F388418

General Info

Members Datasets Scaffolds Average Seq Length
288 191 576 194

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100327721|Ga0070682_1003277211
Length 219
Sequence MVSAGVAACRGPGWSVPGRCHASWVATDVPTYTTKPLTQDTWEDFASLVEANNGVWGGCWCMGFHPEGVGAGRTREGNRAAKRRHVANGIVHQTLVYAGQECVGWCQYGSPAELPNIKNSAAYRKELQTLPDWRIGCIFTGSRHRAAGVARAAVAGTLEAIRANGGGVVEAYPEQVEGRPPQRGAYLHTGPETLFEEFGFVRDRRIAKWRWVMRLDLPA

Samples

Sample ID Description Type Environment
1 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
19 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
26 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
55 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
76 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
77 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
80 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
81 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
82 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
83 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
84 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
85 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
86 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
87 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
88 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
89 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
90 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
91 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
92 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
93 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
94 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
95 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
96 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
98 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
101 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
102 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
103 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
104 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
105 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
106 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
107 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
108 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
109 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
112 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
113 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
114 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
115 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
116 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
117 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
118 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
119 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
120 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
121 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
122 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
123 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
124 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
125 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
126 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
127 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
128 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
129 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
130 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
131 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
132 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
133 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
134 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
135 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
159 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
160 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
163 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
164 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
165 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
166 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
170 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
171 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
172 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
173 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
176 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
177 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
178 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
179 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
180 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
181 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
182 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
183 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
184 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
185 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
186 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
187 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
188 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
189 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
190 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
191 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.26
Metatranscriptomes 0.35
Isolates 1.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.15
Nodule 0
Rhizoplane 9.03
Rhizosphere 75
Stem 0
Stem Tuber 0
Unclassified 4.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070682_100327721 3300005337 Bacteria 1134
2 Ga0070658_10045417 3300005327 Bacteria 3552
3 Ga0070658_10410060 3300005327 Bacteria 1164
4 Ga0070683_100045358 3300005329 Bacteria 4057
5 Ga0070683_100294867 3300005329 Bacteria 1542
6 Ga0070680_100090517 3300005336 Bacteria 2533
7 Ga0070660_100240110 3300005339 Bacteria 1476
8 Ga0070660_100492452 3300005339 Bacteria 1019
9 Ga0070659_100090105 3300005366 Bacteria 2458
10 Ga0070659_100100986 3300005366 Bacteria 2322
11 Ga0070659_100498173 3300005366 Bacteria 1038
12 Ga0070667_100091018 3300005367 Bacteria 2622
13 Ga0070700_100363658 3300005441 Bacteria 1076
14 Ga0070663_100141230 3300005455 Bacteria 1839
15 Ga0070663_100436810 3300005455 Bacteria 1076
16 Ga0070699_100824206 3300005518 Unclassified 849
17 Ga0070684_100017387 3300005535 Bacteria 5901
18 Ga0070665_101397059 3300005548 Bacteria 709
19 Ga0070664_100150812 3300005564 Bacteria 2052
20 Ga0070664_100198847 3300005564 Bacteria 1788
21 Ga0070664_100425259 3300005564 Bacteria 1217
22 Ga0068857_100272547 3300005577 Bacteria 1555
23 Ga0068854_100167280 3300005578 Bacteria 1708
24 Ga0068854_100454793 3300005578 Bacteria 1070
25 Ga0068852_100831481 3300005616 Bacteria 938
26 Ga0068852_100848414 3300005616 Bacteria 929
27 Ga0068852_101461488 3300005616 Bacteria 706
28 Ga0068864_100673471 3300005618 Bacteria 1009
29 Ga0068860_100000826 3300005843 Bacteria 34669
30 Ga0068862_100706676 3300005844 Bacteria 977
31 Ga0081455_10089282 3300005937 Bacteria 2501
32 Ga0075365_10015437 3300006038 Bacteria 4621
33 Ga0075365_10130158 3300006038 Bacteria 1741
34 Ga0075365_10152890 3300006038 Bacteria 1606
35 Ga0075365_10187628 3300006038 Bacteria 1446
36 Ga0075365_10225679 3300006038 Bacteria 1314
37 Ga0075365_10338101 3300006038 Bacteria 1061
38 Ga0075365_10474447 3300006038 Bacteria 884
39 Ga0075368_10015696 3300006042 Bacteria 2814
40 Ga0075368_10020756 3300006042 Bacteria 2490
41 Ga0075368_10040693 3300006042 Bacteria 1825
42 Ga0075363_100001373 3300006048 Bacteria 9170
43 Ga0075363_100123697 3300006048 Bacteria 1446
44 Ga0075363_100128901 3300006048 Bacteria 1418
45 Ga0075364_10009377 3300006051 Bacteria 5868
46 Ga0075364_10133412 3300006051 Bacteria 1667
47 Ga0075364_10763052 3300006051 Bacteria 660
48 Ga0075367_10019678 3300006178 Bacteria 3747
49 Ga0075367_10043041 3300006178 Bacteria 2645
50 Ga0075370_10077199 3300006353 Bacteria 1911
51 Ga0075428_100006480 3300006844 Bacteria 13016
52 Ga0075430_100020699 3300006846 Bacteria 5595
53 Ga0075430_100114573 3300006846 Bacteria 2246
54 Ga0075431_100001666 3300006847 Bacteria 20839
55 Ga0075431_100040631 3300006847 Bacteria 4794
56 Ga0075431_100342598 3300006847 Bacteria 1504
57 Ga0075433_10211383 3300006852 Unclassified 1724
58 Ga0075434_100646271 3300006871 Bacteria 1076
59 Ga0075429_100005849 3300006880 Bacteria 10611
60 Ga0068865_100295618 3300006881 Bacteria 1294
61 Ga0075436_100191382 3300006914 Bacteria 1447
62 Ga0075435_100334814 3300007076 Bacteria 1297
63 Ga0075435_100462768 3300007076 Unclassified 1094
64 Ga0111539_10001924 3300009094 Bacteria 27666
65 Ga0111539_11323259 3300009094 Bacteria 836
66 Ga0105245_10040544 3300009098 Bacteria 4149
67 Ga0105245_10094448 3300009098 Bacteria 2756
68 Ga0105245_10778159 3300009098 Bacteria 994
69 Ga0114129_10018916 3300009147 Bacteria 9814
70 Ga0105243_10275525 3300009148 Bacteria 1513
71 Ga0105243_11154974 3300009148 Bacteria 785
72 Ga0105241_10853031 3300009174 Bacteria 843
73 Ga0105248_10468806 3300009177 Bacteria 1419
74 Ga0105238_10157834 3300009551 Bacteria 2244
75 Ga0105238_10916352 3300009551 Bacteria 895
76 Ga0105239_10152440 3300010375 Bacteria 2580
77 Ga0157370_10514125 3300013104 Bacteria 1099
78 Ga0157369_10144851 3300013105 Bacteria 2512
79 Ga0157369_10205516 3300013105 Bacteria 2066
80 Ga0157369_10249120 3300013105 Bacteria 1854
81 Ga0157374_10894515 3300013296 Bacteria 905
82 Ga0163162_10340011 3300013306 Bacteria 1633
83 Ga0157372_10143147 3300013307 Bacteria 2757
84 Ga0157375_10088079 3300013308 Bacteria 3159
85 Ga0157375_10089850 3300013308 Bacteria 3129
86 Ga0157375_10270453 3300013308 Bacteria 1861
87 Ga0157375_10354707 3300013308 Bacteria 1633
88 Ga0157375_10944357 3300013308 Bacteria 1004
89 Ga0163163_10826644 3300014325 Bacteria 990
90 Ga0163163_11273410 3300014325 Bacteria 797
91 Ga0157380_11111791 3300014326 Bacteria 830
92 Ga0163161_10079499 3300017792 Bacteria 2411
93 Ga0163161_10729191 3300017792 Bacteria 827
94 Ga0206354_10446218 3300020081 Bacteria 832
95 Ga0213875_10001642 3300021388 Bacteria 14120
96 Ga0213875_10019716 3300021388 Bacteria 3242
97 Ga0207680_10450028 3300025903 Bacteria 914
98 Ga0207705_10935476 3300025909 Bacteria 671
99 Ga0207654_10519335 3300025911 Bacteria 843
100 Ga0207657_10061565 3300025919 Bacteria 3217
101 Ga0207657_10238943 3300025919 Bacteria 1451
102 Ga0207657_10805973 3300025919 Bacteria 726
103 Ga0207652_10137910 3300025921 Bacteria 2179
104 Ga0207687_10201364 3300025927 Bacteria 1556
105 Ga0207687_10364947 3300025927 Bacteria 1179
106 Ga0207690_10249662 3300025932 Bacteria 1370
107 Ga0207690_10517208 3300025932 Bacteria 967
108 Ga0207686_10075865 3300025934 Bacteria 2177
109 Ga0207709_10393628 3300025935 Bacteria 1057
110 Ga0207661_10026049 3300025944 Bacteria 4452
111 Ga0207679_10295234 3300025945 Bacteria 1395
112 Ga0207679_10414294 3300025945 Bacteria 1188
113 Ga0207640_10438943 3300025981 Bacteria 1073
114 Ga0207658_10214754 3300025986 Bacteria 1614
115 Ga0207678_10273288 3300026067 Bacteria 1449
116 Ga0207708_10019425 3300026075 Bacteria 5122
117 Ga0207702_10600395 3300026078 Bacteria 1080
118 Ga0207702_10975777 3300026078 Bacteria 840
119 Ga0207674_10005985 3300026116 Bacteria 14400
120 Ga0207674_10139977 3300026116 Bacteria 2380
121 Ga0207675_100065468 3300026118 Bacteria 3397
122 Ga0207675_101068807 3300026118 Bacteria 826
123 Ga0268265_10539039 3300028380 Bacteria 1106
124 Ga0268264_10000280 3300028381 Bacteria 86361
125 Ga0265319_1035228 3300028563 Unclassified 1718
126 Ga0265319_1162657 3300028563 Bacteria 689
127 Ga0265334_10135068 3300028573 Bacteria 876
128 Ga0265336_10001216 3300028666 Bacteria 12211
129 Ga0265338_10003710 3300028800 Bacteria 21247
130 Ga0265338_10013121 3300028800 Bacteria 9389
131 Ga0265325_10020843 3300031241 Bacteria 3608
132 Ga0265340_10026010 3300031247 Bacteria 2961
133 Ga0265339_10091367 3300031249 Bacteria 1595
134 Ga0265313_10062334 3300031595 Bacteria 1742
135 Ga0316575_10017083 3300031665 Bacteria 2752
136 Ga0265314_10043926 3300031711 Bacteria 3172
137 Ga0265342_10316833 3300031712 Bacteria 818
138 Ga0316577_10030949 3300031733 Bacteria 2988
139 Ga0373953_0029420 3300035117 Bacteria 2124
140 Ga0373956_0236251 3300035119 Bacteria 868
141 Ga0316574_0162351 3300035398 Bacteria 1438
142 Ga0373924_0084126 3300035410 Bacteria 1356
143 Ga0373931_0077009 3300035691 Bacteria 1833
144 Ga0373947_0061758 3300035725 Bacteria 2278
145 Ga0373937_0162985 3300036401 Bacteria 2090
146 Ga0316582_0148675 3300036647 Bacteria 1582
147 Ga0316584_0206236 3300036712 Bacteria 1449
148 Ga0373925_0000828 3300037068 Bacteria 28518
149 Ga0316581_0004746 3300037588 Bacteria 3493
150 Ga0436364_0383313 3300037853 Bacteria 88995
151 Ga0436364_1565454 3300037853 Bacteria 3399
152 Ga0395901_0105243 3300038443 Bacteria 2961
153 Ga0436360_0724130 3300039438 Unclassified 779
154 Ga0451791_0519137 3300041451 Bacteria 747
155 Ga0451795_0084420 3300041456 Bacteria 742
156 Ga0451839_0468559 3300041496 Bacteria 1133
157 Ga0451841_1388375 3300041498 Bacteria 893
158 Ga0451847_0757906 3300041503 Unclassified 714
159 Ga0451853_3655461 3300041512 Unclassified 1143
160 Ga0450890_024613 3300042127 Bacteria 832
161 Ga0466963_0132620 3300044694 Bacteria 1722
162 Ga0466963_0233949 3300044694 Bacteria 1288
163 Ga0466963_0265705 3300044694 Bacteria 1205
164 Ga0466963_0561117 3300044694 Bacteria 806
165 Ga0451576_0051979 3300045051 Bacteria 4295
166 Ga0466967_0150500 3300045976 Bacteria 2174
167 Ga0466967_0400743 3300045976 Bacteria 1335
168 Ga0466967_0789541 3300045976 Bacteria 942
169 Ga0495592_0006030 3300046454 Bacteria 9009
170 Ga0495641_0048599 3300046461 Bacteria 1945
171 Ga0495653_0033124 3300046463 Bacteria 4096
172 Ga0495664_0252033 3300046477 Bacteria 1067
173 Ga0495608_0001170 3300046511 Bacteria 18589
174 Ga0495628_0021140 3300046516 Bacteria 5358
175 Ga0495628_0192649 3300046516 Bacteria 1539
176 Ga0495652_0002019 3300046529 Bacteria 21594
177 Ga0495640_0237180 3300046533 Bacteria 1145
178 Ga0495587_0016139 3300046536 Bacteria 4648
179 Ga0495645_0009659 3300046543 Bacteria 6747
180 Ga0495667_0002374 3300046559 Bacteria 12582
181 Ga0495634_0146444 3300046642 Bacteria 1496
182 Ga0495635_0002735 3300046663 Bacteria 12089
183 Ga0495588_0516423 3300046674 Bacteria 626
184 Ga0495599_0014436 3300046678 Bacteria 4891
185 Ga0495623_0071622 3300046679 Bacteria 2156
186 Ga0495646_0053133 3300046680 Bacteria 2444
187 Ga0495600_0006062 3300046809 Bacteria 7323
188 Ga0495604_0006218 3300047317 Bacteria 9475
189 Ga0495674_0005456 3300047319 Bacteria 12218
190 Ga0495680_0068002 3300047322 Bacteria 2722
191 Ga0495675_0007064 3300047444 Bacteria 6909
192 Ga0495684_0004064 3300047471 Bacteria 11420
193 Ga0495602_0050538 3300048088 Bacteria 3713
194 Ga0496100_0349857 3300048903 Bacteria 1116
195 Ga0496100_0481947 3300048903 Bacteria 954
196 Ga0496102_0022494 3300048905 Bacteria 5587
197 Ga0496104_0016062 3300048907 Bacteria 6795
198 Ga0496104_0065397 3300048907 Bacteria 3451
199 Ga0496105_0126828 3300048908 Bacteria 2104
200 Ga0496105_0138509 3300048908 Bacteria 2004
201 Ga0496107_0197042 3300048910 Bacteria 1497
202 Ga0496108_0004869 3300048911 Bacteria 10841
203 Ga0496108_0148069 3300048911 Bacteria 2025
204 Ga0496109_0004446 3300048912 Bacteria 11708
205 Ga0496109_0055790 3300048912 Bacteria 3604
206 Ga0496109_0262492 3300048912 Bacteria 1627
207 Ga0496110_0314743 3300048913 Bacteria 1425
208 Ga0496111_0148667 3300048914 Bacteria 1737
209 Ga0496111_0405864 3300048914 Bacteria 1007
210 Ga0496112_0034610 3300048915 Bacteria 4916
211 Ga0496113_0393040 3300048916 Bacteria 1113
212 Ga0496114_0006393 3300048917 Bacteria 9278
213 Ga0496114_0011603 3300048917 Bacteria 7044
214 Ga0496114_0023175 3300048917 Bacteria 5064
215 Ga0496114_0046427 3300048917 Bacteria 3609
216 Ga0496114_0399209 3300048917 Bacteria 1217
217 Ga0496115_0166087 3300048918 Bacteria 1825
218 Ga0501031_0085577 3300049568 Bacteria 2055
219 Ga0501036_0009236 3300049572 Bacteria 8106
220 Ga0501038_0007541 3300049574 Bacteria 10030
221 Ga0501039_0004923 3300049575 Bacteria 10121
222 Ga0501039_0268370 3300049575 Bacteria 1341
223 Ga0501040_0013322 3300049576 Bacteria 5406
224 Ga0501041_0122642 3300049577 Bacteria 1616
225 Ga0501041_0173967 3300049577 Bacteria 1347
226 Ga0501042_0009929 3300049578 Bacteria 6360
227 Ga0501046_0116162 3300049580 Bacteria 2040
228 Ga0501046_0399008 3300049580 Bacteria 994
229 Ga0501047_0556443 3300049581 Bacteria 971
230 Ga0501048_0003907 3300049582 Bacteria 11320
231 Ga0501048_0330165 3300049582 Bacteria 1087
232 Ga0501069_0249806 3300049585 Bacteria 1035
233 Ga0501070_0193189 3300049586 Bacteria 1673
234 Ga0501070_0271762 3300049586 Bacteria 1384
235 Ga0501070_0419964 3300049586 Unclassified 1080
236 Ga0501071_0011733 3300049587 Bacteria 5912
237 Ga0501072_0698051 3300049588 Bacteria 797
238 Ga0501074_0023380 3300049590 Bacteria 4494
239 Ga0501074_0068455 3300049590 Bacteria 2552
240 Ga0501076_0068320 3300049592 Bacteria 2839
241 Ga0501076_0069197 3300049592 Bacteria 2820
242 Ga0501076_0338238 3300049592 Bacteria 1235
243 Ga0501076_0942012 3300049592 Bacteria 712
244 Ga0501079_0008075 3300049741 Bacteria 7974
245 Ga0501079_0100997 3300049741 Bacteria 2237
246 Ga0501080_0135830 3300049742 Bacteria 2276
247 Ga0501080_0492511 3300049742 Unclassified 1096
248 Ga0501081_0026905 3300049743 Bacteria 3881
249 Ga0501035_0103157 3300049822 Bacteria 2502
250 Ga0501035_0144661 3300049822 Bacteria 2065
251 Ga0501035_0190237 3300049822 Bacteria 1765
252 Ga0501044_0049919 3300049823 Bacteria 4318
253 Ga0501044_0085907 3300049823 Bacteria 3179
254 Ga0501044_0222012 3300049823 Bacteria 1840
255 Ga0501045_0034546 3300049824 Bacteria 3670
256 nmdc:mga03n38_505986_c1 3300050490 Bacteria 678
257 nmdc:mga03n38_61433_c1 3300050490 Bacteria 1711
258 nmdc:mga00v17_118411_c1 3300050491 Bacteria 1685
259 nmdc:mga0yw44_149591_c1 3300050492 Bacteria 1522
260 nmdc:mga0yw44_154166_c1 3300050492 Bacteria 1500
261 nmdc:mga0yw44_163048_c1 3300050492 Bacteria 1460
262 nmdc:mga0yw44_33416_c1 3300050492 Bacteria 3005
263 nmdc:mga0yw44_35897_c1 3300050492 Bacteria 2917
264 nmdc:mga0yw44_461729_c1 3300050492 Bacteria 861
265 nmdc:mga0yw44_519460_c1 3300050492 Bacteria 808
266 nmdc:mga0yw44_542146_c1 3300050492 Bacteria 790
267 nmdc:mga0yw44_54757_c1 3300050492 Bacteria 2426
268 nmdc:mga0yw44_639766_c1 3300050492 Bacteria 723
269 nmdc:mga04h51_22155_c1 3300050495 Bacteria 1919
270 nmdc:mga05p37_376_c1 3300050507 Bacteria 48027
271 nmdc:mga09592_61521_c1 3300050508 Unclassified 3176
272 nmdc:mga0qj67_5266_c1 3300050509 Bacteria 9432
273 nmdc:mga06r32_813_c1 3300050510 Bacteria 27671
274 nmdc:mga0rr50_447825_c1 3300050513 Unclassified 1094
275 nmdc:mga0a205_48224_c1 3300050515 Bacteria 4111
276 nmdc:mga0a205_95321_c1 3300050515 Bacteria 2874
277 Ga0495601_0079201 3300053077 Bacteria 2106
278 Ga0495655_0085700 3300053083 Unclassified 909
279 Ga0495619_0064553 3300053085 Bacteria 2441
280 Ga0500654_073533 3300053099 Viruses 1647
281 Ga0500573_0032515 3300053140 Bacteria 3011
282 Ga0501084_0022169 3300054114 Bacteria 5299
283 Ga0501082_0666941 3300060353 Bacteria 910
284 Ga0530510_0440930 3300061734 Bacteria 984
285 2643850087 2643221567 Bacteria 4163945
286 2644136089 2643221624 Bacteria 4384879
287 2883826417 2883821847 Bacteria 5121194
288 8045833882 8045830549 Bacteria 4444727
289 Ga0070682_100327721
290 Ga0070658_10045417
291 Ga0070658_10410060
292 Ga0070683_100045358
293 Ga0070683_100294867
294 Ga0070680_100090517
295 Ga0070660_100240110
296 Ga0070660_100492452
297 Ga0070659_100090105
298 Ga0070659_100100986
299 Ga0070659_100498173
300 Ga0070667_100091018
301 Ga0070700_100363658
302 Ga0070663_100141230
303 Ga0070663_100436810
304 Ga0070699_100824206
305 Ga0070684_100017387
306 Ga0070665_101397059
307 Ga0070664_100150812
308 Ga0070664_100198847
309 Ga0070664_100425259
310 Ga0068857_100272547
311 Ga0068854_100167280
312 Ga0068854_100454793
313 Ga0068852_100831481
314 Ga0068852_100848414
315 Ga0068852_101461488
316 Ga0068864_100673471
317 Ga0068860_100000826
318 Ga0068862_100706676
319 Ga0081455_10089282
320 Ga0075365_10015437
321 Ga0075365_10130158
322 Ga0075365_10152890
323 Ga0075365_10187628
324 Ga0075365_10225679
325 Ga0075365_10338101
326 Ga0075365_10474447
327 Ga0075368_10015696
328 Ga0075368_10020756
329 Ga0075368_10040693
330 Ga0075363_100001373
331 Ga0075363_100123697
332 Ga0075363_100128901
333 Ga0075364_10009377
334 Ga0075364_10133412
335 Ga0075364_10763052
336 Ga0075367_10019678
337 Ga0075367_10043041
338 Ga0075370_10077199
339 Ga0075428_100006480
340 Ga0075430_100020699
341 Ga0075430_100114573
342 Ga0075431_100001666
343 Ga0075431_100040631
344 Ga0075431_100342598
345 Ga0075433_10211383
346 Ga0075434_100646271
347 Ga0075429_100005849
348 Ga0068865_100295618
349 Ga0075436_100191382
350 Ga0075435_100334814
351 Ga0075435_100462768
352 Ga0111539_10001924
353 Ga0111539_11323259
354 Ga0105245_10040544
355 Ga0105245_10094448
356 Ga0105245_10778159
357 Ga0114129_10018916
358 Ga0105243_10275525
359 Ga0105243_11154974
360 Ga0105241_10853031
361 Ga0105248_10468806
362 Ga0105238_10157834
363 Ga0105238_10916352
364 Ga0105239_10152440
365 Ga0157370_10514125
366 Ga0157369_10144851
367 Ga0157369_10205516
368 Ga0157369_10249120
369 Ga0157374_10894515
370 Ga0163162_10340011
371 Ga0157372_10143147
372 Ga0157375_10088079
373 Ga0157375_10089850
374 Ga0157375_10270453
375 Ga0157375_10354707
376 Ga0157375_10944357
377 Ga0163163_10826644
378 Ga0163163_11273410
379 Ga0157380_11111791
380 Ga0163161_10079499
381 Ga0163161_10729191
382 Ga0206354_10446218
383 Ga0213875_10001642
384 Ga0213875_10019716
385 Ga0207680_10450028
386 Ga0207705_10935476
387 Ga0207654_10519335
388 Ga0207657_10061565
389 Ga0207657_10238943
390 Ga0207657_10805973
391 Ga0207652_10137910
392 Ga0207687_10201364
393 Ga0207687_10364947
394 Ga0207690_10249662
395 Ga0207690_10517208
396 Ga0207686_10075865
397 Ga0207709_10393628
398 Ga0207661_10026049
399 Ga0207679_10295234
400 Ga0207679_10414294
401 Ga0207640_10438943
402 Ga0207658_10214754
403 Ga0207678_10273288
404 Ga0207708_10019425
405 Ga0207702_10600395
406 Ga0207702_10975777
407 Ga0207674_10005985
408 Ga0207674_10139977
409 Ga0207675_100065468
410 Ga0207675_101068807
411 Ga0268265_10539039
412 Ga0268264_10000280
413 Ga0265319_1035228
414 Ga0265319_1162657
415 Ga0265334_10135068
416 Ga0265336_10001216
417 Ga0265338_10003710
418 Ga0265338_10013121
419 Ga0265325_10020843
420 Ga0265340_10026010
421 Ga0265339_10091367
422 Ga0265313_10062334
423 Ga0316575_10017083
424 Ga0265314_10043926
425 Ga0265342_10316833
426 Ga0316577_10030949
427 Ga0373953_0029420
428 Ga0373956_0236251
429 Ga0316574_0162351
430 Ga0373924_0084126
431 Ga0373931_0077009
432 Ga0373947_0061758
433 Ga0373937_0162985
434 Ga0316582_0148675
435 Ga0316584_0206236
436 Ga0373925_0000828
437 Ga0316581_0004746
438 Ga0436364_0383313
439 Ga0436364_1565454
440 Ga0395901_0105243
441 Ga0436360_0724130
442 Ga0451791_0519137
443 Ga0451795_0084420
444 Ga0451839_0468559
445 Ga0451841_1388375
446 Ga0451847_0757906
447 Ga0451853_3655461
448 Ga0450890_024613
449 Ga0466963_0132620
450 Ga0466963_0233949
451 Ga0466963_0265705
452 Ga0466963_0561117
453 Ga0451576_0051979
454 Ga0466967_0150500
455 Ga0466967_0400743
456 Ga0466967_0789541
457 Ga0495592_0006030
458 Ga0495641_0048599
459 Ga0495653_0033124
460 Ga0495664_0252033
461 Ga0495608_0001170
462 Ga0495628_0021140
463 Ga0495628_0192649
464 Ga0495652_0002019
465 Ga0495640_0237180
466 Ga0495587_0016139
467 Ga0495645_0009659
468 Ga0495667_0002374
469 Ga0495634_0146444
470 Ga0495635_0002735
471 Ga0495588_0516423
472 Ga0495599_0014436
473 Ga0495623_0071622
474 Ga0495646_0053133
475 Ga0495600_0006062
476 Ga0495604_0006218
477 Ga0495674_0005456
478 Ga0495680_0068002
479 Ga0495675_0007064
480 Ga0495684_0004064
481 Ga0495602_0050538
482 Ga0496100_0349857
483 Ga0496100_0481947
484 Ga0496102_0022494
485 Ga0496104_0016062
486 Ga0496104_0065397
487 Ga0496105_0126828
488 Ga0496105_0138509
489 Ga0496107_0197042
490 Ga0496108_0004869
491 Ga0496108_0148069
492 Ga0496109_0004446
493 Ga0496109_0055790
494 Ga0496109_0262492
495 Ga0496110_0314743
496 Ga0496111_0148667
497 Ga0496111_0405864
498 Ga0496112_0034610
499 Ga0496113_0393040
500 Ga0496114_0006393
501 Ga0496114_0011603
502 Ga0496114_0023175
503 Ga0496114_0046427
504 Ga0496114_0399209
505 Ga0496115_0166087
506 Ga0501031_0085577
507 Ga0501036_0009236
508 Ga0501038_0007541
509 Ga0501039_0004923
510 Ga0501039_0268370
511 Ga0501040_0013322
512 Ga0501041_0122642
513 Ga0501041_0173967
514 Ga0501042_0009929
515 Ga0501046_0116162
516 Ga0501046_0399008
517 Ga0501047_0556443
518 Ga0501048_0003907
519 Ga0501048_0330165
520 Ga0501069_0249806
521 Ga0501070_0193189
522 Ga0501070_0271762
523 Ga0501070_0419964
524 Ga0501071_0011733
525 Ga0501072_0698051
526 Ga0501074_0023380
527 Ga0501074_0068455
528 Ga0501076_0068320
529 Ga0501076_0069197
530 Ga0501076_0338238
531 Ga0501076_0942012
532 Ga0501079_0008075
533 Ga0501079_0100997
534 Ga0501080_0135830
535 Ga0501080_0492511
536 Ga0501081_0026905
537 Ga0501035_0103157
538 Ga0501035_0144661
539 Ga0501035_0190237
540 Ga0501044_0049919
541 Ga0501044_0085907
542 Ga0501044_0222012
543 Ga0501045_0034546
544 nmdc:mga03n38_505986_c1
545 nmdc:mga03n38_61433_c1
546 nmdc:mga00v17_118411_c1
547 nmdc:mga0yw44_149591_c1
548 nmdc:mga0yw44_154166_c1
549 nmdc:mga0yw44_163048_c1
550 nmdc:mga0yw44_33416_c1
551 nmdc:mga0yw44_35897_c1
552 nmdc:mga0yw44_461729_c1
553 nmdc:mga0yw44_519460_c1
554 nmdc:mga0yw44_542146_c1
555 nmdc:mga0yw44_54757_c1
556 nmdc:mga0yw44_639766_c1
557 nmdc:mga04h51_22155_c1
558 nmdc:mga05p37_376_c1
559 nmdc:mga09592_61521_c1
560 nmdc:mga0qj67_5266_c1
561 nmdc:mga06r32_813_c1
562 nmdc:mga0rr50_447825_c1
563 nmdc:mga0a205_48224_c1
564 nmdc:mga0a205_95321_c1
565 Ga0495601_0079201
566 Ga0495655_0085700
567 Ga0495619_0064553
568 Ga0500654_073533
569 Ga0500573_0032515
570 Ga0501084_0022169
571 Ga0501082_0666941
572 Ga0530510_0440930
573 2643850087
574 2644136089
575 2883826417
576 8045833882

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s60-assembly1.cif.gz_A-2 aminoglycoside n-acetyltransferase aac(6')-iy in complex with coa and n-terminal his(6)-tag (crystal form 2) 0.7735 9 137
2vbq-assembly1.cif.gz_A structure of aac(6')-iy in complex with bisubstrate analog coa-s- monomethyl-acetylneamine. 0.769 9 136
7wx6-assembly1.cif.gz_A a legionella acetyltransferase vipf 0.7564 8 137
7n1l-assembly8.cif.gz_O crystal structure of ribosomal-protein-alanine n-acetyltransferase from brucella melitensis biovar abortus 2308 0.738 10 138
7n1l-assembly7.cif.gz_M crystal structure of ribosomal-protein-alanine n-acetyltransferase from brucella melitensis biovar abortus 2308 0.7368 9 138
ID Description Score Start End Superfamily
af_Q555H5_1389_1473_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8384 79 141 3.40.630.30
af_K7LHF0_767_874_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7965 66 138 3.40.630.30
af_A0A0R0IHP4_113_245_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7711 78 138 3.40.630.30
af_Q8WUY8_92_189_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7651 78 136 3.40.630.30
af_G5EE42_2_95_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7446 70 137 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A2P2CI62-F1-model_v4 GCN5-related N-acetyltransferase 0.9881 65 195 GO:0016747
AF-A0A529HB16-F1-model_v4 GNAT family N-acetyltransferase 0.9715 62 146 GO:0016740
AF-A0A850D2U1-F1-model_v4 deleted 0.9712 14 194
AF-A0A239M537-F1-model_v4 N-acetyltransferase domain-containing protein 0.9681 102 194
AF-A0A7C9PJE5-F1-model_v4 GNAT family N-acetyltransferase 0.9638 9 195 GO:0016747

Map