F389117

General Info

Members Datasets Scaffolds Average Seq Length
289 153 578 199

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10023751|Ga0075433_100237513
Length 211
Sequence MSSARPPDGDRFGAKPAVLRCARCGKFVDWDEAHVQIVCSCRMRIDLPPVLVREATDRDRHAVRELFSRDFGRTNIVAFGEVMDIDQMPALVADRTDEPSGALAYRLFGDALHIVALATDPMWQRSGVGGYLVAEAELLARRLGLTRIVVATSNDNLPALYFYQRRGYRMTEVVVNSVLTHTGQDVPGFAGIPVRDEVRLEKRLPFGQGLA

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
91 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
92 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
93 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
94 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
95 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
103 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
104 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
105 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
106 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
107 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
108 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
109 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
112 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
113 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
114 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
115 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
116 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
117 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
118 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
119 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
130 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
131 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
132 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
133 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
134 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
135 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
136 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
137 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
138 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
139 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
140 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
144 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
145 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
146 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
147 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
148 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
149 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
150 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
151 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
152 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
153 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.35
Rhizosphere 99.65
Stem 0
Stem Tuber 0
Unclassified 25.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10023751 3300006852 Bacteria 5164
2 MBSR1b_contig_5684308 2162886012 Bacteria 850
3 JGI25406J46586_10061779 3300003203 Bacteria 1207
4 Ga0065712_10003945 3300005290 Bacteria 4325
5 Ga0065707_10105892 3300005295 Bacteria 2624
6 Ga0070676_10118346 3300005328 Bacteria 1659
7 Ga0070670_100009230 3300005331 Bacteria 8427
8 Ga0070670_101224021 3300005331 Unclassified 686
9 Ga0070680_100473792 3300005336 Unclassified 1070
10 Ga0070689_100038990 3300005340 Bacteria 3636
11 Ga0070687_100026845 3300005343 Bacteria 2776
12 Ga0070661_100136486 3300005344 Unclassified 1846
13 Ga0070668_100307444 3300005347 Unclassified 1331
14 Ga0070669_100056569 3300005353 Bacteria 2876
15 Ga0070669_100122229 3300005353 Unclassified 1988
16 Ga0070669_100375252 3300005353 Bacteria 1159
17 Ga0070669_100680917 3300005353 Unclassified 867
18 Ga0070675_100384286 3300005354 Bacteria 1250
19 Ga0070671_100356293 3300005355 Bacteria 1249
20 Ga0070674_100144826 3300005356 Bacteria 1787
21 Ga0070674_100869094 3300005356 Bacteria 783
22 Ga0070673_100002384 3300005364 Bacteria 11443
23 Ga0070673_100847292 3300005364 Unclassified 846
24 Ga0070688_100034440 3300005365 Bacteria 3068
25 Ga0070659_100585098 3300005366 Bacteria 958
26 Ga0070667_100162447 3300005367 Unclassified 1968
27 Ga0070703_10036016 3300005406 Bacteria 1518
28 Ga0070709_10934851 3300005434 Bacteria 687
29 Ga0070714_100070206 3300005435 Bacteria 3028
30 Ga0070701_10029549 3300005438 Bacteria 2704
31 Ga0070701_10310983 3300005438 Bacteria 972
32 Ga0070700_100441777 3300005441 Bacteria 988
33 Ga0070694_100004457 3300005444 Bacteria 8423
34 Ga0070694_100010763 3300005444 Bacteria 5656
35 Ga0070694_100197853 3300005444 Bacteria 1496
36 Ga0070694_100483433 3300005444 Unclassified 983
37 Ga0070708_100079045 3300005445 Bacteria 2975
38 Ga0070678_100556274 3300005456 Bacteria 1019
39 Ga0070662_100285194 3300005457 Unclassified 1337
40 Ga0070681_10106430 3300005458 Unclassified 2746
41 Ga0070681_10412696 3300005458 Bacteria 1262
42 Ga0070685_10086880 3300005466 Bacteria 1886
43 Ga0070706_100267226 3300005467 Unclassified 1596
44 Ga0070707_100130405 3300005468 Bacteria 2445
45 Ga0070707_100751496 3300005468 Unclassified 938
46 Ga0070698_100327152 3300005471 Bacteria 1464
47 Ga0070698_100388273 3300005471 Bacteria 1329
48 Ga0070698_101036207 3300005471 Bacteria 768
49 Ga0070699_100003786 3300005518 Bacteria 13372
50 Ga0070699_100221539 3300005518 Unclassified 1686
51 Ga0070699_100404090 3300005518 Unclassified 1235
52 Ga0070699_100426292 3300005518 Unclassified 1201
53 Ga0070697_100119446 3300005536 Bacteria 2204
54 Ga0070697_100222450 3300005536 Bacteria 1609
55 Ga0070695_100001381 3300005545 Bacteria 13480
56 Ga0070695_100002877 3300005545 Bacteria 10015
57 Ga0070696_100017821 3300005546 Bacteria 4795
58 Ga0070696_100424974 3300005546 Unclassified 1044
59 Ga0070704_100052878 3300005549 Bacteria 2868
60 Ga0068855_100141825 3300005563 Unclassified 2738
61 Ga0070664_100004294 3300005564 Bacteria 11459
62 Ga0070664_100312685 3300005564 Bacteria 1422
63 Ga0068859_100007888 3300005617 Bacteria 10804
64 Ga0068864_100030943 3300005618 Unclassified 4538
65 Ga0068864_100257278 3300005618 Unclassified 1623
66 Ga0068870_10508588 3300005840 Bacteria 804
67 Ga0068858_100028506 3300005842 Bacteria 5186
68 Ga0068860_100533691 3300005843 Bacteria 1174
69 Ga0068862_100293299 3300005844 Unclassified 1494
70 Ga0081538_10132296 3300005981 Bacteria 1170
71 Ga0081540_1127062 3300005983 Bacteria 1047
72 Ga0081539_10003534 3300005985 Bacteria 19012
73 Ga0081539_10257042 3300005985 Bacteria 773
74 Ga0075428_100001725 3300006844 Bacteria 23355
75 Ga0075433_10023743 3300006852 Bacteria 5165
76 Ga0075433_10054403 3300006852 Bacteria 3492
77 Ga0075433_10115597 3300006852 Bacteria 2380
78 Ga0075434_100002382 3300006871 Bacteria 16506
79 Ga0075434_100131299 3300006871 Bacteria 2524
80 Ga0075434_100211390 3300006871 Bacteria 1960
81 Ga0075434_100322963 3300006871 Bacteria 1564
82 Ga0075434_100367372 3300006871 Bacteria 1460
83 Ga0075434_100659997 3300006871 Bacteria 1064
84 Ga0075429_100027509 3300006880 Bacteria 4937
85 Ga0075429_100398892 3300006880 Unclassified 1205
86 Ga0075436_100017909 3300006914 Bacteria 4850
87 Ga0097620_100007888 3300006931 Bacteria 10804
88 Ga0075435_100000964 3300007076 Bacteria 18176
89 Ga0075435_100002288 3300007076 Bacteria 12651
90 Ga0075435_100042326 3300007076 Bacteria 3644
91 Ga0075435_100136385 3300007076 Unclassified 2056
92 Ga0075435_100499829 3300007076 Bacteria 1051
93 Ga0105240_10044088 3300009093 Bacteria 5672
94 Ga0105240_10567622 3300009093 Bacteria 1253
95 Ga0111539_10000014 3300009094 Bacteria 307501
96 Ga0111539_10446291 3300009094 Bacteria 1506
97 Ga0111539_10643090 3300009094 Bacteria 1235
98 Ga0114129_10000382 3300009147 Bacteria 51464
99 Ga0114129_10009222 3300009147 Bacteria 14073
100 Ga0114129_10013444 3300009147 Bacteria 11666
101 Ga0114129_10016294 3300009147 Bacteria 10579
102 Ga0114129_10017403 3300009147 Bacteria 10237
103 Ga0114129_10056212 3300009147 Bacteria 5513
104 Ga0114129_10080200 3300009147 Bacteria 4536
105 Ga0114129_10119965 3300009147 Bacteria 3622
106 Ga0114129_10460241 3300009147 Bacteria 1667
107 Ga0114129_10945219 3300009147 Unclassified 1089
108 Ga0114129_11025645 3300009147 Unclassified 1037
109 Ga0105243_10314570 3300009148 Unclassified 1424
110 Ga0157380_10079826 3300014326 Bacteria 2673
111 Ga0157380_10289576 3300014326 Unclassified 1503
112 Ga0157380_10567597 3300014326 Bacteria 1116
113 Ga0207697_10181977 3300025315 Unclassified 921
114 Ga0207707_10063404 3300025912 Unclassified 3217
115 Ga0207695_10339952 3300025913 Bacteria 1389
116 Ga0207695_10619773 3300025913 Bacteria 963
117 Ga0207660_10213860 3300025917 Unclassified 1511
118 Ga0207662_10022048 3300025918 Bacteria 3646
119 Ga0207649_10101325 3300025920 Unclassified 1906
120 Ga0207646_10105946 3300025922 Bacteria 2522
121 Ga0207646_10262499 3300025922 Bacteria 1561
122 Ga0207681_10309304 3300025923 Bacteria 1253
123 Ga0207650_10036346 3300025925 Bacteria 3583
124 Ga0207650_10446356 3300025925 Bacteria 1076
125 Ga0207659_10088304 3300025926 Bacteria 2309
126 Ga0207706_10324989 3300025933 Bacteria 1339
127 Ga0207706_10338413 3300025933 Unclassified 1309
128 Ga0207670_10004120 3300025936 Bacteria 7787
129 Ga0207669_10364905 3300025937 Bacteria 1120
130 Ga0207669_10378126 3300025937 Bacteria 1103
131 Ga0207691_10015939 3300025940 Bacteria 7140
132 Ga0207679_10017295 3300025945 Unclassified 4806
133 Ga0207667_10815075 3300025949 Unclassified 929
134 Ga0207651_10033237 3300025960 Bacteria 3324
135 Ga0207651_10565106 3300025960 Unclassified 991
136 Ga0207668_10283359 3300025972 Unclassified 1360
137 Ga0207640_10103111 3300025981 Bacteria 2005
138 Ga0207640_10234088 3300025981 Unclassified 1415
139 Ga0207703_10041076 3300026035 Unclassified 3704
140 Ga0207708_10459445 3300026075 Bacteria 1062
141 Ga0207676_10634381 3300026095 Bacteria 1029
142 Ga0207676_11107094 3300026095 Bacteria 783
143 Ga0207675_100020637 3300026118 Bacteria 6141
144 Ga0207683_10716355 3300026121 Unclassified 928
145 Ga0207428_10000005 3300027907 Bacteria 520045
146 Ga0207428_10084820 3300027907 Bacteria 2468
147 Ga0268265_10355331 3300028380 Bacteria 1339
148 Ga0268265_11118316 3300028380 Unclassified 783
149 Ga0268264_11415181 3300028381 Bacteria 706
150 Ga0307408_100009442 3300031548 Bacteria 6434
151 Ga0307408_100031641 3300031548 Bacteria 3686
152 Ga0307408_100049820 3300031548 Bacteria 3009
153 Ga0307408_100141476 3300031548 Bacteria 1889
154 Ga0307408_100178092 3300031548 Bacteria 1703
155 Ga0316578_10171676 3300031728 Bacteria 1307
156 Ga0307405_10228711 3300031731 Unclassified 1369
157 Ga0307405_10307402 3300031731 Unclassified 1205
158 Ga0307405_10329057 3300031731 Bacteria 1170
159 Ga0307405_10702941 3300031731 Bacteria 837
160 Ga0307413_10152553 3300031824 Bacteria 1612
161 Ga0307413_10493590 3300031824 Unclassified 981
162 Ga0307413_10508890 3300031824 Unclassified 968
163 Ga0307410_10063189 3300031852 Bacteria 2539
164 Ga0307410_10594734 3300031852 Bacteria 922
165 Ga0307406_10439787 3300031901 Unclassified 1043
166 Ga0307406_10982338 3300031901 Unclassified 723
167 Ga0307407_10001892 3300031903 Bacteria 7900
168 Ga0307412_10005630 3300031911 Bacteria 7034
169 Ga0307412_10850213 3300031911 Unclassified 796
170 Ga0307409_100028507 3300031995 Bacteria 3979
171 Ga0307409_100046680 3300031995 Bacteria 3281
172 Ga0307409_100070080 3300031995 Bacteria 2781
173 Ga0307409_100095394 3300031995 Bacteria 2451
174 Ga0307416_100007852 3300032002 Bacteria 6822
175 Ga0307416_100028292 3300032002 Bacteria 4165
176 Ga0307416_100069471 3300032002 Bacteria 2915
177 Ga0307416_100074188 3300032002 Bacteria 2841
178 Ga0307416_100145709 3300032002 Bacteria 2162
179 Ga0307416_100475414 3300032002 Unclassified 1308
180 Ga0307416_100489328 3300032002 Bacteria 1292
181 Ga0307416_100961943 3300032002 Bacteria 956
182 Ga0307414_10010630 3300032004 Bacteria 5352
183 Ga0307414_10176539 3300032004 Bacteria 1714
184 Ga0307414_10480043 3300032004 Bacteria 1096
185 Ga0307411_10000610 3300032005 Bacteria 12858
186 Ga0307411_10001922 3300032005 Bacteria 8878
187 Ga0307411_10010973 3300032005 Bacteria 4861
188 Ga0307411_10069734 3300032005 Bacteria 2375
189 Ga0307411_10143051 3300032005 Unclassified 1766
190 Ga0307411_10283755 3300032005 Bacteria 1319
191 Ga0307411_10438716 3300032005 Unclassified 1089
192 Ga0307415_100026757 3300032126 Bacteria 3644
193 Ga0307415_100086892 3300032126 Bacteria 2251
194 Ga0307415_100748062 3300032126 Unclassified 887
195 Ga0373962_0147091 3300035242 Archaea 769
196 Ga0439433_0032103 3300041999 Bacteria 1204
197 Ga0439451_074291 3300042009 Unclassified 681
198 Ga0450908_031448 3300042184 Bacteria 922
199 Ga0439435_0031093 3300042436 Bacteria 1450
200 Ga0451577_0553992 3300042876 Bacteria 1044
201 Ga0451577_0674983 3300042876 Bacteria 936
202 Ga0453684_0048044 3300044712 Bacteria 5650
203 Ga0453684_0316460 3300044712 Bacteria 1769
204 Ga0453684_1072988 3300044712 Unclassified 852
205 Ga0451576_0135012 3300045051 Bacteria 2573
206 Ga0451576_0334105 3300045051 Bacteria 1586
207 Ga0466967_0228445 3300045976 Bacteria 1771
208 Ga0466967_0513567 3300045976 Unclassified 1177
209 Ga0495643_0002526 3300046522 Bacteria 14357
210 Ga0495598_0015492 3300046537 Unclassified 1926
211 Ga0495633_0036222 3300046558 Bacteria 2365
212 Ga0495670_0097279 3300046691 Bacteria 1512
213 Ga0495672_0425399 3300047320 Unclassified 603
214 Ga0495684_0174962 3300047471 Bacteria 1594
215 Ga0496114_0551067 3300048917 Bacteria 1019
216 Ga0501299_002452 3300049522 Bacteria 2567
217 Ga0501034_0636572 3300049571 Bacteria 969
218 Ga0501036_0027182 3300049572 Bacteria 4834
219 Ga0501036_0382114 3300049572 Bacteria 1175
220 Ga0501037_0279803 3300049573 Unclassified 1163
221 Ga0501039_0542720 3300049575 Unclassified 912
222 Ga0501040_0030111 3300049576 Bacteria 3664
223 Ga0501041_0022304 3300049577 Bacteria 3790
224 Ga0501041_0251519 3300049577 Bacteria 1111
225 Ga0501042_0014265 3300049578 Bacteria 5421
226 Ga0501043_0205939 3300049579 Unclassified 1525
227 Ga0501046_0002991 3300049580 Bacteria 15623
228 Ga0501048_0366254 3300049582 Unclassified 1028
229 Ga0501068_0495181 3300049584 Unclassified 792
230 Ga0501071_0009233 3300049587 Bacteria 6558
231 Ga0501072_0052395 3300049588 Bacteria 3213
232 Ga0501072_0110542 3300049588 Bacteria 2187
233 Ga0501074_0053671 3300049590 Unclassified 2907
234 Ga0501074_0601690 3300049590 Unclassified 777
235 Ga0501075_0062156 3300049591 Bacteria 2815
236 Ga0501076_0002822 3300049592 Bacteria 12012
237 Ga0501077_0027592 3300049593 Bacteria 3605
238 Ga0501209_051463 3300049656 Unclassified 1125
239 Ga0501079_0017690 3300049741 Bacteria 5444
240 Ga0501080_0017961 3300049742 Bacteria 6547
241 Ga0501080_0560248 3300049742 Bacteria 1017
242 Ga0501081_0004648 3300049743 Bacteria 8828
243 Ga0501081_0040411 3300049743 Bacteria 3194
244 Ga0501081_0301253 3300049743 Bacteria 1176
245 Ga0501081_0524161 3300049743 Bacteria 884
246 Ga0501035_0502245 3300049822 Bacteria 998
247 Ga0501045_0003790 3300049824 Bacteria 10399
248 nmdc:mga05p37_13319_c1 3300050507 Bacteria 9850
249 nmdc:mga05p37_139176_c1 3300050507 Unclassified 2975
250 nmdc:mga05p37_179549_c1 3300050507 Unclassified 2576
251 nmdc:mga05p37_246454_c1 3300050507 Bacteria 2145
252 nmdc:mga05p37_27750_c1 3300050507 Bacteria 6896
253 nmdc:mga05p37_4217_c1 3300050507 Bacteria 16790
254 nmdc:mga05p37_45734_c1 3300050507 Bacteria 5382
255 nmdc:mga05p37_59325_c1 3300050507 Bacteria 4712
256 nmdc:mga05p37_653460_c1 3300050507 Unclassified 1177
257 nmdc:mga05p37_72757_c1 3300050507 Bacteria 4230
258 nmdc:mga05p37_91138_c1 3300050507 Bacteria 3756
259 nmdc:mga09592_241435_c1 3300050508 Unclassified 1565
260 nmdc:mga09592_361888_c1 3300050508 Unclassified 1255
261 nmdc:mga09592_81347_c1 3300050508 Bacteria 2760
262 nmdc:mga08y16_1712249_c1 3300050511 Bacteria 584
263 nmdc:mga08y16_773580_c1 3300050511 Unclassified 955
264 nmdc:mga08y16_81409_c1 3300050511 Bacteria 3376
265 nmdc:mga08y16_9_c1 3300050511 Bacteria 566088
266 nmdc:mga0n895_1017244_c1 3300050512 Bacteria 809
267 nmdc:mga0n895_157021_c1 3300050512 Bacteria 2306
268 nmdc:mga0n895_226585_c1 3300050512 Bacteria 1897
269 nmdc:mga0n895_283731_c1 3300050512 Bacteria 1679
270 nmdc:mga0n895_363126_c1 3300050512 Bacteria 1466
271 nmdc:mga0n895_64526_c1 3300050512 Unclassified 3623
272 nmdc:mga0n895_899866_c1 3300050512 Unclassified 870
273 nmdc:mga0rr50_109159_c1 3300050513 Bacteria 2187
274 nmdc:mga0rr50_170146_c1 3300050513 Unclassified 1775
275 nmdc:mga0rr50_24340_c1 3300050513 Unclassified 4193
276 nmdc:mga0rr50_9024_c1 3300050513 Bacteria 6240
277 nmdc:mga0a205_18074_c1 3300050515 Bacteria 6623
278 nmdc:mga0a205_30883_c1 3300050515 Bacteria 5132
279 nmdc:mga0a205_5934_c1 3300050515 Bacteria 11007
280 Ga0501084_0073143 3300054114 Bacteria 2870
281 Ga0590071_000070 3300059421 Bacteria 27672
282 Ga0590075_000153 3300059424 Bacteria 18600
283 Ga0590077_000308 3300059426 Bacteria 13849
284 Ga0590077_062144 3300059426 Bacteria 848
285 Ga0501082_0432761 3300060353 Bacteria 1149
286 Ga0501082_0651094 3300060353 Bacteria 922
287 Ga0501082_0718306 3300060353 Unclassified 874
288 Ga0530510_0156700 3300061734 Bacteria 1683
289 Ga0530510_0413645 3300061734 Bacteria 1017
290 Ga0075433_10023751
291 MBSR1b_contig_5684308
292 JGI25406J46586_10061779
293 Ga0065712_10003945
294 Ga0065707_10105892
295 Ga0070676_10118346
296 Ga0070670_100009230
297 Ga0070670_101224021
298 Ga0070680_100473792
299 Ga0070689_100038990
300 Ga0070687_100026845
301 Ga0070661_100136486
302 Ga0070668_100307444
303 Ga0070669_100056569
304 Ga0070669_100122229
305 Ga0070669_100375252
306 Ga0070669_100680917
307 Ga0070675_100384286
308 Ga0070671_100356293
309 Ga0070674_100144826
310 Ga0070674_100869094
311 Ga0070673_100002384
312 Ga0070673_100847292
313 Ga0070688_100034440
314 Ga0070659_100585098
315 Ga0070667_100162447
316 Ga0070703_10036016
317 Ga0070709_10934851
318 Ga0070714_100070206
319 Ga0070701_10029549
320 Ga0070701_10310983
321 Ga0070700_100441777
322 Ga0070694_100004457
323 Ga0070694_100010763
324 Ga0070694_100197853
325 Ga0070694_100483433
326 Ga0070708_100079045
327 Ga0070678_100556274
328 Ga0070662_100285194
329 Ga0070681_10106430
330 Ga0070681_10412696
331 Ga0070685_10086880
332 Ga0070706_100267226
333 Ga0070707_100130405
334 Ga0070707_100751496
335 Ga0070698_100327152
336 Ga0070698_100388273
337 Ga0070698_101036207
338 Ga0070699_100003786
339 Ga0070699_100221539
340 Ga0070699_100404090
341 Ga0070699_100426292
342 Ga0070697_100119446
343 Ga0070697_100222450
344 Ga0070695_100001381
345 Ga0070695_100002877
346 Ga0070696_100017821
347 Ga0070696_100424974
348 Ga0070704_100052878
349 Ga0068855_100141825
350 Ga0070664_100004294
351 Ga0070664_100312685
352 Ga0068859_100007888
353 Ga0068864_100030943
354 Ga0068864_100257278
355 Ga0068870_10508588
356 Ga0068858_100028506
357 Ga0068860_100533691
358 Ga0068862_100293299
359 Ga0081538_10132296
360 Ga0081540_1127062
361 Ga0081539_10003534
362 Ga0081539_10257042
363 Ga0075428_100001725
364 Ga0075433_10023743
365 Ga0075433_10054403
366 Ga0075433_10115597
367 Ga0075434_100002382
368 Ga0075434_100131299
369 Ga0075434_100211390
370 Ga0075434_100322963
371 Ga0075434_100367372
372 Ga0075434_100659997
373 Ga0075429_100027509
374 Ga0075429_100398892
375 Ga0075436_100017909
376 Ga0097620_100007888
377 Ga0075435_100000964
378 Ga0075435_100002288
379 Ga0075435_100042326
380 Ga0075435_100136385
381 Ga0075435_100499829
382 Ga0105240_10044088
383 Ga0105240_10567622
384 Ga0111539_10000014
385 Ga0111539_10446291
386 Ga0111539_10643090
387 Ga0114129_10000382
388 Ga0114129_10009222
389 Ga0114129_10013444
390 Ga0114129_10016294
391 Ga0114129_10017403
392 Ga0114129_10056212
393 Ga0114129_10080200
394 Ga0114129_10119965
395 Ga0114129_10460241
396 Ga0114129_10945219
397 Ga0114129_11025645
398 Ga0105243_10314570
399 Ga0157380_10079826
400 Ga0157380_10289576
401 Ga0157380_10567597
402 Ga0207697_10181977
403 Ga0207707_10063404
404 Ga0207695_10339952
405 Ga0207695_10619773
406 Ga0207660_10213860
407 Ga0207662_10022048
408 Ga0207649_10101325
409 Ga0207646_10105946
410 Ga0207646_10262499
411 Ga0207681_10309304
412 Ga0207650_10036346
413 Ga0207650_10446356
414 Ga0207659_10088304
415 Ga0207706_10324989
416 Ga0207706_10338413
417 Ga0207670_10004120
418 Ga0207669_10364905
419 Ga0207669_10378126
420 Ga0207691_10015939
421 Ga0207679_10017295
422 Ga0207667_10815075
423 Ga0207651_10033237
424 Ga0207651_10565106
425 Ga0207668_10283359
426 Ga0207640_10103111
427 Ga0207640_10234088
428 Ga0207703_10041076
429 Ga0207708_10459445
430 Ga0207676_10634381
431 Ga0207676_11107094
432 Ga0207675_100020637
433 Ga0207683_10716355
434 Ga0207428_10000005
435 Ga0207428_10084820
436 Ga0268265_10355331
437 Ga0268265_11118316
438 Ga0268264_11415181
439 Ga0307408_100009442
440 Ga0307408_100031641
441 Ga0307408_100049820
442 Ga0307408_100141476
443 Ga0307408_100178092
444 Ga0316578_10171676
445 Ga0307405_10228711
446 Ga0307405_10307402
447 Ga0307405_10329057
448 Ga0307405_10702941
449 Ga0307413_10152553
450 Ga0307413_10493590
451 Ga0307413_10508890
452 Ga0307410_10063189
453 Ga0307410_10594734
454 Ga0307406_10439787
455 Ga0307406_10982338
456 Ga0307407_10001892
457 Ga0307412_10005630
458 Ga0307412_10850213
459 Ga0307409_100028507
460 Ga0307409_100046680
461 Ga0307409_100070080
462 Ga0307409_100095394
463 Ga0307416_100007852
464 Ga0307416_100028292
465 Ga0307416_100069471
466 Ga0307416_100074188
467 Ga0307416_100145709
468 Ga0307416_100475414
469 Ga0307416_100489328
470 Ga0307416_100961943
471 Ga0307414_10010630
472 Ga0307414_10176539
473 Ga0307414_10480043
474 Ga0307411_10000610
475 Ga0307411_10001922
476 Ga0307411_10010973
477 Ga0307411_10069734
478 Ga0307411_10143051
479 Ga0307411_10283755
480 Ga0307411_10438716
481 Ga0307415_100026757
482 Ga0307415_100086892
483 Ga0307415_100748062
484 Ga0373962_0147091
485 Ga0439433_0032103
486 Ga0439451_074291
487 Ga0450908_031448
488 Ga0439435_0031093
489 Ga0451577_0553992
490 Ga0451577_0674983
491 Ga0453684_0048044
492 Ga0453684_0316460
493 Ga0453684_1072988
494 Ga0451576_0135012
495 Ga0451576_0334105
496 Ga0466967_0228445
497 Ga0466967_0513567
498 Ga0495643_0002526
499 Ga0495598_0015492
500 Ga0495633_0036222
501 Ga0495670_0097279
502 Ga0495672_0425399
503 Ga0495684_0174962
504 Ga0496114_0551067
505 Ga0501299_002452
506 Ga0501034_0636572
507 Ga0501036_0027182
508 Ga0501036_0382114
509 Ga0501037_0279803
510 Ga0501039_0542720
511 Ga0501040_0030111
512 Ga0501041_0022304
513 Ga0501041_0251519
514 Ga0501042_0014265
515 Ga0501043_0205939
516 Ga0501046_0002991
517 Ga0501048_0366254
518 Ga0501068_0495181
519 Ga0501071_0009233
520 Ga0501072_0052395
521 Ga0501072_0110542
522 Ga0501074_0053671
523 Ga0501074_0601690
524 Ga0501075_0062156
525 Ga0501076_0002822
526 Ga0501077_0027592
527 Ga0501209_051463
528 Ga0501079_0017690
529 Ga0501080_0017961
530 Ga0501080_0560248
531 Ga0501081_0004648
532 Ga0501081_0040411
533 Ga0501081_0301253
534 Ga0501081_0524161
535 Ga0501035_0502245
536 Ga0501045_0003790
537 nmdc:mga05p37_13319_c1
538 nmdc:mga05p37_139176_c1
539 nmdc:mga05p37_179549_c1
540 nmdc:mga05p37_246454_c1
541 nmdc:mga05p37_27750_c1
542 nmdc:mga05p37_4217_c1
543 nmdc:mga05p37_45734_c1
544 nmdc:mga05p37_59325_c1
545 nmdc:mga05p37_653460_c1
546 nmdc:mga05p37_72757_c1
547 nmdc:mga05p37_91138_c1
548 nmdc:mga09592_241435_c1
549 nmdc:mga09592_361888_c1
550 nmdc:mga09592_81347_c1
551 nmdc:mga08y16_1712249_c1
552 nmdc:mga08y16_773580_c1
553 nmdc:mga08y16_81409_c1
554 nmdc:mga08y16_9_c1
555 nmdc:mga0n895_1017244_c1
556 nmdc:mga0n895_157021_c1
557 nmdc:mga0n895_226585_c1
558 nmdc:mga0n895_283731_c1
559 nmdc:mga0n895_363126_c1
560 nmdc:mga0n895_64526_c1
561 nmdc:mga0n895_899866_c1
562 nmdc:mga0rr50_109159_c1
563 nmdc:mga0rr50_170146_c1
564 nmdc:mga0rr50_24340_c1
565 nmdc:mga0rr50_9024_c1
566 nmdc:mga0a205_18074_c1
567 nmdc:mga0a205_30883_c1
568 nmdc:mga0a205_5934_c1
569 Ga0501084_0073143
570 Ga0590071_000070
571 Ga0590075_000153
572 Ga0590077_000308
573 Ga0590077_062144
574 Ga0501082_0432761
575 Ga0501082_0651094
576 Ga0501082_0718306
577 Ga0530510_0156700
578 Ga0530510_0413645

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

60

168

0.85

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

86

170

0.81

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

55

178

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c26-assembly1.cif.gz_A-2 crystal structure of a putative acetyltransferase (np_394282.1) from thermoplasma acidophilum at 2.00 a resolution 0.8424 83 168
2evn-assembly1.cif.gz_A nmr solution structures of at1g77540 0.8409 83 143
1y9k-assembly3.cif.gz_C iaa acetyltransferase from bacillus cereus atcc 14579 0.8359 43 197
1yvk-assembly1.cif.gz_D crystal structure of the bacillis subtilis acetyltransferase in complex with coa, northeast structural genomics target sr237. 0.8282 43 199
7daj-assembly1.cif.gz_B the crystal structure of serotonin n-acetyltransferase in complex with acetyl-coa from oryza sativa 0.8254 82 164
ID Description Score Start End Superfamily
af_A0A286YBP0_57_178_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9093 83 160 3.40.630.30
af_Q54CC0_2_81_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8766 83 137 3.40.630.30
af_P9WQG5_1_155_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.874 83 197 3.40.630.30
af_K7LQW1_676_805_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8699 83 159 3.40.630.30
af_O64737_28_157_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8582 83 165 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A5B1M7Q0-F1-model_v4 [Ribosomal protein bS18]-alanine N-acetyltransferase (EC 2.3.1.266) 0.914 83 199 GO:0005737
GO:0008999
AF-A0A2K0U6K6-F1-model_v4 N-acetyltransferase domain-containing protein 0.9108 91 199 GO:0005737
GO:0008080
GO:1905502
AF-A0A7X4JRY5-F1-model_v4 GNAT family N-acetyltransferase 0.9011 81 165 GO:0016020
GO:0016747
AF-A0A101FN45-F1-model_v4 Ribosomal-protein-alanine acetyltransferase 0.8986 91 198 GO:0016747
AF-A0A4Q7WTA1-F1-model_v4 Acetyltransferase (GNAT) family protein 0.8976 44 199 GO:0016747

Map