F388503

General Info

Members Datasets Scaffolds Average Seq Length
288 141 534 532

Family's Representative Sequence

Representative Sequence 3300006175|Ga0070712_100046666|Ga0070712_1000466662
Length 568
Sequence MAKEAVNLIDIAPHPGEAGVAELWSLRGGRSNVRQRIGKFAAVAVLLSAMSIAAPAPAEEEPKRGGILTYMIPADAPPSFDAHREETYATIHSAAPFYSVLIRANPYDPGRTDDLVCDVCTAMPKPTDDGKTYIFKIREGVKFTDGSPLTADDVAASWNEIIFPPEGVISARQSNFVMVDKVEATDPTTVVFRLKFATDAFLPALADPYAWIYRKTILDKDPHWYEKNILGSGPFKFVGYDTGQSIKGERNPDYFRKGLPYLDGFTGIFADKQAIRVEAIRADRAAIEFRGFPPATVDELKKALGDKITVQTSNWNCGGVITPNHKKKPFDDVRVRRALTLAIDRWGSAPELSKIAIVHTVGGLTFPDSPLAPTKEELQQIAGYWLDIEKSRAEARRLLKEAGAEGLQFELLNRNVDQPYKYYGIWAVDEWSKIGLHVTQRVLPTGPWFEALRSGNFDVTTEGNCQNVVNPLADVGKYLPHSVSSSNYGQFDDAKEIEMYHRQLRELDKTKQHADLLEFNKYVLDEQAHAIYLLWWQRIVPYRSYVKGWKIGPSHYVNQDLGTIWLDK

Samples

Sample ID Description Type Environment
1 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
38 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
43 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
50 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
51 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
52 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
81 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
82 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
83 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
84 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
85 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
86 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
87 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
89 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
90 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
96 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
99 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
100 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
101 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
102 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
103 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
104 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
107 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
108 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
109 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
110 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
111 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
112 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
113 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
114 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
115 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
116 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
117 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
118 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
119 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
120 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
121 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
122 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
123 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
124 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
127 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
130 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
133 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
134 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
135 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
136 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
137 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
138 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
139 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
140 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.96
Metatranscriptomes 0.69
Isolates 0.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.78
Nodule 0.35
Rhizoplane 0.69
Rhizosphere 92.01
Stem 0
Stem Tuber 0
Unclassified 1.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070712_100046666 3300006175 Bacteria 2996
2 Ga0070658_10004436 3300005327 Bacteria 11431
3 Ga0070680_100019008 3300005336 Bacteria 5438
4 Ga0070680_100046419 3300005336 Bacteria 3533
5 Ga0070682_100044387 3300005337 Bacteria 2752
6 Ga0070689_100058143 3300005340 Bacteria 3003
7 Ga0070691_10011803 3300005341 Bacteria 3996
8 Ga0070661_100052911 3300005344 Bacteria 2971
9 Ga0070671_100014669 3300005355 Bacteria 6334
10 Ga0070709_10090430 3300005434 Bacteria 2018
11 Ga0070714_100027094 3300005435 Bacteria 4742
12 Ga0070714_100028900 3300005435 Bacteria 4604
13 Ga0070714_100033366 3300005435 Bacteria 4303
14 Ga0070714_100058044 3300005435 Bacteria 3314
15 Ga0070714_100076635 3300005435 Bacteria 2904
16 Ga0070714_100097949 3300005435 Bacteria 2579
17 Ga0070714_100161448 3300005435 Bacteria 2028
18 Ga0070713_100007838 3300005436 Bacteria 7528
19 Ga0070713_100121124 3300005436 Bacteria 2295
20 Ga0070713_100137140 3300005436 Bacteria 2163
21 Ga0070710_10014767 3300005437 Bacteria 3936
22 Ga0070710_10015587 3300005437 Bacteria 3850
23 Ga0070710_10066796 3300005437 Bacteria 2062
24 Ga0070711_100007820 3300005439 Bacteria 6514
25 Ga0070711_100018605 3300005439 Bacteria 4439
26 Ga0070711_100062325 3300005439 Bacteria 2599
27 Ga0070711_100114352 3300005439 Bacteria 1986
28 Ga0070708_100066813 3300005445 Bacteria 3227
29 Ga0070708_100094654 3300005445 Bacteria 2725
30 Ga0070708_100142090 3300005445 Bacteria 2227
31 Ga0070678_100066546 3300005456 Bacteria 2679
32 Ga0070681_10011493 3300005458 Bacteria 8763
33 Ga0070681_10023971 3300005458 Bacteria 6144
34 Ga0070681_10035190 3300005458 Bacteria 5030
35 Ga0070681_10066001 3300005458 Bacteria 3588
36 Ga0070706_100071415 3300005467 Bacteria 3211
37 Ga0070706_100093777 3300005467 Bacteria 2785
38 Ga0070706_100143854 3300005467 Bacteria 2226
39 Ga0070707_100004136 3300005468 Bacteria 13602
40 Ga0070707_100025021 3300005468 Bacteria 5661
41 Ga0070707_100039585 3300005468 Bacteria 4506
42 Ga0070698_100004779 3300005471 Bacteria 14870
43 Ga0070698_100013576 3300005471 Bacteria 8624
44 Ga0070698_100023783 3300005471 Bacteria 6398
45 Ga0070698_100037541 3300005471 Bacteria 4994
46 Ga0070698_100099697 3300005471 Bacteria 2878
47 Ga0070698_100180652 3300005471 Bacteria 2049
48 Ga0070698_100183168 3300005471 Bacteria 2032
49 Ga0070699_100004776 3300005518 Bacteria 11975
50 Ga0070699_100049161 3300005518 Bacteria 3650
51 Ga0070699_100053113 3300005518 Bacteria 3507
52 Ga0070699_100138542 3300005518 Bacteria 2147
53 Ga0070679_100035506 3300005530 Bacteria 4946
54 Ga0070679_100050562 3300005530 Bacteria 4140
55 Ga0070679_100076909 3300005530 Bacteria 3326
56 Ga0070679_100089515 3300005530 Bacteria 3065
57 Ga0070684_100001731 3300005535 Bacteria 15866
58 Ga0070684_100015113 3300005535 Bacteria 6276
59 Ga0070697_100010508 3300005536 Bacteria 7225
60 Ga0070697_100029929 3300005536 Bacteria 4371
61 Ga0070697_100089884 3300005536 Unclassified 2538
62 Ga0070697_100115112 3300005536 Bacteria 2245
63 Ga0070697_100122677 3300005536 Bacteria 2174
64 Ga0070665_100044540 3300005548 Bacteria 4456
65 Ga0068855_100062601 3300005563 Bacteria 4343
66 Ga0068855_100213105 3300005563 Bacteria 2169
67 Ga0068857_100042241 3300005577 Bacteria 4044
68 Ga0068856_100049915 3300005614 Bacteria 4124
69 Ga0081455_10019465 3300005937 Bacteria 6421
70 Ga0081455_10030165 3300005937 Bacteria 4931
71 Ga0081540_1008177 3300005983 Bacteria 7331
72 Ga0081539_10004586 3300005985 Bacteria 15087
73 Ga0081539_10025781 3300005985 Bacteria 3771
74 Ga0070717_10009133 3300006028 Bacteria 7448
75 Ga0070717_10032454 3300006028 Bacteria 4208
76 Ga0070717_10053391 3300006028 Bacteria 3331
77 Ga0070717_10131245 3300006028 Bacteria 2154
78 Ga0070717_10134995 3300006028 Bacteria 2124
79 Ga0070717_10156348 3300006028 Bacteria 1976
80 Ga0070715_10012776 3300006163 Bacteria 3068
81 Ga0070715_10049249 3300006163 Bacteria 1805
82 Ga0070716_100091314 3300006173 Bacteria 1844
83 Ga0070712_100009701 3300006175 Bacteria 6067
84 Ga0070712_100047005 3300006175 Bacteria 2985
85 Ga0070712_100052583 3300006175 Bacteria 2841
86 Ga0075367_10018533 3300006178 Bacteria 3843
87 Ga0075367_10029510 3300006178 Bacteria 3138
88 Ga0075367_10063269 3300006178 Bacteria 2211
89 Ga0075369_10013319 3300006186 Bacteria 3262
90 Ga0075435_100030509 3300007076 Bacteria 4240
91 Ga0099794_10007531 3300007265 Bacteria 4478
92 Ga0099795_10004856 3300007788 Bacteria 3514
93 Ga0099795_10007056 3300007788 Bacteria 3109
94 Ga0099795_10008386 3300007788 Bacteria 2944
95 Ga0099795_10013857 3300007788 Bacteria 2485
96 Ga0105240_10037912 3300009093 Bacteria 6189
97 Ga0105248_10057241 3300009177 Bacteria 4375
98 Ga0105237_10091257 3300009545 Bacteria 3035
99 Ga0105035_100717 3300009988 Bacteria 2078
100 Ga0099796_10000528 3300010159 Bacteria 6518
101 Ga0105239_10079854 3300010375 Bacteria 3600
102 Ga0105239_10118662 3300010375 Bacteria 2936
103 Ga0157370_10139474 3300013104 Bacteria 2259
104 Ga0157369_10006203 3300013105 Bacteria 13871
105 Ga0157369_10017550 3300013105 Bacteria 8042
106 Ga0157369_10038756 3300013105 Bacteria 5210
107 Ga0163162_10244593 3300013306 Bacteria 1925
108 Ga0157376_10065989 3300014969 Bacteria 3058
109 Ga0213874_10003344 3300021377 Bacteria 3548
110 Ga0213875_10000009 3300021388 Bacteria 451129
111 Ga0213875_10000590 3300021388 Bacteria 29305
112 Ga0213871_10001075 3300021441 Bacteria 4319
113 Ga0224712_10009337 3300022467 Bacteria 2951
114 Ga0207692_10026687 3300025898 Bacteria 2712
115 Ga0207692_10054091 3300025898 Unclassified 2048
116 Ga0207685_10000846 3300025905 Bacteria 5737
117 Ga0207699_10023491 3300025906 Plasmid 3356
118 Ga0207699_10028578 3300025906 Bacteria 3101
119 Ga0207699_10043707 3300025906 Bacteria 2604
120 Ga0207684_10005897 3300025910 Bacteria 11221
121 Ga0207684_10027676 3300025910 Bacteria 4828
122 Ga0207684_10030316 3300025910 Bacteria 4605
123 Ga0207684_10034205 3300025910 Bacteria 4319
124 Ga0207654_10003692 3300025911 Bacteria 7719
125 Ga0207707_10057551 3300025912 Bacteria 3384
126 Ga0207707_10057729 3300025912 Bacteria 3378
127 Ga0207695_10052445 3300025913 Bacteria 4273
128 Ga0207695_10115660 3300025913 Bacteria 2656
129 Ga0207693_10006250 3300025915 Bacteria 9878
130 Ga0207693_10008396 3300025915 Bacteria 8451
131 Ga0207693_10008435 3300025915 Bacteria 8430
132 Ga0207693_10009508 3300025915 Bacteria 7920
133 Ga0207693_10017042 3300025915 Bacteria 5801
134 Ga0207693_10021778 3300025915 Bacteria 5096
135 Ga0207693_10038668 3300025915 Bacteria 3756
136 Ga0207693_10114713 3300025915 Bacteria 2114
137 Ga0207663_10076131 3300025916 Bacteria 2179
138 Ga0207663_10077211 3300025916 Bacteria 2167
139 Ga0207663_10077354 3300025916 Bacteria 2165
140 Ga0207663_10094150 3300025916 Bacteria 1995
141 Ga0207663_10124107 3300025916 Bacteria 1773
142 Ga0207660_10027229 3300025917 Bacteria 3898
143 Ga0207652_10026165 3300025921 Bacteria 4856
144 Ga0207652_10071145 3300025921 Bacteria 3022
145 Ga0207652_10076525 3300025921 Bacteria 2919
146 Ga0207652_10189896 3300025921 Bacteria 1848
147 Ga0207646_10006925 3300025922 Bacteria 11641
148 Ga0207646_10007040 3300025922 Bacteria 11511
149 Ga0207700_10005578 3300025928 Bacteria 7552
150 Ga0207700_10009171 3300025928 Bacteria 6166
151 Ga0207700_10031778 3300025928 Bacteria 3755
152 Ga0207700_10070089 3300025928 Bacteria 2694
153 Ga0207700_10162442 3300025928 Bacteria 1856
154 Ga0207664_10013112 3300025929 Bacteria 5943
155 Ga0207664_10130976 3300025929 Bacteria 2111
156 Ga0207644_10032401 3300025931 Bacteria 3646
157 Ga0207670_10083317 3300025936 Bacteria 2243
158 Ga0207665_10039215 3300025939 Bacteria 3157
159 Ga0207665_10098579 3300025939 Bacteria 2036
160 Ga0207661_10000630 3300025944 Bacteria 22633
161 Ga0207661_10015396 3300025944 Bacteria 5627
162 Ga0207667_10090238 3300025949 Bacteria 3167
163 Ga0207702_10179081 3300026078 Bacteria 1951
164 Ga0207674_10032597 3300026116 Bacteria 5463
165 Ga0207683_10095830 3300026121 Bacteria 2646
166 Ga0207698_10018214 3300026142 Bacteria 4780
167 Ga0209179_1003667 3300027512 Bacteria 2238
168 Ga0268266_10055227 3300028379 Bacteria 3414
169 Ga0268264_10068676 3300028381 Bacteria 2996
170 Ga0265338_10021992 3300028800 Bacteria 6626
171 Ga0373923_0048919 3300035111 Bacteria 1767
172 Ga0373936_0020144 3300035113 Bacteria 2589
173 Ga0373945_0027294 3300035116 Bacteria 1994
174 Ga0373954_0043821 3300035118 Bacteria 2087
175 Ga0373957_0010598 3300035120 Bacteria 3053
176 Ga0373946_0034152 3300035171 Bacteria 2052
177 Ga0373955_0044200 3300035172 Bacteria 2398
178 Ga0373955_0044837 3300035172 Bacteria 2384
179 Ga0373935_0012010 3300035692 Bacteria 5205
180 Ga0373935_0021474 3300035692 Bacteria 3953
181 Ga0373935_0056482 3300035692 Bacteria 2503
182 Ga0373927_0091875 3300035695 Bacteria 1972
183 Ga0373933_0015905 3300035724 Bacteria 4198
184 Ga0373933_0041335 3300035724 Bacteria 2721
185 Ga0373933_0070823 3300035724 Bacteria 2121
186 Ga0373937_0002541 3300036401 Bacteria 15154
187 Ga0373937_0007378 3300036401 Bacteria 9513
188 Ga0373937_0012954 3300036401 Bacteria 7343
189 Ga0373937_0025754 3300036401 Bacteria 5312
190 Ga0373937_0061985 3300036401 Bacteria 3437
191 Ga0373937_0187099 3300036401 Unclassified 1945
192 Ga0373925_0052131 3300037068 Bacteria 3057
193 Ga0373925_0052567 3300037068 Bacteria 3044
194 Ga0373925_0061243 3300037068 Bacteria 2826
195 Ga0395899_0019090 3300037312 Bacteria 5211
196 Ga0395899_0059609 3300037312 Bacteria 2814
197 Ga0395900_0019670 3300037418 Bacteria 6883
198 Ga0395898_0014667 3300037466 Bacteria 8046
199 Ga0395905_0124691 3300037471 Bacteria 2422
200 Ga0436364_0089300 3300037853 Bacteria 8670
201 Ga0436364_0091337 3300037853 Bacteria 3441
202 Ga0436364_0174146 3300037853 Bacteria 60383
203 Ga0436364_0844647 3300037853 Bacteria 4954
204 Ga0395901_0004436 3300038443 Bacteria 14158
205 Ga0395901_0004824 3300038443 Bacteria 13607
206 Ga0395901_0069544 3300038443 Bacteria 3666
207 Ga0395901_0126520 3300038443 Bacteria 2685
208 Ga0436365_1029875 3300039437 Bacteria 2001
209 Ga0436365_1205705 3300039437 Bacteria 1955
210 Ga0436360_1370905 3300039438 Bacteria 15254
211 Ga0436361_1092803 3300039447 Bacteria 1802
212 Ga0436361_1104481 3300039447 Bacteria 2295
213 Ga0436363_0564534 3300039450 Bacteria 2642
214 Ga0436363_0887186 3300039450 Bacteria 3681
215 Ga0439448_0019705 3300042005 Bacteria 2080
216 Ga0466963_0032337 3300044694 Bacteria 3387
217 Ga0466957_0042019 3300044842 Bacteria 2765
218 Ga0466967_0064738 3300045976 Bacteria 3252
219 Ga0495592_0005982 3300046454 Bacteria 9047
220 Ga0495592_0009894 3300046454 Bacteria 7181
221 Ga0495629_0025611 3300046459 Bacteria 4192
222 Ga0495664_0003040 3300046477 Bacteria 9087
223 Ga0495664_0006872 3300046477 Bacteria 6297
224 Ga0495664_0017381 3300046477 Bacteria 4111
225 Ga0495608_0025569 3300046511 Bacteria 4030
226 Ga0495618_0042136 3300046514 Bacteria 2877
227 Ga0495628_0052236 3300046516 Bacteria 3229
228 Ga0495640_0087543 3300046533 Unclassified 2060
229 Ga0495640_0106898 3300046533 Bacteria 1832
230 Ga0495586_0021723 3300046535 Bacteria 3423
231 Ga0495645_0001100 3300046543 Bacteria 18313
232 Ga0495645_0004195 3300046543 Bacteria 9855
233 Ga0495667_0018465 3300046559 Bacteria 4711
234 Ga0495667_0020087 3300046559 Bacteria 4505
235 Ga0495635_0010059 3300046663 Bacteria 6615
236 Ga0495599_0013120 3300046678 Bacteria 5119
237 Ga0495646_0032775 3300046680 Bacteria 3232
238 Ga0495600_0060297 3300046809 Bacteria 2478
239 Ga0495604_0040875 3300047317 Bacteria 3639
240 Ga0495680_0006331 3300047322 Bacteria 11020
241 Ga0495675_0004197 3300047444 Bacteria 8721
242 Ga0495684_0032822 3300047471 Bacteria 3988
243 Ga0495602_0000131 3300048088 Bacteria 70438
244 Ga0495602_0000195 3300048088 Bacteria 57149
245 Ga0496104_0025316 3300048907 Bacteria 5470
246 Ga0496115_0161994 3300048918 Bacteria 1849
247 Ga0501034_0000739 3300049571 Bacteria 49430
248 Ga0501047_0075573 3300049581 Bacteria 3242
249 Ga0501068_0007424 3300049584 Bacteria 6069
250 Ga0501073_0072663 3300049589 Bacteria 2396
251 Ga0501044_0011418 3300049823 Bacteria 9622
252 nmdc:mga03683_6220_c1 3300050489 Bacteria 4075
253 nmdc:mga0k408_67726_c1 3300050493 Bacteria 2081
254 nmdc:mga06z11_15439_c1 3300050494 Bacteria 3409
255 nmdc:mga0sz30_7601_c1 3300050516 Bacteria 4070
256 Ga0495601_0004945 3300053077 Bacteria 7732
257 Ga0495601_0015408 3300053077 Bacteria 4620
258 Ga0495601_0017706 3300053077 Bacteria 4328
259 Ga0495601_0039205 3300053077 Bacteria 2966
260 Ga0495601_0114403 3300053077 Bacteria 1749
261 Ga0495612_0002144 3300053078 Bacteria 8120
262 Ga0495595_0002163 3300053084 Bacteria 7640
263 Ga0495595_0030322 3300053084 Bacteria 2425
264 Ga0495619_0004933 3300053085 Bacteria 8475
265 Ga0495619_0007390 3300053085 Bacteria 6960
266 Ga0587073_0004805 3300059492 Bacteria 1967
267 2876762586 2876761206 Bacteria 10111113
268 Ga0070712_100046666
269 Ga0070658_10004436
270 Ga0070680_100019008
271 Ga0070680_100046419
272 Ga0070682_100044387
273 Ga0070689_100058143
274 Ga0070691_10011803
275 Ga0070661_100052911
276 Ga0070671_100014669
277 Ga0070709_10090430
278 Ga0070714_100027094
279 Ga0070714_100028900
280 Ga0070714_100033366
281 Ga0070714_100058044
282 Ga0070714_100076635
283 Ga0070714_100097949
284 Ga0070714_100161448
285 Ga0070713_100007838
286 Ga0070713_100121124
287 Ga0070713_100137140
288 Ga0070710_10014767
289 Ga0070710_10015587
290 Ga0070710_10066796
291 Ga0070711_100007820
292 Ga0070711_100018605
293 Ga0070711_100062325
294 Ga0070711_100114352
295 Ga0070708_100066813
296 Ga0070708_100094654
297 Ga0070708_100142090
298 Ga0070678_100066546
299 Ga0070681_10011493
300 Ga0070681_10023971
301 Ga0070681_10035190
302 Ga0070681_10066001
303 Ga0070706_100071415
304 Ga0070706_100093777
305 Ga0070706_100143854
306 Ga0070707_100004136
307 Ga0070707_100025021
308 Ga0070707_100039585
309 Ga0070698_100004779
310 Ga0070698_100013576
311 Ga0070698_100023783
312 Ga0070698_100037541
313 Ga0070698_100099697
314 Ga0070698_100180652
315 Ga0070698_100183168
316 Ga0070699_100004776
317 Ga0070699_100049161
318 Ga0070699_100053113
319 Ga0070699_100138542
320 Ga0070679_100035506
321 Ga0070679_100050562
322 Ga0070679_100076909
323 Ga0070679_100089515
324 Ga0070684_100001731
325 Ga0070684_100015113
326 Ga0070697_100010508
327 Ga0070697_100029929
328 Ga0070697_100089884
329 Ga0070697_100115112
330 Ga0070697_100122677
331 Ga0070665_100044540
332 Ga0068855_100062601
333 Ga0068855_100213105
334 Ga0068857_100042241
335 Ga0068856_100049915
336 Ga0081455_10019465
337 Ga0081455_10030165
338 Ga0081540_1008177
339 Ga0081539_10004586
340 Ga0081539_10025781
341 Ga0070717_10009133
342 Ga0070717_10032454
343 Ga0070717_10053391
344 Ga0070717_10131245
345 Ga0070717_10134995
346 Ga0070717_10156348
347 Ga0070715_10012776
348 Ga0070715_10049249
349 Ga0070716_100091314
350 Ga0070712_100009701
351 Ga0070712_100047005
352 Ga0070712_100052583
353 Ga0075367_10018533
354 Ga0075367_10029510
355 Ga0075367_10063269
356 Ga0075369_10013319
357 Ga0075435_100030509
358 Ga0099794_10007531
359 Ga0099795_10004856
360 Ga0099795_10007056
361 Ga0099795_10008386
362 Ga0099795_10013857
363 Ga0105240_10037912
364 Ga0105248_10057241
365 Ga0105237_10091257
366 Ga0105035_100717
367 Ga0099796_10000528
368 Ga0105239_10079854
369 Ga0105239_10118662
370 Ga0157370_10139474
371 Ga0157369_10006203
372 Ga0157369_10017550
373 Ga0157369_10038756
374 Ga0163162_10244593
375 Ga0157376_10065989
376 Ga0213874_10003344
377 Ga0213875_10000009
378 Ga0213875_10000590
379 Ga0213871_10001075
380 Ga0224712_10009337
381 Ga0207692_10026687
382 Ga0207692_10054091
383 Ga0207685_10000846
384 Ga0207699_10023491
385 Ga0207699_10028578
386 Ga0207699_10043707
387 Ga0207684_10005897
388 Ga0207684_10027676
389 Ga0207684_10030316
390 Ga0207684_10034205
391 Ga0207654_10003692
392 Ga0207707_10057551
393 Ga0207707_10057729
394 Ga0207695_10052445
395 Ga0207695_10115660
396 Ga0207693_10006250
397 Ga0207693_10008396
398 Ga0207693_10008435
399 Ga0207693_10009508
400 Ga0207693_10017042
401 Ga0207693_10021778
402 Ga0207693_10038668
403 Ga0207693_10114713
404 Ga0207663_10076131
405 Ga0207663_10077211
406 Ga0207663_10077354
407 Ga0207663_10094150
408 Ga0207663_10124107
409 Ga0207660_10027229
410 Ga0207652_10026165
411 Ga0207652_10071145
412 Ga0207652_10076525
413 Ga0207652_10189896
414 Ga0207646_10006925
415 Ga0207646_10007040
416 Ga0207700_10005578
417 Ga0207700_10009171
418 Ga0207700_10031778
419 Ga0207700_10070089
420 Ga0207700_10162442
421 Ga0207664_10013112
422 Ga0207664_10130976
423 Ga0207644_10032401
424 Ga0207670_10083317
425 Ga0207665_10039215
426 Ga0207665_10098579
427 Ga0207661_10000630
428 Ga0207661_10015396
429 Ga0207667_10090238
430 Ga0207702_10179081
431 Ga0207674_10032597
432 Ga0207683_10095830
433 Ga0207698_10018214
434 Ga0209179_1003667
435 Ga0268266_10055227
436 Ga0268264_10068676
437 Ga0265338_10021992
438 Ga0373923_0048919
439 Ga0373936_0020144
440 Ga0373945_0027294
441 Ga0373954_0043821
442 Ga0373957_0010598
443 Ga0373946_0034152
444 Ga0373955_0044200
445 Ga0373955_0044837
446 Ga0373935_0012010
447 Ga0373935_0021474
448 Ga0373935_0056482
449 Ga0373927_0091875
450 Ga0373933_0015905
451 Ga0373933_0041335
452 Ga0373933_0070823
453 Ga0373937_0002541
454 Ga0373937_0007378
455 Ga0373937_0012954
456 Ga0373937_0025754
457 Ga0373937_0061985
458 Ga0373937_0187099
459 Ga0373925_0052131
460 Ga0373925_0052567
461 Ga0373925_0061243
462 Ga0395899_0019090
463 Ga0395899_0059609
464 Ga0395900_0019670
465 Ga0395898_0014667
466 Ga0395905_0124691
467 Ga0436364_0089300
468 Ga0436364_0091337
469 Ga0436364_0174146
470 Ga0436364_0844647
471 Ga0395901_0004436
472 Ga0395901_0004824
473 Ga0395901_0069544
474 Ga0395901_0126520
475 Ga0436365_1029875
476 Ga0436365_1205705
477 Ga0436360_1370905
478 Ga0436361_1092803
479 Ga0436361_1104481
480 Ga0436363_0564534
481 Ga0436363_0887186
482 Ga0439448_0019705
483 Ga0466963_0032337
484 Ga0466957_0042019
485 Ga0466967_0064738
486 Ga0495592_0005982
487 Ga0495592_0009894
488 Ga0495629_0025611
489 Ga0495664_0003040
490 Ga0495664_0006872
491 Ga0495664_0017381
492 Ga0495608_0025569
493 Ga0495618_0042136
494 Ga0495628_0052236
495 Ga0495640_0087543
496 Ga0495640_0106898
497 Ga0495586_0021723
498 Ga0495645_0001100
499 Ga0495645_0004195
500 Ga0495667_0018465
501 Ga0495667_0020087
502 Ga0495635_0010059
503 Ga0495599_0013120
504 Ga0495646_0032775
505 Ga0495600_0060297
506 Ga0495604_0040875
507 Ga0495680_0006331
508 Ga0495675_0004197
509 Ga0495684_0032822
510 Ga0495602_0000131
511 Ga0495602_0000195
512 Ga0496104_0025316
513 Ga0496115_0161994
514 Ga0501034_0000739
515 Ga0501047_0075573
516 Ga0501068_0007424
517 Ga0501073_0072663
518 Ga0501044_0011418
519 nmdc:mga03683_6220_c1
520 nmdc:mga0k408_67726_c1
521 nmdc:mga06z11_15439_c1
522 nmdc:mga0sz30_7601_c1
523 Ga0495601_0004945
524 Ga0495601_0015408
525 Ga0495601_0017706
526 Ga0495601_0039205
527 Ga0495601_0114403
528 Ga0495612_0002144
529 Ga0495595_0002163
530 Ga0495595_0030322
531 Ga0495619_0004933
532 Ga0495619_0007390
533 Ga0587073_0004805
534 2876762586

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00496

SBP_bac_5

Bacterial extracellular solute-binding proteins, family 5 Middle

114

486

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5isu-assembly1.cif.gz_A 2.2 angstrom crystal structure of abc transporter substrate binding protein ctap (lmo0135) from listeria monocytogenes. 0.8724 29 534
5isu-assembly1.cif.gz_A 2.2 angstrom crystal structure of abc transporter substrate binding protein ctap (lmo0135) from listeria monocytogenes. 0.8707 29 534
5u4o-assembly1.cif.gz_A-2 a 2.05a x-ray structureof a bacterial extracellular solute-binding protein, family 5 for bacillus anthracis str. ames 0.87 31 532
5u4o-assembly1.cif.gz_A-2 a 2.05a x-ray structureof a bacterial extracellular solute-binding protein, family 5 for bacillus anthracis str. ames 0.8649 31 532
6i3g-assembly1.cif.gz_A crystal structure of a putative peptide binding protein appa from clostridium difficile 0.8598 32 532
ID Description Score Start End Superfamily
6hlxA02 Alpha Beta;Alpha-Beta Complex;Dipeptide-binding Protein; domain 1;Dipeptide-binding Protein; Domain 1 0.8946 43 197 3.90.76.10
1uqwB02 Alpha Beta;Alpha-Beta Complex;Dipeptide-binding Protein; domain 1;Dipeptide-binding Protein; Domain 1 0.8925 45 197 3.90.76.10
5isuA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8917 192 279 3.40.190.10
1xocA02 Alpha Beta;Alpha-Beta Complex;Dipeptide-binding Protein; domain 1;Dipeptide-binding Protein; Domain 1 0.8849 64 188 3.90.76.10
1b52A03 Alpha Beta;Roll;Dipeptide-binding Protein; domain 3;Dipeptide-binding Protein; Domain 3 0.8845 283 502 3.10.105.10
ID Description Score Start End GO Terms
AF-A0A383B407-F1-model_v4 Solute-binding protein family 5 domain-containing protein 0.9742 22 245 GO:0015833
GO:1904680
AF-A0A535JSC0-F1-model_v4 Solute-binding protein family 5 domain-containing protein 0.9709 277 532 GO:0015833
GO:1904680
AF-A0A0B5DXX7-F1-model_v4 ABC transporter substrate-binding protein 0.9706 27 534 GO:0015031
GO:0015833
GO:0030288
GO:0043190
GO:1904680
AF-A0A2S6U885-F1-model_v4 Oligopeptide-binding protein AppA 0.9528 1 444 GO:0015833
GO:0030288
GO:0043190
GO:1904680
AF-A0A2V6Y1C8-F1-model_v4 Solute-binding protein family 5 domain-containing protein 0.9502 254 532 GO:0015031
GO:0015833
GO:0030313
GO:1904680

Map