F388706

General Info

Members Datasets Scaffolds Average Seq Length
288 203 576 282

Family's Representative Sequence

Representative Sequence 3300036459|Ga0372808_009603|Ga0372808_009603_120_1052
Length 310
Sequence MCPERHESDAGSGYGPDRKDDCMSEFRLTQISDTHLARRLTALTANFERVSEYVDATRPDLVVNSGDLAFDAPTQPDDLEFARVLHDALPVACRYLPGNHDIGDNPTQVGPAPSQPVTEKRRQAFIAAFGDDRWRFEAAGWCFIGLNSLVMNSTLVSEAEQFDWLASELASAAGKPVALFLHKPIYLNAPDDPELAATSIRYVPMPARRRLVEMLRSVDLRLVASGHVHQRRDYTFGGVRNIWAPSAGFIISDARQERIGVKEIGLVEYRFQPDSFEVRHVRAPGQVDVDLDSLLAKTPAQETERAKLVI

Samples

Sample ID Description Type Environment
1 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
26 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
30 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
42 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
43 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
63 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
64 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
65 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
66 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
67 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
68 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
69 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
70 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
71 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
72 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
73 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
74 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
75 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
76 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
77 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
78 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
79 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
80 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
81 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
82 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
83 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
84 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
85 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
86 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
95 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
96 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
97 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
98 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
99 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
100 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
101 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
102 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
103 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
104 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
105 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
106 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
107 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
108 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
109 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
110 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
111 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
112 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
113 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
114 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
115 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
116 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
117 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
118 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
119 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
120 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
121 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
122 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
123 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
124 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
125 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
126 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
127 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
128 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
129 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
130 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
131 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
132 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
133 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
134 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
135 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
136 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
137 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
138 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
139 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
140 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
141 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
142 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
143 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
144 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
145 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
148 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
149 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
150 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
151 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
152 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
153 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
158 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
163 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
164 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
165 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
166 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
167 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
168 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
169 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
170 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
171 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
172 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
173 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
174 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
175 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
176 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
177 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
178 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
179 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
180 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
181 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
182 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
183 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
184 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
185 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
186 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
187 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
188 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
189 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
190 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
191 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
192 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
193 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
194 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
195 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
196 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
197 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
198 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
199 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
200 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
201 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
202 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
203 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.18
Metatranscriptomes 0.35
Isolates 3.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.93
Nodule 2.08
Rhizoplane 0.69
Rhizosphere 74.65
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0372808_009603 3300036459 Bacteria 1353
2 Ga0070680_100014887 3300005336 Bacteria 6084
3 Ga0070682_100043887 3300005337 Bacteria 2766
4 Ga0070661_100404014 3300005344 Bacteria 1080
5 Ga0070674_100052454 3300005356 Bacteria 2813
6 Ga0070674_100365094 3300005356 Bacteria 1170
7 Ga0070709_10107367 3300005434 Bacteria 1871
8 Ga0070709_10148099 3300005434 Bacteria 1619
9 Ga0070714_100016867 3300005435 Bacteria 5908
10 Ga0070714_100061541 3300005435 Bacteria 3225
11 Ga0070714_100075179 3300005435 Bacteria 2931
12 Ga0070714_100535346 3300005435 Bacteria 1120
13 Ga0070713_100020030 3300005436 Bacteria 5121
14 Ga0070713_100224731 3300005436 Bacteria 1704
15 Ga0070710_10001849 3300005437 Bacteria 9973
16 Ga0070710_10042360 3300005437 Bacteria 2517
17 Ga0070711_100026385 3300005439 Bacteria 3807
18 Ga0070681_10021129 3300005458 Bacteria 6522
19 Ga0070681_10087316 3300005458 Bacteria 3072
20 Ga0070681_10371441 3300005458 Bacteria 1341
21 Ga0070679_100016868 3300005530 Bacteria 7059
22 Ga0070679_100054377 3300005530 Bacteria 3985
23 Ga0070679_100142548 3300005530 Bacteria 2375
24 Ga0070684_100010906 3300005535 Bacteria 7221
25 Ga0070684_100026872 3300005535 Bacteria 4852
26 Ga0068853_100110116 3300005539 Bacteria 2446
27 Ga0068855_100034770 3300005563 Bacteria 6006
28 Ga0068855_100209735 3300005563 Bacteria 2189
29 Ga0068855_100704135 3300005563 Bacteria 1081
30 Ga0068854_100123471 3300005578 Bacteria 1969
31 Ga0068856_100000020 3300005614 Bacteria 146775
32 Ga0068856_100126902 3300005614 Bacteria 2555
33 Ga0068852_100042670 3300005616 Bacteria 3841
34 Ga0070717_10040820 3300006028 Bacteria 3782
35 Ga0070717_10047694 3300006028 Bacteria 3511
36 Ga0070717_10533868 3300006028 Bacteria 1062
37 Ga0075368_10015733 3300006042 Bacteria 2811
38 Ga0075364_10028053 3300006051 Bacteria 3601
39 Ga0070715_10012125 3300006163 Bacteria 3125
40 Ga0070712_100033513 3300006175 Bacteria 3476
41 Ga0070712_100047496 3300006175 Bacteria 2971
42 Ga0075367_10055093 3300006178 Bacteria 2359
43 Ga0075367_10151826 3300006178 Bacteria 1438
44 Ga0075369_10031951 3300006186 Bacteria 2225
45 Ga0068871_100059381 3300006358 Bacteria 3116
46 Ga0075434_100002422 3300006871 Bacteria 16387
47 Ga0075435_100026230 3300007076 Bacteria 4544
48 Ga0099794_10033233 3300007265 Bacteria 2425
49 Ga0099795_10017658 3300007788 Bacteria 2278
50 Ga0105240_10157459 3300009093 Bacteria 2700
51 Ga0105240_10663245 3300009093 Bacteria 1142
52 Ga0105241_10087993 3300009174 Bacteria 2445
53 Ga0105237_10062673 3300009545 Bacteria 3718
54 Ga0105238_10035432 3300009551 Bacteria 5074
55 Ga0105249_10236459 3300009553 Bacteria 1804
56 Ga0105239_10045490 3300010375 Bacteria 4811
57 Ga0105239_10148810 3300010375 Bacteria 2613
58 Ga0157370_10494228 3300013104 Bacteria 1124
59 Ga0157369_10010862 3300013105 Bacteria 10373
60 Ga0157369_10177800 3300013105 Bacteria 2240
61 Ga0157369_10264847 3300013105 Bacteria 1792
62 Ga0157369_10738001 3300013105 Bacteria 1013
63 Ga0157374_10098545 3300013296 Bacteria 2799
64 Ga0157372_10067851 3300013307 Bacteria 4009
65 Ga0213876_10009439 3300021384 Bacteria 5251
66 Ga0209758_1001092 3300025297 Bacteria 35145
67 Ga0207692_10006397 3300025898 Bacteria 4775
68 Ga0207699_10007610 3300025906 Bacteria 5303
69 Ga0207707_10009522 3300025912 Bacteria 8427
70 Ga0207707_10011411 3300025912 Bacteria 7738
71 Ga0207707_10214469 3300025912 Bacteria 1676
72 Ga0207707_10468369 3300025912 Bacteria 1077
73 Ga0207695_10469522 3300025913 Bacteria 1141
74 Ga0207693_10001875 3300025915 Bacteria 18415
75 Ga0207693_10007332 3300025915 Bacteria 9072
76 Ga0207663_10058775 3300025916 Bacteria 2429
77 Ga0207660_10037246 3300025917 Bacteria 3388
78 Ga0207652_10098478 3300025921 Bacteria 2579
79 Ga0207646_10145922 3300025922 Bacteria 2132
80 Ga0207700_10043952 3300025928 Bacteria 3285
81 Ga0207700_10088176 3300025928 Bacteria 2442
82 Ga0207664_10027202 3300025929 Bacteria 4333
83 Ga0207665_10312619 3300025939 Bacteria 1177
84 Ga0207661_10001655 3300025944 Bacteria 15191
85 Ga0207661_10027946 3300025944 Bacteria 4314
86 Ga0207667_10452116 3300025949 Bacteria 1305
87 Ga0207640_10146282 3300025981 Bacteria 1730
88 Ga0207678_10062793 3300026067 Bacteria 3192
89 Ga0207702_10002142 3300026078 Bacteria 18978
90 Ga0207698_10095782 3300026142 Bacteria 2444
91 Ga0209179_1044789 3300027512 Bacteria 938
92 Ga0265330_10022520 3300031235 Bacteria 2866
93 Ga0265330_10172675 3300031235 Bacteria 916
94 Ga0265325_10036032 3300031241 Bacteria 2624
95 Ga0265340_10013897 3300031247 Bacteria 4218
96 Ga0307509_10355708 3300031507 Bacteria 1186
97 Ga0307508_10000018 3300031616 Bacteria 202701
98 Ga0307508_10306349 3300031616 Bacteria 1181
99 Ga0265314_10226199 3300031711 Bacteria 1088
100 Ga0307510_10122896 3300033180 Bacteria 2294
101 Ga0373934_0074640 3300035086 Bacteria 1359
102 Ga0373944_0034020 3300035089 Bacteria 1547
103 Ga0373923_0059953 3300035111 Bacteria 1614
104 Ga0373936_0031880 3300035113 Bacteria 2083
105 Ga0373936_0090410 3300035113 Bacteria 1283
106 Ga0373945_0017914 3300035116 Bacteria 2404
107 Ga0373945_0019791 3300035116 Bacteria 2299
108 Ga0373953_0047406 3300035117 Bacteria 1728
109 Ga0373953_0074364 3300035117 Bacteria 1405
110 Ga0373954_0019404 3300035118 Bacteria 3066
111 Ga0373956_0002490 3300035119 Bacteria 7496
112 Ga0373956_0122891 3300035119 Bacteria 1213
113 Ga0373957_0004943 3300035120 Bacteria 4101
114 Ga0373943_0128641 3300035170 Bacteria 1353
115 Ga0373946_0006071 3300035171 Bacteria 4375
116 Ga0373955_0001626 3300035172 Bacteria 9614
117 Ga0373924_0024788 3300035410 Bacteria 2366
118 Ga0373935_0001116 3300035692 Bacteria 14637
119 Ga0373935_0010155 3300035692 Bacteria 5639
120 Ga0373927_0001437 3300035695 Bacteria 17974
121 Ga0373927_0014123 3300035695 Bacteria 5296
122 Ga0373927_0021625 3300035695 Bacteria 4217
123 Ga0373933_0155187 3300035724 Bacteria 1451
124 Ga0373947_0003173 3300035725 Bacteria 9781
125 Ga0373947_0010046 3300035725 Bacteria 5432
126 Ga0373937_0396399 3300036401 Bacteria 1309
127 Ga0373925_0027366 3300037068 Bacteria 4173
128 Ga0373925_0031532 3300037068 Bacteria 3896
129 Ga0373925_0113416 3300037068 Bacteria 2096
130 Ga0395899_0188802 3300037312 Bacteria 1443
131 Ga0395900_0587265 3300037418 Bacteria 1055
132 Ga0395898_0035823 3300037466 Bacteria 4932
133 Ga0395898_0067134 3300037466 Bacteria 3473
134 Ga0436364_0128776 3300037853 Bacteria 1913
135 Ga0395901_0204869 3300038443 Bacteria 2067
136 Ga0395901_0821106 3300038443 Bacteria 917
137 Ga0436365_1079672 3300039437 Bacteria 3870
138 Ga0436361_0310484 3300039447 Bacteria 2718
139 Ga0436361_0782426 3300039447 Bacteria 2003
140 Ga0436363_1211778 3300039450 Bacteria 5063
141 Ga0466971_0103352 3300044719 Bacteria 1311
142 Ga0495592_0002109 3300046454 Bacteria 14021
143 Ga0495592_0026853 3300046454 Bacteria 4365
144 Ga0495592_0044911 3300046454 Bacteria 3299
145 Ga0495603_0010484 3300046455 Bacteria 5615
146 Ga0495603_0205798 3300046455 Bacteria 1137
147 Ga0495629_0000726 3300046459 Bacteria 26748
148 Ga0495629_0008557 3300046459 Bacteria 7535
149 Ga0495629_0044950 3300046459 Bacteria 3099
150 Ga0495638_0047999 3300046460 Bacteria 2674
151 Ga0495638_0063039 3300046460 Bacteria 2286
152 Ga0495641_0000747 3300046461 Bacteria 27535
153 Ga0495651_0001234 3300046462 Bacteria 19776
154 Ga0495653_0000358 3300046463 Bacteria 36893
155 Ga0495653_0042802 3300046463 Bacteria 3524
156 Ga0495580_0012590 3300046472 Bacteria 6483
157 Ga0495580_0135925 3300046472 Bacteria 1704
158 Ga0495582_0000416 3300046473 Bacteria 23251
159 Ga0495639_0000165 3300046475 Bacteria 34551
160 Ga0495639_0105226 3300046475 Bacteria 1335
161 Ga0495662_0000066 3300046476 Bacteria 36870
162 Ga0495662_0141152 3300046476 Bacteria 1186
163 Ga0495664_0005316 3300046477 Bacteria 7062
164 Ga0495664_0013023 3300046477 Bacteria 4715
165 Ga0495594_0000441 3300046499 Bacteria 20981
166 Ga0495583_0091381 3300046506 Bacteria 1310
167 Ga0495608_0002274 3300046511 Bacteria 13858
168 Ga0495610_0078607 3300046512 Bacteria 1520
169 Ga0495620_0026479 3300046515 Bacteria 2727
170 Ga0495628_0008060 3300046516 Bacteria 9067
171 Ga0495628_0020389 3300046516 Bacteria 5469
172 Ga0495630_0008582 3300046517 Bacteria 7332
173 Ga0495630_0173245 3300046517 Bacteria 1644
174 Ga0495643_0136063 3300046522 Bacteria 1229
175 Ga0495652_0005186 3300046529 Bacteria 12313
176 Ga0495652_0158383 3300046529 Bacteria 1761
177 Ga0495652_0260546 3300046529 Bacteria 1280
178 Ga0495665_0000802 3300046531 Bacteria 16451
179 Ga0495640_0003534 3300046533 Bacteria 12566
180 Ga0495640_0008220 3300046533 Bacteria 8188
181 Ga0495640_0071682 3300046533 Bacteria 2324
182 Ga0495645_0008975 3300046543 Bacteria 6983
183 Ga0495667_0007508 3300046559 Bacteria 7398
184 Ga0495667_0021338 3300046559 Bacteria 4371
185 Ga0495667_0306502 3300046559 Bacteria 1006
186 Ga0495634_0002191 3300046642 Bacteria 16415
187 Ga0495634_0086160 3300046642 Bacteria 2046
188 Ga0495625_0088213 3300046660 Bacteria 2149
189 Ga0495635_0000527 3300046663 Bacteria 24259
190 Ga0495635_0002022 3300046663 Bacteria 13767
191 Ga0495635_0025042 3300046663 Bacteria 4158
192 Ga0495661_0096685 3300046665 Bacteria 1669
193 Ga0495588_0002484 3300046674 Bacteria 7899
194 Ga0495657_0001550 3300046675 Bacteria 19763
195 Ga0495623_0003194 3300046679 Bacteria 10824
196 Ga0495646_0005104 3300046680 Bacteria 8276
197 Ga0495646_0179119 3300046680 Bacteria 1164
198 Ga0495647_0001835 3300046681 Bacteria 6580
199 Ga0495647_0135508 3300046681 Bacteria 1046
200 Ga0495658_0004889 3300046683 Bacteria 6576
201 Ga0495613_0016014 3300046689 Bacteria 5582
202 Ga0495613_0142336 3300046689 Bacteria 1713
203 Ga0495624_0001581 3300046690 Bacteria 17522
204 Ga0495670_0012031 3300046691 Bacteria 4259
205 Ga0495671_0053934 3300046692 Bacteria 1994
206 Ga0495600_0001732 3300046809 Bacteria 12197
207 Ga0495600_0225343 3300046809 Bacteria 1198
208 Ga0495581_0000530 3300047315 Bacteria 19591
209 Ga0495604_0002815 3300047317 Bacteria 13967
210 Ga0495604_0041867 3300047317 Bacteria 3591
211 Ga0495674_0001486 3300047319 Bacteria 22968
212 Ga0495674_0026653 3300047319 Bacteria 5288
213 Ga0495674_0037959 3300047319 Bacteria 4327
214 Ga0495676_0009740 3300047321 Bacteria 8734
215 Ga0495680_0005453 3300047322 Bacteria 11971
216 Ga0495684_0001215 3300047471 Bacteria 20690
217 Ga0495686_0050905 3300047472 Bacteria 2601
218 Ga0495593_0000345 3300047673 Bacteria 25682
219 Ga0495593_0019493 3300047673 Bacteria 3802
220 Ga0495614_0032248 3300048089 Bacteria 2255
221 Ga0496113_0390436 3300048916 Bacteria 1117
222 Ga0496117_0085261 3300048920 Bacteria 2057
223 Ga0496119_0082263 3300048922 Bacteria 1852
224 Ga0496120_0008856 3300048923 Bacteria 7218
225 Ga0496121_0000458 3300048924 Bacteria 80207
226 Ga0496121_0009926 3300048924 Bacteria 10838
227 Ga0496121_0100600 3300048924 Bacteria 2231
228 Ga0496122_0017860 3300048925 Bacteria 6593
229 Ga0496123_0009061 3300048926 Bacteria 9016
230 Ga0496124_0159102 3300048927 Bacteria 1763
231 Ga0496126_0084973 3300048929 Bacteria 2790
232 Ga0501046_0039055 3300049580 Bacteria 3805
233 Ga0501047_0040568 3300049581 Bacteria 4501
234 Ga0501070_0043591 3300049586 Bacteria 3733
235 Ga0501074_0016075 3300049590 Bacteria 5439
236 Ga0501080_0059102 3300049742 Bacteria 3568
237 nmdc:mga06z11_260319_c1 3300050494 Bacteria 1023
238 nmdc:mga0n895_3874_c1 3300050512 Bacteria 12149
239 nmdc:mga0rr50_5656_c1 3300050513 Bacteria 7484
240 nmdc:mga0sz30_74188_c1 3300050516 Bacteria 1467
241 Ga0495601_0036374 3300053077 Bacteria 3074
242 Ga0495595_0001771 3300053084 Bacteria 8432
243 Ga0495619_0000757 3300053085 Bacteria 21079
244 Ga0500643_002043 3300053087 Bacteria 10818
245 Ga0500646_0013103 3300053090 Bacteria 2146
246 Ga0500566_0000006 3300053094 Bacteria 153632
247 Ga0500640_003111 3300053095 Bacteria 5688
248 Ga0500641_0027717 3300053096 Bacteria 2207
249 Ga0500650_0000167 3300053098 Bacteria 16961
250 Ga0500554_039358 3300053102 Bacteria 1443
251 Ga0500556_0000030 3300053104 Bacteria 165098
252 Ga0500572_000870 3300053111 Bacteria 9372
253 Ga0500572_001481 3300053111 Bacteria 6343
254 Ga0500592_000383 3300053116 Bacteria 7460
255 Ga0500608_010820 3300053122 Bacteria 3933
256 Ga0500608_026840 3300053122 Bacteria 2709
257 Ga0500614_000745 3300053123 Bacteria 8292
258 Ga0500642_0000302 3300053130 Bacteria 17637
259 Ga0500652_001787 3300053131 Bacteria 6519
260 Ga0500658_0029225 3300053134 Bacteria 2143
261 Ga0500658_0090307 3300053134 Bacteria 1323
262 Ga0500559_0000714 3300053136 Bacteria 21826
263 Ga0500559_0002857 3300053136 Bacteria 8726
264 Ga0500559_0016012 3300053136 Bacteria 3166
265 Ga0500568_0000978 3300053139 Bacteria 19672
266 Ga0500603_000163 3300053150 Bacteria 16654
267 Ga0500603_000339 3300053150 Bacteria 12234
268 Ga0500604_0026938 3300053151 Bacteria 1660
269 Ga0500619_083629 3300053154 Bacteria 1074
270 Ga0500622_0003870 3300053156 Bacteria 9716
271 Ga0500630_000788 3300053159 Bacteria 14585
272 Ga0500638_001821 3300053162 Bacteria 7023
273 Ga0500639_000765 3300053163 Bacteria 16347
274 Ga0500639_020691 3300053163 Bacteria 3475
275 Ga0500637_0000178 3300053178 Bacteria 23661
276 Ga0500637_0242399 3300053178 Bacteria 1010
277 Ga0500611_003285 3300053727 Bacteria 2055
278 Ga0500596_006619 3300053735 Bacteria 1947
279 2509150484 2508501128 Bacteria 8613869
280 2513894742 2513237141 Bacteria 8496279
281 2603859672 2602042107 Bacteria 6226103
282 2857528932 2857524615 Bacteria 6615449
283 2893070390 2893066018 Bacteria 6158120
284 2903755257 2903748898 Bacteria 9972761
285 2904694763 2904690495 Bacteria 9412302
286 2908760085 2908756301 Bacteria 8864324
287 2919076332 2919073203 Bacteria 6531949
288 8056691289 8056689827 Bacteria 6712655
289 Ga0372808_009603
290 Ga0070680_100014887
291 Ga0070682_100043887
292 Ga0070661_100404014
293 Ga0070674_100052454
294 Ga0070674_100365094
295 Ga0070709_10107367
296 Ga0070709_10148099
297 Ga0070714_100016867
298 Ga0070714_100061541
299 Ga0070714_100075179
300 Ga0070714_100535346
301 Ga0070713_100020030
302 Ga0070713_100224731
303 Ga0070710_10001849
304 Ga0070710_10042360
305 Ga0070711_100026385
306 Ga0070681_10021129
307 Ga0070681_10087316
308 Ga0070681_10371441
309 Ga0070679_100016868
310 Ga0070679_100054377
311 Ga0070679_100142548
312 Ga0070684_100010906
313 Ga0070684_100026872
314 Ga0068853_100110116
315 Ga0068855_100034770
316 Ga0068855_100209735
317 Ga0068855_100704135
318 Ga0068854_100123471
319 Ga0068856_100000020
320 Ga0068856_100126902
321 Ga0068852_100042670
322 Ga0070717_10040820
323 Ga0070717_10047694
324 Ga0070717_10533868
325 Ga0075368_10015733
326 Ga0075364_10028053
327 Ga0070715_10012125
328 Ga0070712_100033513
329 Ga0070712_100047496
330 Ga0075367_10055093
331 Ga0075367_10151826
332 Ga0075369_10031951
333 Ga0068871_100059381
334 Ga0075434_100002422
335 Ga0075435_100026230
336 Ga0099794_10033233
337 Ga0099795_10017658
338 Ga0105240_10157459
339 Ga0105240_10663245
340 Ga0105241_10087993
341 Ga0105237_10062673
342 Ga0105238_10035432
343 Ga0105249_10236459
344 Ga0105239_10045490
345 Ga0105239_10148810
346 Ga0157370_10494228
347 Ga0157369_10010862
348 Ga0157369_10177800
349 Ga0157369_10264847
350 Ga0157369_10738001
351 Ga0157374_10098545
352 Ga0157372_10067851
353 Ga0213876_10009439
354 Ga0209758_1001092
355 Ga0207692_10006397
356 Ga0207699_10007610
357 Ga0207707_10009522
358 Ga0207707_10011411
359 Ga0207707_10214469
360 Ga0207707_10468369
361 Ga0207695_10469522
362 Ga0207693_10001875
363 Ga0207693_10007332
364 Ga0207663_10058775
365 Ga0207660_10037246
366 Ga0207652_10098478
367 Ga0207646_10145922
368 Ga0207700_10043952
369 Ga0207700_10088176
370 Ga0207664_10027202
371 Ga0207665_10312619
372 Ga0207661_10001655
373 Ga0207661_10027946
374 Ga0207667_10452116
375 Ga0207640_10146282
376 Ga0207678_10062793
377 Ga0207702_10002142
378 Ga0207698_10095782
379 Ga0209179_1044789
380 Ga0265330_10022520
381 Ga0265330_10172675
382 Ga0265325_10036032
383 Ga0265340_10013897
384 Ga0307509_10355708
385 Ga0307508_10000018
386 Ga0307508_10306349
387 Ga0265314_10226199
388 Ga0307510_10122896
389 Ga0373934_0074640
390 Ga0373944_0034020
391 Ga0373923_0059953
392 Ga0373936_0031880
393 Ga0373936_0090410
394 Ga0373945_0017914
395 Ga0373945_0019791
396 Ga0373953_0047406
397 Ga0373953_0074364
398 Ga0373954_0019404
399 Ga0373956_0002490
400 Ga0373956_0122891
401 Ga0373957_0004943
402 Ga0373943_0128641
403 Ga0373946_0006071
404 Ga0373955_0001626
405 Ga0373924_0024788
406 Ga0373935_0001116
407 Ga0373935_0010155
408 Ga0373927_0001437
409 Ga0373927_0014123
410 Ga0373927_0021625
411 Ga0373933_0155187
412 Ga0373947_0003173
413 Ga0373947_0010046
414 Ga0373937_0396399
415 Ga0373925_0027366
416 Ga0373925_0031532
417 Ga0373925_0113416
418 Ga0395899_0188802
419 Ga0395900_0587265
420 Ga0395898_0035823
421 Ga0395898_0067134
422 Ga0436364_0128776
423 Ga0395901_0204869
424 Ga0395901_0821106
425 Ga0436365_1079672
426 Ga0436361_0310484
427 Ga0436361_0782426
428 Ga0436363_1211778
429 Ga0466971_0103352
430 Ga0495592_0002109
431 Ga0495592_0026853
432 Ga0495592_0044911
433 Ga0495603_0010484
434 Ga0495603_0205798
435 Ga0495629_0000726
436 Ga0495629_0008557
437 Ga0495629_0044950
438 Ga0495638_0047999
439 Ga0495638_0063039
440 Ga0495641_0000747
441 Ga0495651_0001234
442 Ga0495653_0000358
443 Ga0495653_0042802
444 Ga0495580_0012590
445 Ga0495580_0135925
446 Ga0495582_0000416
447 Ga0495639_0000165
448 Ga0495639_0105226
449 Ga0495662_0000066
450 Ga0495662_0141152
451 Ga0495664_0005316
452 Ga0495664_0013023
453 Ga0495594_0000441
454 Ga0495583_0091381
455 Ga0495608_0002274
456 Ga0495610_0078607
457 Ga0495620_0026479
458 Ga0495628_0008060
459 Ga0495628_0020389
460 Ga0495630_0008582
461 Ga0495630_0173245
462 Ga0495643_0136063
463 Ga0495652_0005186
464 Ga0495652_0158383
465 Ga0495652_0260546
466 Ga0495665_0000802
467 Ga0495640_0003534
468 Ga0495640_0008220
469 Ga0495640_0071682
470 Ga0495645_0008975
471 Ga0495667_0007508
472 Ga0495667_0021338
473 Ga0495667_0306502
474 Ga0495634_0002191
475 Ga0495634_0086160
476 Ga0495625_0088213
477 Ga0495635_0000527
478 Ga0495635_0002022
479 Ga0495635_0025042
480 Ga0495661_0096685
481 Ga0495588_0002484
482 Ga0495657_0001550
483 Ga0495623_0003194
484 Ga0495646_0005104
485 Ga0495646_0179119
486 Ga0495647_0001835
487 Ga0495647_0135508
488 Ga0495658_0004889
489 Ga0495613_0016014
490 Ga0495613_0142336
491 Ga0495624_0001581
492 Ga0495670_0012031
493 Ga0495671_0053934
494 Ga0495600_0001732
495 Ga0495600_0225343
496 Ga0495581_0000530
497 Ga0495604_0002815
498 Ga0495604_0041867
499 Ga0495674_0001486
500 Ga0495674_0026653
501 Ga0495674_0037959
502 Ga0495676_0009740
503 Ga0495680_0005453
504 Ga0495684_0001215
505 Ga0495686_0050905
506 Ga0495593_0000345
507 Ga0495593_0019493
508 Ga0495614_0032248
509 Ga0496113_0390436
510 Ga0496117_0085261
511 Ga0496119_0082263
512 Ga0496120_0008856
513 Ga0496121_0000458
514 Ga0496121_0009926
515 Ga0496121_0100600
516 Ga0496122_0017860
517 Ga0496123_0009061
518 Ga0496124_0159102
519 Ga0496126_0084973
520 Ga0501046_0039055
521 Ga0501047_0040568
522 Ga0501070_0043591
523 Ga0501074_0016075
524 Ga0501080_0059102
525 nmdc:mga06z11_260319_c1
526 nmdc:mga0n895_3874_c1
527 nmdc:mga0rr50_5656_c1
528 nmdc:mga0sz30_74188_c1
529 Ga0495601_0036374
530 Ga0495595_0001771
531 Ga0495619_0000757
532 Ga0500643_002043
533 Ga0500646_0013103
534 Ga0500566_0000006
535 Ga0500640_003111
536 Ga0500641_0027717
537 Ga0500650_0000167
538 Ga0500554_039358
539 Ga0500556_0000030
540 Ga0500572_000870
541 Ga0500572_001481
542 Ga0500592_000383
543 Ga0500608_010820
544 Ga0500608_026840
545 Ga0500614_000745
546 Ga0500642_0000302
547 Ga0500652_001787
548 Ga0500658_0029225
549 Ga0500658_0090307
550 Ga0500559_0000714
551 Ga0500559_0002857
552 Ga0500559_0016012
553 Ga0500568_0000978
554 Ga0500603_000163
555 Ga0500603_000339
556 Ga0500604_0026938
557 Ga0500619_083629
558 Ga0500622_0003870
559 Ga0500630_000788
560 Ga0500638_001821
561 Ga0500639_000765
562 Ga0500639_020691
563 Ga0500637_0000178
564 Ga0500637_0242399
565 Ga0500611_003285
566 Ga0500596_006619
567 2509150484
568 2513894742
569 2603859672
570 2857528932
571 2893070390
572 2903755257
573 2904694763
574 2908760085
575 2919076332
576 8056691289

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00149

Metallophos

Calcineurin-like phosphoesterase

26

231

0.64

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fz5-assembly1.cif.gz_J the pi31-free bovine 20s proteasome 0.7156 220 238
2fbm-assembly1.cif.gz_C acetyltransferase domain of cdy1 0.6668 86 140
2fw2-assembly1.cif.gz_F catalytic domain of cdy 0.6497 86 140
4zde-assembly1.cif.gz_A crystal structure of yeast d3,d2-enoyl-coa isomerase f268a mutant 0.6254 85 140
1pjh-assembly1.cif.gz_C-2 structural studies on delta3-delta2-enoyl-coa isomerase: the variable mode of assembly of the trimeric disks of the crotonase superfamily 0.6241 85 140
ID Description Score Start End Superfamily
af_Q9VV99_449_608_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7171 220 240 2.130.10.10
2o1uB01 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.7021 220 234 3.30.565.10
af_Q8IQD3_79_332_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.6954 80 198 3.60.21.10
2dxlA02 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;GpdQ, beta-strand dimerisation domain 0.6925 88 200 3.30.750.180
af_A4IDU5_812_880_2.60.420.10 Mainly Beta;Sandwich;Maltose phosphorylase, domain 3;Maltose phosphorylase, domain 3 0.6808 220 241 2.60.420.10
ID Description Score Start End GO Terms
AF-A0A7C9VRR1-F1-model_v4 Metallophosphoesterase 0.7969 56 246 GO:0005737
AF-A0A3D4GV97-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.7819 50 200 GO:0005737
AF-A0A3N5N097-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.7792 34 191 GO:0005737
GO:0016787
AF-A0A5C7UB85-F1-model_v4 deleted 0.779 19 180
AF-A0A662BUB8-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.7723 28 200 GO:0005737
GO:0016787

Map