F388858

General Info

Members Datasets Scaffolds Average Seq Length
288 142 576 486

Family's Representative Sequence

Representative Sequence 3300049592|Ga0501076_0110261|Ga0501076_0110261_620_2155
Length 506
Sequence VILDLTSPAHLALALLPELVLTAWSVVLLLLVGWRHRTAADLRLAAWTTGVALATTALAVWWLWWRRAGVDGLASMVAVDDYRFVTDMVFLGAAGITVLVSPQYLERERLLVPEFYLLLVFATIGMMLMGGAADLMVLFLGLETMSVGVYVMAAIDRRSPRAAEAGLKYFLLGAFASGFLLYGIALLYGATGTTNLVLIGAQVGMLDLAANPMLLAGIGXXXVGFAFKVAAVPFHTWAPDVYDGAPTPVTGFMATAVKAAAFAALFRVLVEALPGVPAAAAVMGGLAVVTMVVGNLVALAQRSLKRMLAWSSVAHAGYLLVAPSGTAAFLVYIVAYSATTLAAFTIVAWLGRGGESDVRIDDLAGLASRHPWIAFGLAVCMLSLLGFPGTVGFIGKWTVLLAAVEAGRWTLAVVLVVTSVVSAGFYLPVLMAAYMKPPAHDGAHRDTRLAGLVRASVVVAVAAVLALGVRPQPLLDIARETGASLRPTAVFTAGASAPAAEPTVAR

Samples

Sample ID Description Type Environment
1 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
88 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
89 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
98 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
99 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
100 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
101 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
102 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
103 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
104 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
105 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
106 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
107 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
108 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
109 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
110 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
111 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
112 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
113 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
114 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
119 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
120 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
121 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
122 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
123 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
124 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
125 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
126 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
127 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
128 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
129 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
130 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
131 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
132 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
135 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
136 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
137 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
138 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
139 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
140 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
141 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
142 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.25
Rhizosphere 93.75
Stem 0
Stem Tuber 0
Unclassified 1.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501076_0110261 3300049592 Bacteria 2225
2 Ga0070676_10005074 3300005328 Bacteria 6983
3 Ga0070670_100135948 3300005331 Bacteria 2124
4 Ga0070677_10036404 3300005333 Bacteria 1914
5 Ga0070680_100012032 3300005336 Bacteria 6713
6 Ga0070691_10062438 3300005341 Unclassified 1794
7 Ga0070669_100103056 3300005353 Bacteria 2155
8 Ga0070675_100163877 3300005354 Unclassified 1914
9 Ga0070671_100055915 3300005355 Bacteria 3283
10 Ga0070674_100000493 3300005356 Bacteria 19842
11 Ga0070703_10000072 3300005406 Bacteria 50010
12 Ga0070703_10003824 3300005406 Bacteria 4258
13 Ga0070703_10009579 3300005406 Bacteria 2733
14 Ga0070711_100000082 3300005439 Bacteria 52402
15 Ga0070711_100016962 3300005439 Bacteria 4631
16 Ga0070705_100000906 3300005440 Bacteria 16561
17 Ga0070705_100007671 3300005440 Bacteria 5322
18 Ga0070705_100009381 3300005440 Bacteria 4864
19 Ga0070694_100002082 3300005444 Bacteria 11878
20 Ga0070694_100002853 3300005444 Bacteria 10263
21 Ga0070694_100010991 3300005444 Bacteria 5599
22 Ga0070694_100024985 3300005444 Bacteria 3861
23 Ga0070694_100078917 3300005444 Bacteria 2284
24 Ga0070708_100002874 3300005445 Bacteria 13363
25 Ga0070708_100011383 3300005445 Bacteria 7237
26 Ga0070708_100025946 3300005445 Bacteria 5012
27 Ga0070678_100001265 3300005456 Bacteria 13416
28 Ga0070662_100001259 3300005457 Bacteria 15571
29 Ga0068867_100003191 3300005459 Bacteria 11554
30 Ga0070706_100008602 3300005467 Bacteria 9515
31 Ga0070706_100020252 3300005467 Bacteria 6131
32 Ga0070706_100069826 3300005467 Bacteria 3249
33 Ga0070706_100167081 3300005467 Bacteria 2054
34 Ga0070707_100055254 3300005468 Bacteria 3806
35 Ga0070707_100088041 3300005468 Bacteria 3004
36 Ga0070707_100277498 3300005468 Bacteria 1629
37 Ga0070698_100000037 3300005471 Bacteria 92307
38 Ga0070698_100106377 3300005471 Bacteria 2774
39 Ga0070699_100005020 3300005518 Bacteria 11653
40 Ga0070699_100008095 3300005518 Bacteria 9126
41 Ga0070699_100011684 3300005518 Bacteria 7581
42 Ga0070699_100012811 3300005518 Bacteria 7228
43 Ga0070699_100012895 3300005518 Bacteria 7204
44 Ga0070699_100069086 3300005518 Bacteria 3069
45 Ga0070699_100092199 3300005518 Bacteria 2650
46 Ga0070679_100083584 3300005530 Bacteria 3181
47 Ga0070697_100004258 3300005536 Bacteria 10968
48 Ga0070697_100007748 3300005536 Bacteria 8364
49 Ga0070697_100010953 3300005536 Bacteria 7084
50 Ga0070697_100017595 3300005536 Bacteria 5627
51 Ga0070697_100022342 3300005536 Bacteria 5021
52 Ga0070697_100029248 3300005536 Bacteria 4416
53 Ga0070697_100119036 3300005536 Bacteria 2207
54 Ga0070697_100130984 3300005536 Bacteria 2103
55 Ga0070697_100186331 3300005536 Bacteria 1760
56 Ga0070695_100004904 3300005545 Bacteria 7887
57 Ga0070695_100009251 3300005545 Bacteria 5857
58 Ga0070695_100012109 3300005545 Bacteria 5170
59 Ga0070695_100017351 3300005545 Bacteria 4365
60 Ga0070696_100000364 3300005546 Bacteria 27704
61 Ga0070696_100001799 3300005546 Bacteria 14064
62 Ga0070696_100042271 3300005546 Bacteria 3152
63 Ga0070696_100069924 3300005546 Unclassified 2468
64 Ga0070693_100028555 3300005547 Bacteria 3034
65 Ga0070704_100000705 3300005549 Bacteria 16279
66 Ga0070704_100002345 3300005549 Bacteria 10623
67 Ga0070704_100002360 3300005549 Bacteria 10594
68 Ga0070704_100038850 3300005549 Bacteria 3264
69 Ga0070664_100012512 3300005564 Bacteria 6902
70 Ga0068854_100002496 3300005578 Bacteria 11405
71 Ga0070702_100015304 3300005615 Bacteria 3915
72 Ga0068859_100085012 3300005617 Bacteria 3209
73 Ga0068864_100003845 3300005618 Bacteria 12371
74 Ga0068864_100034548 3300005618 Bacteria 4301
75 Ga0068866_10000778 3300005718 Bacteria 14329
76 Ga0068870_10027474 3300005840 Bacteria 2846
77 Ga0068863_100017370 3300005841 Bacteria 6898
78 Ga0070716_100062682 3300006173 Bacteria 2156
79 Ga0075428_100020729 3300006844 Bacteria 7277
80 Ga0075428_100060462 3300006844 Bacteria 4148
81 Ga0075430_100192123 3300006846 Bacteria 1697
82 Ga0075431_100003686 3300006847 Bacteria 14880
83 Ga0075431_100019193 3300006847 Bacteria 6968
84 Ga0075433_10144144 3300006852 Bacteria 2117
85 Ga0075434_100003859 3300006871 Bacteria 13410
86 Ga0075434_100004348 3300006871 Bacteria 12750
87 Ga0075434_100005740 3300006871 Bacteria 11331
88 Ga0075434_100049497 3300006871 Bacteria 4172
89 Ga0075434_100062407 3300006871 Bacteria 3709
90 Ga0075434_100207088 3300006871 Bacteria 1982
91 Ga0075436_100002864 3300006914 Bacteria 11815
92 Ga0075436_100033576 3300006914 Bacteria 3538
93 Ga0075436_100069734 3300006914 Bacteria 2429
94 Ga0075436_100087376 3300006914 Bacteria 2166
95 Ga0075436_100112459 3300006914 Bacteria 1901
96 Ga0097620_100085012 3300006931 Bacteria 3209
97 Ga0075435_100003527 3300007076 Bacteria 10617
98 Ga0075435_100018617 3300007076 Bacteria 5288
99 Ga0099794_10000064 3300007265 Bacteria 40634
100 Ga0099794_10009952 3300007265 Bacteria 4023
101 Ga0105240_10178876 3300009093 Bacteria 2505
102 Ga0111539_10073374 3300009094 Bacteria 4035
103 Ga0111539_10190619 3300009094 Bacteria 2392
104 Ga0114129_10064244 3300009147 Bacteria 5122
105 Ga0114129_10192856 3300009147 Bacteria 2765
106 Ga0105243_10003291 3300009148 Bacteria 13126
107 Ga0105242_10003434 3300009176 Bacteria 12313
108 Ga0105249_10018674 3300009553 Bacteria 6175
109 Ga0105239_10050097 3300010375 Bacteria 4581
110 Ga0157378_10000421 3300013297 Bacteria 41701
111 Ga0163162_10021372 3300013306 Bacteria 6372
112 Ga0157379_10032766 3300014968 Bacteria 4633
113 Ga0207653_10000053 3300025885 Bacteria 87641
114 Ga0207653_10002937 3300025885 Bacteria 5406
115 Ga0207653_10019269 3300025885 Bacteria 2151
116 Ga0207645_10005465 3300025907 Bacteria 9198
117 Ga0207643_10004794 3300025908 Bacteria 7248
118 Ga0207684_10013127 3300025910 Bacteria 7170
119 Ga0207684_10016059 3300025910 Bacteria 6429
120 Ga0207684_10043221 3300025910 Bacteria 3819
121 Ga0207684_10122256 3300025910 Bacteria 2232
122 Ga0207707_10002467 3300025912 Bacteria 16652
123 Ga0207663_10000059 3300025916 Bacteria 56317
124 Ga0207663_10025939 3300025916 Bacteria 3395
125 Ga0207662_10088179 3300025918 Unclassified 1905
126 Ga0207652_10005142 3300025921 Bacteria 10613
127 Ga0207646_10002302 3300025922 Bacteria 22670
128 Ga0207646_10009808 3300025922 Bacteria 9429
129 Ga0207646_10027166 3300025922 Bacteria 5219
130 Ga0207646_10038517 3300025922 Bacteria 4306
131 Ga0207646_10074286 3300025922 Bacteria 3037
132 Ga0207646_10083388 3300025922 Bacteria 2859
133 Ga0207646_10110567 3300025922 Bacteria 2466
134 Ga0207681_10031594 3300025923 Bacteria 3459
135 Ga0207687_10014420 3300025927 Bacteria 5171
136 Ga0207644_10040830 3300025931 Bacteria 3280
137 Ga0207706_10000233 3300025933 Bacteria 60777
138 Ga0207686_10000067 3300025934 Bacteria 94339
139 Ga0207709_10003816 3300025935 Bacteria 8846
140 Ga0207669_10001925 3300025937 Bacteria 8800
141 Ga0207665_10031933 3300025939 Bacteria 3486
142 Ga0207665_10126962 3300025939 Bacteria 1807
143 Ga0207689_10010212 3300025942 Bacteria 8091
144 Ga0207679_10029962 3300025945 Bacteria 3794
145 Ga0207679_10129658 3300025945 Bacteria 2021
146 Ga0207712_10000422 3300025961 Bacteria 36283
147 Ga0207640_10040208 3300025981 Bacteria 2964
148 Ga0207658_10013320 3300025986 Bacteria 5617
149 Ga0207641_10011415 3300026088 Bacteria 7291
150 Ga0207676_10005584 3300026095 Bacteria 8901
151 Ga0207676_10011031 3300026095 Bacteria 6448
152 Ga0207674_10084711 3300026116 Bacteria 3167
153 Ga0207675_100032794 3300026118 Bacteria 4839
154 Ga0207683_10002858 3300026121 Bacteria 15062
155 Ga0209588_1002612 3300027671 Bacteria 4902
156 Ga0268264_10009432 3300028381 Bacteria 8083
157 Ga0307408_100006769 3300031548 Bacteria 7599
158 Ga0307408_100012447 3300031548 Bacteria 5636
159 Ga0307408_100018442 3300031548 Bacteria 4685
160 Ga0307408_100036377 3300031548 Bacteria 3461
161 Ga0307408_100038992 3300031548 Bacteria 3355
162 Ga0307408_100054077 3300031548 Bacteria 2902
163 Ga0307405_10011298 3300031731 Bacteria 4672
164 Ga0307405_10047773 3300031731 Bacteria 2637
165 Ga0307413_10000521 3300031824 Bacteria 12723
166 Ga0307413_10086686 3300031824 Bacteria 2025
167 Ga0307410_10005063 3300031852 Bacteria 6927
168 Ga0307410_10016007 3300031852 Bacteria 4460
169 Ga0307410_10017093 3300031852 Bacteria 4346
170 Ga0307410_10018133 3300031852 Bacteria 4247
171 Ga0307406_10141433 3300031901 Bacteria 1704
172 Ga0307407_10046036 3300031903 Bacteria 2468
173 Ga0307407_10101441 3300031903 Bacteria 1787
174 Ga0307409_100002426 3300031995 Bacteria 9740
175 Ga0307409_100045629 3300031995 Bacteria 3310
176 Ga0307409_100072736 3300031995 Bacteria 2739
177 Ga0307416_100002505 3300032002 Bacteria 10561
178 Ga0307416_100019989 3300032002 Bacteria 4764
179 Ga0307414_10009946 3300032004 Bacteria 5489
180 Ga0307414_10014346 3300032004 Bacteria 4749
181 Ga0307414_10092650 3300032004 Bacteria 2250
182 Ga0307411_10001515 3300032005 Bacteria 9568
183 Ga0307411_10013491 3300032005 Bacteria 4510
184 Ga0307411_10014293 3300032005 Bacteria 4411
185 Ga0307411_10023620 3300032005 Bacteria 3646
186 Ga0307411_10109953 3300032005 Bacteria 1970
187 Ga0307415_100039817 3300032126 Bacteria 3110
188 Ga0242420_003007 3300038996 Bacteria 2462
189 Ga0451577_0004271 3300042876 Bacteria 15192
190 Ga0451576_0015064 3300045051 Bacteria 8586
191 Ga0451576_0018328 3300045051 Bacteria 7677
192 Ga0451576_0032682 3300045051 Bacteria 5535
193 Ga0451576_0064729 3300045051 Bacteria 3808
194 Ga0495603_0014319 3300046455 Bacteria 4797
195 Ga0495580_0145481 3300046472 Bacteria 1643
196 Ga0495609_0059398 3300046538 Bacteria 1691
197 Ga0495621_0004849 3300046539 Bacteria 3817
198 Ga0496101_0045695 3300048904 Bacteria 3138
199 Ga0496102_0009462 3300048905 Bacteria 8375
200 Ga0496104_0008254 3300048907 Bacteria 9246
201 Ga0496106_0030766 3300048909 Bacteria 4001
202 Ga0496108_0001015 3300048911 Bacteria 21893
203 Ga0496108_0008330 3300048911 Bacteria 8408
204 Ga0496108_0024455 3300048911 Bacteria 4972
205 Ga0496109_0003846 3300048912 Bacteria 12538
206 Ga0496109_0009087 3300048912 Bacteria 8461
207 Ga0496109_0009800 3300048912 Bacteria 8179
208 Ga0496110_0008698 3300048913 Bacteria 8175
209 Ga0496110_0012808 3300048913 Bacteria 6908
210 Ga0496111_0191503 3300048914 Bacteria 1520
211 Ga0496112_0000777 3300048915 Bacteria 22477
212 Ga0496112_0001653 3300048915 Bacteria 17323
213 Ga0496112_0031135 3300048915 Bacteria 5170
214 Ga0496113_0000735 3300048916 Bacteria 16815
215 Ga0496113_0046636 3300048916 Bacteria 3217
216 Ga0501034_0000957 3300049571 Bacteria 41717
217 Ga0501034_0041019 3300049571 Bacteria 4683
218 Ga0501040_0080208 3300049576 Bacteria 2260
219 Ga0501042_0049463 3300049578 Bacteria 2999
220 Ga0501046_0017939 3300049580 Bacteria 5898
221 Ga0501067_0000453 3300049583 Bacteria 22520
222 Ga0501067_0001051 3300049583 Bacteria 14859
223 Ga0501067_0006666 3300049583 Bacteria 6408
224 Ga0501068_0000075 3300049584 Bacteria 39857
225 Ga0501068_0002185 3300049584 Bacteria 10424
226 Ga0501069_0000201 3300049585 Bacteria 26361
227 Ga0501069_0000583 3300049585 Bacteria 16870
228 Ga0501069_0010014 3300049585 Bacteria 5012
229 Ga0501070_0002218 3300049586 Bacteria 17067
230 Ga0501070_0002776 3300049586 Bacteria 15278
231 Ga0501070_0086124 3300049586 Bacteria 2601
232 Ga0501071_0000468 3300049587 Bacteria 20369
233 Ga0501071_0001022 3300049587 Bacteria 15424
234 Ga0501071_0015057 3300049587 Bacteria 5303
235 Ga0501072_0002414 3300049588 Bacteria 14002
236 Ga0501072_0056275 3300049588 Bacteria 3100
237 Ga0501072_0060815 3300049588 Bacteria 2978
238 Ga0501073_0001702 3300049589 Bacteria 16308
239 Ga0501073_0083435 3300049589 Bacteria 2223
240 Ga0501074_0000981 3300049590 Bacteria 18483
241 Ga0501074_0010158 3300049590 Bacteria 6834
242 Ga0501074_0035570 3300049590 Bacteria 3609
243 Ga0501074_0094542 3300049590 Bacteria 2140
244 Ga0501075_0010875 3300049591 Bacteria 6419
245 Ga0501075_0016169 3300049591 Bacteria 5370
246 Ga0501076_0044895 3300049592 Bacteria 3487
247 Ga0501076_0054538 3300049592 Bacteria 3168
248 Ga0501076_0075604 3300049592 Bacteria 2700
249 Ga0501077_0000496 3300049593 Bacteria 23850
250 Ga0501077_0006491 3300049593 Bacteria 7182
251 Ga0501079_0001564 3300049741 Bacteria 16235
252 Ga0501080_0011589 3300049742 Bacteria 8075
253 Ga0501080_0078289 3300049742 Bacteria 3075
254 Ga0501080_0092087 3300049742 Bacteria 2816
255 Ga0501081_0045051 3300049743 Bacteria 3029
256 Ga0501081_0069194 3300049743 Bacteria 2459
257 Ga0501081_0171749 3300049743 Bacteria 1565
258 Ga0501083_0000108 3300049744 Bacteria 55825
259 Ga0501083_0005191 3300049744 Bacteria 9215
260 Ga0501045_0021877 3300049824 Bacteria 4575
261 Ga0501045_0070647 3300049824 Bacteria 2569
262 nmdc:mga09592_110260_c1 3300050508 Bacteria 2361
263 nmdc:mga0qj67_100015_c1 3300050509 Bacteria 2337
264 nmdc:mga0n895_18223_c1 3300050512 Bacteria 6492
265 nmdc:mga0n895_18678_c1 3300050512 Bacteria 6422
266 nmdc:mga0n895_31248_c1 3300050512 Bacteria 5097
267 nmdc:mga0n895_42614_c1 3300050512 Bacteria 4417
268 nmdc:mga0n895_5129_c1 3300050512 Bacteria 10887
269 nmdc:mga0rr50_34228_c1 3300050513 Bacteria 3637
270 nmdc:mga0rr50_58907_c1 3300050513 Bacteria 2881
271 nmdc:mga0rr50_80333_c1 3300050513 Bacteria 2514
272 nmdc:mga0rr50_86747_c1 3300050513 Bacteria 2429
273 nmdc:mga08x19_20627_c1 3300050514 Bacteria 4058
274 nmdc:mga08x19_3259_c1 3300050514 Bacteria 9722
275 nmdc:mga08x19_52470_c1 3300050514 Bacteria 2623
276 nmdc:mga08x19_7396_c1 3300050514 Bacteria 6521
277 nmdc:mga0a205_2075_c1 3300050515 Bacteria 17529
278 nmdc:mga0a205_43035_c1 3300050515 Bacteria 4354
279 nmdc:mga0a205_99332_c2 3300050515 Bacteria 2612
280 Ga0501084_0004050 3300054114 Bacteria 11935
281 Ga0501084_0006504 3300054114 Bacteria 9605
282 Ga0501084_0024001 3300054114 Bacteria 5086
283 Ga0501084_0079434 3300054114 Bacteria 2749
284 Ga0590075_005076 3300059424 Bacteria 3113
285 Ga0590077_011182 3300059426 Bacteria 1851
286 Ga0501082_0001928 3300060353 Bacteria 18242
287 Ga0501082_0009681 3300060353 Bacteria 8298
288 Ga0501082_0083537 3300060353 Bacteria 2755
289 Ga0501076_0110261
290 Ga0070676_10005074
291 Ga0070670_100135948
292 Ga0070677_10036404
293 Ga0070680_100012032
294 Ga0070691_10062438
295 Ga0070669_100103056
296 Ga0070675_100163877
297 Ga0070671_100055915
298 Ga0070674_100000493
299 Ga0070703_10000072
300 Ga0070703_10003824
301 Ga0070703_10009579
302 Ga0070711_100000082
303 Ga0070711_100016962
304 Ga0070705_100000906
305 Ga0070705_100007671
306 Ga0070705_100009381
307 Ga0070694_100002082
308 Ga0070694_100002853
309 Ga0070694_100010991
310 Ga0070694_100024985
311 Ga0070694_100078917
312 Ga0070708_100002874
313 Ga0070708_100011383
314 Ga0070708_100025946
315 Ga0070678_100001265
316 Ga0070662_100001259
317 Ga0068867_100003191
318 Ga0070706_100008602
319 Ga0070706_100020252
320 Ga0070706_100069826
321 Ga0070706_100167081
322 Ga0070707_100055254
323 Ga0070707_100088041
324 Ga0070707_100277498
325 Ga0070698_100000037
326 Ga0070698_100106377
327 Ga0070699_100005020
328 Ga0070699_100008095
329 Ga0070699_100011684
330 Ga0070699_100012811
331 Ga0070699_100012895
332 Ga0070699_100069086
333 Ga0070699_100092199
334 Ga0070679_100083584
335 Ga0070697_100004258
336 Ga0070697_100007748
337 Ga0070697_100010953
338 Ga0070697_100017595
339 Ga0070697_100022342
340 Ga0070697_100029248
341 Ga0070697_100119036
342 Ga0070697_100130984
343 Ga0070697_100186331
344 Ga0070695_100004904
345 Ga0070695_100009251
346 Ga0070695_100012109
347 Ga0070695_100017351
348 Ga0070696_100000364
349 Ga0070696_100001799
350 Ga0070696_100042271
351 Ga0070696_100069924
352 Ga0070693_100028555
353 Ga0070704_100000705
354 Ga0070704_100002345
355 Ga0070704_100002360
356 Ga0070704_100038850
357 Ga0070664_100012512
358 Ga0068854_100002496
359 Ga0070702_100015304
360 Ga0068859_100085012
361 Ga0068864_100003845
362 Ga0068864_100034548
363 Ga0068866_10000778
364 Ga0068870_10027474
365 Ga0068863_100017370
366 Ga0070716_100062682
367 Ga0075428_100020729
368 Ga0075428_100060462
369 Ga0075430_100192123
370 Ga0075431_100003686
371 Ga0075431_100019193
372 Ga0075433_10144144
373 Ga0075434_100003859
374 Ga0075434_100004348
375 Ga0075434_100005740
376 Ga0075434_100049497
377 Ga0075434_100062407
378 Ga0075434_100207088
379 Ga0075436_100002864
380 Ga0075436_100033576
381 Ga0075436_100069734
382 Ga0075436_100087376
383 Ga0075436_100112459
384 Ga0097620_100085012
385 Ga0075435_100003527
386 Ga0075435_100018617
387 Ga0099794_10000064
388 Ga0099794_10009952
389 Ga0105240_10178876
390 Ga0111539_10073374
391 Ga0111539_10190619
392 Ga0114129_10064244
393 Ga0114129_10192856
394 Ga0105243_10003291
395 Ga0105242_10003434
396 Ga0105249_10018674
397 Ga0105239_10050097
398 Ga0157378_10000421
399 Ga0163162_10021372
400 Ga0157379_10032766
401 Ga0207653_10000053
402 Ga0207653_10002937
403 Ga0207653_10019269
404 Ga0207645_10005465
405 Ga0207643_10004794
406 Ga0207684_10013127
407 Ga0207684_10016059
408 Ga0207684_10043221
409 Ga0207684_10122256
410 Ga0207707_10002467
411 Ga0207663_10000059
412 Ga0207663_10025939
413 Ga0207662_10088179
414 Ga0207652_10005142
415 Ga0207646_10002302
416 Ga0207646_10009808
417 Ga0207646_10027166
418 Ga0207646_10038517
419 Ga0207646_10074286
420 Ga0207646_10083388
421 Ga0207646_10110567
422 Ga0207681_10031594
423 Ga0207687_10014420
424 Ga0207644_10040830
425 Ga0207706_10000233
426 Ga0207686_10000067
427 Ga0207709_10003816
428 Ga0207669_10001925
429 Ga0207665_10031933
430 Ga0207665_10126962
431 Ga0207689_10010212
432 Ga0207679_10029962
433 Ga0207679_10129658
434 Ga0207712_10000422
435 Ga0207640_10040208
436 Ga0207658_10013320
437 Ga0207641_10011415
438 Ga0207676_10005584
439 Ga0207676_10011031
440 Ga0207674_10084711
441 Ga0207675_100032794
442 Ga0207683_10002858
443 Ga0209588_1002612
444 Ga0268264_10009432
445 Ga0307408_100006769
446 Ga0307408_100012447
447 Ga0307408_100018442
448 Ga0307408_100036377
449 Ga0307408_100038992
450 Ga0307408_100054077
451 Ga0307405_10011298
452 Ga0307405_10047773
453 Ga0307413_10000521
454 Ga0307413_10086686
455 Ga0307410_10005063
456 Ga0307410_10016007
457 Ga0307410_10017093
458 Ga0307410_10018133
459 Ga0307406_10141433
460 Ga0307407_10046036
461 Ga0307407_10101441
462 Ga0307409_100002426
463 Ga0307409_100045629
464 Ga0307409_100072736
465 Ga0307416_100002505
466 Ga0307416_100019989
467 Ga0307414_10009946
468 Ga0307414_10014346
469 Ga0307414_10092650
470 Ga0307411_10001515
471 Ga0307411_10013491
472 Ga0307411_10014293
473 Ga0307411_10023620
474 Ga0307411_10109953
475 Ga0307415_100039817
476 Ga0242420_003007
477 Ga0451577_0004271
478 Ga0451576_0015064
479 Ga0451576_0018328
480 Ga0451576_0032682
481 Ga0451576_0064729
482 Ga0495603_0014319
483 Ga0495580_0145481
484 Ga0495609_0059398
485 Ga0495621_0004849
486 Ga0496101_0045695
487 Ga0496102_0009462
488 Ga0496104_0008254
489 Ga0496106_0030766
490 Ga0496108_0001015
491 Ga0496108_0008330
492 Ga0496108_0024455
493 Ga0496109_0003846
494 Ga0496109_0009087
495 Ga0496109_0009800
496 Ga0496110_0008698
497 Ga0496110_0012808
498 Ga0496111_0191503
499 Ga0496112_0000777
500 Ga0496112_0001653
501 Ga0496112_0031135
502 Ga0496113_0000735
503 Ga0496113_0046636
504 Ga0501034_0000957
505 Ga0501034_0041019
506 Ga0501040_0080208
507 Ga0501042_0049463
508 Ga0501046_0017939
509 Ga0501067_0000453
510 Ga0501067_0001051
511 Ga0501067_0006666
512 Ga0501068_0000075
513 Ga0501068_0002185
514 Ga0501069_0000201
515 Ga0501069_0000583
516 Ga0501069_0010014
517 Ga0501070_0002218
518 Ga0501070_0002776
519 Ga0501070_0086124
520 Ga0501071_0000468
521 Ga0501071_0001022
522 Ga0501071_0015057
523 Ga0501072_0002414
524 Ga0501072_0056275
525 Ga0501072_0060815
526 Ga0501073_0001702
527 Ga0501073_0083435
528 Ga0501074_0000981
529 Ga0501074_0010158
530 Ga0501074_0035570
531 Ga0501074_0094542
532 Ga0501075_0010875
533 Ga0501075_0016169
534 Ga0501076_0044895
535 Ga0501076_0054538
536 Ga0501076_0075604
537 Ga0501077_0000496
538 Ga0501077_0006491
539 Ga0501079_0001564
540 Ga0501080_0011589
541 Ga0501080_0078289
542 Ga0501080_0092087
543 Ga0501081_0045051
544 Ga0501081_0069194
545 Ga0501081_0171749
546 Ga0501083_0000108
547 Ga0501083_0005191
548 Ga0501045_0021877
549 Ga0501045_0070647
550 nmdc:mga09592_110260_c1
551 nmdc:mga0qj67_100015_c1
552 nmdc:mga0n895_18223_c1
553 nmdc:mga0n895_18678_c1
554 nmdc:mga0n895_31248_c1
555 nmdc:mga0n895_42614_c1
556 nmdc:mga0n895_5129_c1
557 nmdc:mga0rr50_34228_c1
558 nmdc:mga0rr50_58907_c1
559 nmdc:mga0rr50_80333_c1
560 nmdc:mga0rr50_86747_c1
561 nmdc:mga08x19_20627_c1
562 nmdc:mga08x19_3259_c1
563 nmdc:mga08x19_52470_c1
564 nmdc:mga08x19_7396_c1
565 nmdc:mga0a205_2075_c1
566 nmdc:mga0a205_43035_c1
567 nmdc:mga0a205_99332_c2
568 Ga0501084_0004050
569 Ga0501084_0006504
570 Ga0501084_0024001
571 Ga0501084_0079434
572 Ga0590075_005076
573 Ga0590077_011182
574 Ga0501082_0001928
575 Ga0501082_0009681
576 Ga0501082_0083537

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00361

Proton_antipo_M

Proton-conducting membrane transporter

132

422

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7aqq-assembly1.cif.gz_N cryo-em structure of arabidopsis thaliana complex-i (membrane core) 0.9202 14 487
8e73-assembly1.cif.gz_2M vigna radiata supercomplex i+iii2 (full bridge) 0.9125 14 486
6khj-assembly1.cif.gz_B supercomplex for electron transfer 0.9098 14 483
8e9h-assembly1.cif.gz_N mycobacterial respiratory complex i, fully-inserted quinone 0.9096 14 483
3rko-assembly2.cif.gz_D crystal structure of the membrane domain of respiratory complex i from e. coli at 3.0 angstrom resolution 0.9081 14 479
ID Description Score Start End Superfamily
af_P0AFF0_1_121_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8492 14 127 1.10.287.3510
af_P0AFF0_1_121_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7569 14 127 1.10.287.3510
af_Q8IKN3_1_243_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2911 180 431 1.20.1250.20
af_Q15057_1_255_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.2895 108 316 1.20.1270.60
af_Q9VPT6_30_248_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.2763 18 260 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A3D3CLX8-F1-model_v4 NADH:quinone oxidoreductase/Mrp antiporter transmembrane domain-containing protein 0.9717 261 476 GO:0012505
GO:0016020
AF-A0A351XEN3-F1-model_v4 NADH:quinone oxidoreductase/Mrp antiporter transmembrane domain-containing protein 0.9694 261 488 GO:0012505
GO:0016020
AF-A0A3N5ZDK6-F1-model_v4 NADH-quinone oxidoreductase subunit N 0.9586 84 486 GO:0005886
GO:0008137
GO:0012505
GO:0042773
AF-A0A3D3CLX8-F1-model_v4 NADH:quinone oxidoreductase/Mrp antiporter transmembrane domain-containing protein 0.9582 261 476 GO:0012505
GO:0016020
AF-A0A351XEN3-F1-model_v4 NADH:quinone oxidoreductase/Mrp antiporter transmembrane domain-containing protein 0.957 261 488 GO:0012505
GO:0016020

Map