Ga0207702_10112693
519 Ga0207702_11644506
520 Ga0207674_10429288
521 Ga0207698_10303437
522 Ga0209813_10170511
523 Ga0207428_10307226
524 Ga0268266_10205990
525 Ga0268266_10555611
526 Ga0268266_11763906
527 Ga0268264_11529100
528 Ga0265334_10050966
529 Ga0265340_10112129
530 Ga0373937_0667170
531 Ga0373925_0329500
532 Ga0395899_0060714
533 Ga0395899_0086733
534 Ga0395899_0447212
535 Ga0395900_0019785
536 Ga0395900_0391575
537 Ga0395900_0606198
538 Ga0395898_0285405
539 Ga0395898_0967452
540 Ga0395905_0180983
541 Ga0395901_0017114
542 Ga0395901_0026768
543 Ga0395901_0186199
544 Ga0395901_1537526
545 Ga0436365_1687166
546 Ga0436360_0725030
547 Ga0436360_1135922
548 Ga0436361_0121777
549 Ga0436361_0942340
550 Ga0436362_0218288
551 Ga0466963_0815459
552 Ga0466960_1042283
553 Ga0496104_0415907
554 Ga0496109_0633781
555 Ga0496112_0462601
556 Ga0496112_0637242
557 Ga0496113_1519332
558 Ga0501034_0392869
559 nmdc:mga03683_682712_c1
560 nmdc:mga00v17_123167_c2
561 nmdc:mga0yw44_6642_c1
562 nmdc:mga06z11_106599_c1
563 nmdc:mga06z11_265483_c1
564 nmdc:mga04h51_197103_c1
565 nmdc:mga08y16_278013_c1
566 nmdc:mga0n895_1170208_c1
567 nmdc:mga0n895_258377_c1
568 nmdc:mga0rr50_1550883_c1
569 nmdc:mga0rr50_380270_c1
570 nmdc:mga0rr50_511223_c1
571 nmdc:mga08x19_303536_c1
572 nmdc:mga08x19_463244_c1
573 nmdc:mga0a205_364748_c1
574 Ga0587083_0243291
575 Ga0587085_043461
576 Ga0587075_090455
577 Ga0587076_075320
578 2883292369

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00011

HSP20

Hsp20/alpha crystallin family

44

145

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rzk-assembly1.cif.gz_B crystal structure of sulfolobus solfataricus hsp20.1 acd 0.8547 39 130
4eld-assembly1.cif.gz_A crystal structure of an activated variant of small heat shock protein hsp16.5 0.8471 37 141
2jki-assembly3.cif.gz_U complex of hsp90 n-terminal and sgt1 cs domain 0.8406 39 131
3vqm-assembly7.cif.gz_N small heat shock protein hsp14.0 of c-terminal deletion variant with c-terminal peptide 0.8365 37 125
3vql-assembly1.cif.gz_A small heat shock protein hsp14.0 of c-terminal deletion variant 0.8353 37 130
ID Description Score Start End Superfamily
af_Q9D9A7_3_126_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.896 39 129 2.60.40.790
af_Q8S1F2_1_96_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8659 37 129 2.60.40.790
af_D4ABI7_5_108_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8634 39 129 2.60.40.790
af_A4I9J1_8_137_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8567 39 128 2.60.40.790
4rzkB00 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8547 39 130 2.60.40.790
ID Description Score Start End GO Terms
AF-A0A838DLA5-F1-model_v4 Hsp20/alpha crystallin family protein 0.8735 44 141
AF-K1YQJ0-F1-model_v4 Uncharacterized protein 0.8676 34 141
AF-A0A1F9LJQ2-F1-model_v4 Heat-shock protein Hsp20 0.8599 38 141
AF-A0A1F9LJQ2-F1-model_v4 Heat-shock protein Hsp20 0.8522 38 141
AF-A0A7C5WN77-F1-model_v4 Hsp20/alpha crystallin family protein 0.8468 34 141

Map