F388096

General Info

Members Datasets Scaffolds Average Seq Length
287 159 287 133

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100870388|Ga0307416_1008703881
Length 137
Sequence MNPKRKRTTRLVISLTAAVILASALVYTSFSASSEARSPSQLDDAVPGRSYELTGRVMPGYHRVGDVLVFRVRDRTGSSTATVPVRYAGAVPDPFRAGREVIVTVRRRGDVFVGQKDSLVTKCPSKFSDTPAPGTGR

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
8 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
96 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
104 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
105 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
106 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
112 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
115 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
116 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
117 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
120 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
123 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
124 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
137 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
138 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
139 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
140 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
141 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
144 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
145 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
146 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
147 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
148 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
149 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
150 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
151 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
152 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
153 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
154 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
155 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
156 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
157 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
158 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
159 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.3
Metatranscriptomes 0.7
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.23
Nodule 0
Rhizoplane 1.39
Rhizosphere 92.68
Stem 0
Stem Tuber 0
Unclassified 0.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10380262 3300005327 Bacteria 1211
2 Ga0070683_100022699 3300005329 Bacteria 5612
3 Ga0070680_100005163 3300005336 Bacteria 9874
4 Ga0070660_100016143 3300005339 Bacteria 5414
5 Ga0070692_10379760 3300005345 Bacteria 886
6 Ga0070659_100006515 3300005366 Bacteria 8430
7 Ga0070659_100392286 3300005366 Bacteria 1171
8 Ga0070700_100314552 3300005441 Bacteria 1148
9 Ga0070678_101033701 3300005456 Viruses 756
10 Ga0070681_10091114 3300005458 Bacteria 2999
11 Ga0070681_10769929 3300005458 Bacteria 879
12 Ga0070681_12052651 3300005458 Bacteria 500
13 Ga0070679_100017967 3300005530 Bacteria 6853
14 Ga0070684_100052601 3300005535 Bacteria 3542
15 Ga0070684_100074548 3300005535 Bacteria 2991
16 Ga0070684_101146407 3300005535 Bacteria 731
17 Ga0068853_100011930 3300005539 Bacteria 7066
18 Ga0070672_100452404 3300005543 Unclassified 1106
19 Ga0070686_101424487 3300005544 Bacteria 582
20 Ga0070696_100556307 3300005546 Bacteria 920
21 Ga0070693_101467815 3300005547 Bacteria 532
22 Ga0070704_100402788 3300005549 Bacteria 1168
23 Ga0068855_100806797 3300005563 Bacteria 997
24 Ga0070664_100292499 3300005564 Bacteria 1471
25 Ga0070664_100746599 3300005564 Bacteria 913
26 Ga0068854_100208318 3300005578 Bacteria 1541
27 Ga0068856_100010275 3300005614 Bacteria 9098
28 Ga0068852_100119524 3300005616 Bacteria 2409
29 Ga0068870_10686790 3300005840 Bacteria 705
30 Ga0068858_100549423 3300005842 Unclassified 1118
31 Ga0081455_10160293 3300005937 Bacteria 1725
32 Ga0081538_10070853 3300005981 Bacteria 1922
33 Ga0081539_10009179 3300005985 Bacteria 8340
34 Ga0075365_10078501 3300006038 Bacteria 2232
35 Ga0075365_10084909 3300006038 Bacteria 2149
36 Ga0075365_10178707 3300006038 Bacteria 1483
37 Ga0075365_10645101 3300006038 Bacteria 748
38 Ga0075368_10028105 3300006042 Bacteria 2172
39 Ga0075363_100007424 3300006048 Bacteria 5038
40 Ga0075364_10058111 3300006051 Bacteria 2534
41 Ga0075367_10201500 3300006178 Bacteria 1243
42 Ga0075428_100123245 3300006844 Bacteria 2821
43 Ga0075428_100614301 3300006844 Bacteria 1161
44 Ga0075428_101334924 3300006844 Bacteria 754
45 Ga0075428_101338051 3300006844 Bacteria 753
46 Ga0075428_101340554 3300006844 Bacteria 752
47 Ga0075430_100024461 3300006846 Bacteria 5138
48 Ga0075430_100192366 3300006846 Bacteria 1696
49 Ga0075431_100088838 3300006847 Bacteria 3190
50 Ga0075431_101432953 3300006847 Bacteria 650
51 Ga0075434_100126267 3300006871 Bacteria 2575
52 Ga0075429_100107839 3300006880 Bacteria 2434
53 Ga0075429_100433317 3300006880 Bacteria 1152
54 Ga0075429_101003354 3300006880 Bacteria 730
55 Ga0075429_101290836 3300006880 Bacteria 637
56 Ga0068865_101607864 3300006881 Unclassified 584
57 Ga0105240_10011892 3300009093 Bacteria 12076
58 Ga0111539_10006560 3300009094 Bacteria 14996
59 Ga0111539_10145270 3300009094 Bacteria 2777
60 Ga0111539_10303695 3300009094 Bacteria 1857
61 Ga0111539_10352152 3300009094 Bacteria 1714
62 Ga0105245_10523680 3300009098 Bacteria 1204
63 Ga0114129_10002955 3300009147 Bacteria 23781
64 Ga0114129_10578712 3300009147 Bacteria 1457
65 Ga0114129_10682192 3300009147 Bacteria 1323
66 Ga0114129_11066880 3300009147 Bacteria 1013
67 Ga0105243_10407448 3300009148 Bacteria 1265
68 Ga0105243_11800937 3300009148 Viruses 643
69 Ga0105242_10390622 3300009176 Bacteria 1296
70 Ga0105248_13006010 3300009177 Viruses 537
71 Ga0105237_10089582 3300009545 Bacteria 3066
72 Ga0105238_10081120 3300009551 Bacteria 3233
73 Ga0105249_10698345 3300009553 Bacteria 1074
74 Ga0105239_10362276 3300010375 Bacteria 1638
75 Ga0105246_11371601 3300011119 Unclassified 658
76 Ga0157371_10035627 3300013102 Bacteria 3566
77 Ga0157370_10005899 3300013104 Bacteria 13653
78 Ga0157369_10023010 3300013105 Bacteria 6946
79 Ga0157369_12216890 3300013105 Bacteria 557
80 Ga0163162_12246388 3300013306 Viruses 627
81 Ga0157372_10017054 3300013307 Bacteria 7796
82 Ga0157372_10719995 3300013307 Bacteria 1161
83 Ga0157375_10867503 3300013308 Bacteria 1048
84 Ga0157380_12732946 3300014326 Archaea 560
85 Ga0182008_10524064 3300014497 Bacteria 655
86 Ga0206356_10104443 3300020070 Bacteria 854
87 Ga0206353_11647415 3300020082 Bacteria 3619
88 Ga0207647_10173617 3300025904 Bacteria 1254
89 Ga0207643_10431959 3300025908 Bacteria 836
90 Ga0207705_10292946 3300025909 Bacteria 1247
91 Ga0207707_10003337 3300025912 Bacteria 14251
92 Ga0207695_10221160 3300025913 Bacteria 1801
93 Ga0207671_10023217 3300025914 Bacteria 4679
94 Ga0207660_10023019 3300025917 Bacteria 4204
95 Ga0207662_10922417 3300025918 Bacteria 619
96 Ga0207657_10005840 3300025919 Bacteria 12825
97 Ga0207657_10415046 3300025919 Bacteria 1058
98 Ga0207649_10014135 3300025920 Bacteria 4468
99 Ga0207649_10661623 3300025920 Viruses 808
100 Ga0207652_10016967 3300025921 Bacteria 5955
101 Ga0207694_10085130 3300025924 Bacteria 2488
102 Ga0207687_10413356 3300025927 Bacteria 1112
103 Ga0207690_10004895 3300025932 Bacteria 7901
104 Ga0207691_10512125 3300025940 Unclassified 1019
105 Ga0207661_10000443 3300025944 Bacteria 26690
106 Ga0207661_10007297 3300025944 Bacteria 7864
107 Ga0207661_10340812 3300025944 Bacteria 1351
108 Ga0207661_11372605 3300025944 Unclassified 649
109 Ga0207679_10270974 3300025945 Bacteria 1452
110 Ga0207667_10699222 3300025949 Bacteria 1016
111 Ga0207712_10154139 3300025961 Bacteria 1778
112 Ga0207668_11108789 3300025972 Bacteria 710
113 Ga0207640_10154579 3300025981 Bacteria 1689
114 Ga0207640_10944803 3300025981 Bacteria 755
115 Ga0207640_11014237 3300025981 Bacteria 731
116 Ga0207658_10632409 3300025986 Bacteria 964
117 Ga0207639_10999347 3300026041 Unclassified 783
118 Ga0207639_11310590 3300026041 Unclassified 680
119 Ga0207708_10620901 3300026075 Bacteria 917
120 Ga0207702_10012481 3300026078 Bacteria 7069
121 Ga0207702_11070579 3300026078 Bacteria 800
122 Ga0207675_100073764 3300026118 Bacteria 3193
123 Ga0207683_11162586 3300026121 Bacteria 715
124 Ga0207698_10071102 3300026142 Bacteria 2760
125 Ga0207698_11500565 3300026142 Unclassified 689
126 Ga0207428_10038642 3300027907 Bacteria 3879
127 Ga0307408_101413692 3300031548 Bacteria 655
128 Ga0316576_10001940 3300031727 Bacteria 11553
129 Ga0307405_10380255 3300031731 Bacteria 1099
130 Ga0307405_10563602 3300031731 Unclassified 924
131 Ga0307405_10995148 3300031731 Unclassified 715
132 Ga0307413_10595061 3300031824 Unclassified 904
133 Ga0307413_11295138 3300031824 Bacteria 637
134 Ga0307410_10093378 3300031852 Bacteria 2141
135 Ga0307410_10115911 3300031852 Bacteria 1946
136 Ga0307410_10611452 3300031852 Bacteria 910
137 Ga0307410_11277765 3300031852 Bacteria 641
138 Ga0307406_10143232 3300031901 Unclassified 1695
139 Ga0307406_10161223 3300031901 Bacteria 1612
140 Ga0307406_10197004 3300031901 Bacteria 1480
141 Ga0307406_10227145 3300031901 Bacteria 1391
142 Ga0307406_10293946 3300031901 Bacteria 1245
143 Ga0307406_10546178 3300031901 Unclassified 947
144 Ga0307406_10792871 3300031901 Unclassified 799
145 Ga0307407_10162844 3300031903 Bacteria 1461
146 Ga0307412_10114050 3300031911 Bacteria 1935
147 Ga0307412_10652233 3300031911 Bacteria 898
148 Ga0307412_11103438 3300031911 Unclassified 706
149 Ga0307409_100014932 3300031995 Bacteria 5075
150 Ga0307409_100016239 3300031995 Bacteria 4919
151 Ga0307409_100132011 3300031995 Bacteria 2136
152 Ga0307409_100397946 3300031995 Bacteria 1315
153 Ga0307409_100437569 3300031995 Bacteria 1259
154 Ga0307416_100277217 3300032002 Bacteria 1651
155 Ga0307416_100296290 3300032002 Bacteria 1605
156 Ga0307416_100441776 3300032002 Bacteria 1351
157 Ga0307416_100870388 3300032002 Bacteria 1000
158 Ga0307416_101355035 3300032002 Unclassified 817
159 Ga0307416_101615797 3300032002 Bacteria 753
160 Ga0307416_101885927 3300032002 Unclassified 701
161 Ga0307414_10866373 3300032004 Bacteria 827
162 Ga0307411_10108842 3300032005 Bacteria 1978
163 Ga0307411_10285799 3300032005 Bacteria 1315
164 Ga0307415_100006363 3300032126 Bacteria 6360
165 Ga0307415_100016500 3300032126 Bacteria 4406
166 Ga0307415_100043403 3300032126 Bacteria 3000
167 Ga0307415_100091760 3300032126 Bacteria 2201
168 Ga0307415_100111251 3300032126 Bacteria 2033
169 Ga0307415_100246840 3300032126 Bacteria 1448
170 Ga0307415_100263823 3300032126 Bacteria 1407
171 Ga0307415_100580697 3300032126 Bacteria 994
172 Ga0307415_100953852 3300032126 Unclassified 794
173 Ga0307415_101505987 3300032126 Bacteria 644
174 Ga0316580_10143059 3300032139 Bacteria 734
175 Ga0373960_0325163 3300035121 Bacteria 577
176 Ga0316574_0046665 3300035398 Bacteria 2687
177 Ga0316574_0116019 3300035398 Bacteria 1717
178 Ga0316584_0056660 3300036712 Bacteria 2933
179 Ga0395900_0745845 3300037418 Unclassified 910
180 Ga0395898_0216935 3300037466 Bacteria 1825
181 Ga0395898_0293193 3300037466 Bacteria 1552
182 Ga0395905_0830743 3300037471 Bacteria 827
183 Ga0395901_0067832 3300038443 Bacteria 3716
184 Ga0395901_0536521 3300038443 Bacteria 1187
185 Ga0395901_0802972 3300038443 Bacteria 930
186 Ga0395901_0948817 3300038443 Bacteria 839
187 Ga0395901_1166154 3300038443 Unclassified 738
188 Ga0451837_1300303 3300041494 Bacteria 795
189 Ga0466965_0114390 3300044683 Bacteria 1389
190 Ga0466965_0227717 3300044683 Bacteria 995
191 Ga0466965_0474521 3300044683 Unclassified 699
192 Ga0466963_0029478 3300044694 Bacteria 3533
193 Ga0466963_0242740 3300044694 Bacteria 1263
194 Ga0466963_0525413 3300044694 Bacteria 836
195 Ga0466963_1071432 3300044694 Bacteria 567
196 Ga0466964_0137203 3300044706 Bacteria 1120
197 Ga0466964_0302772 3300044706 Bacteria 806
198 Ga0466964_0422815 3300044706 Bacteria 701
199 Ga0466971_0220104 3300044719 Bacteria 900
200 Ga0466971_0300622 3300044719 Bacteria 770
201 Ga0466957_0430257 3300044842 Bacteria 907
202 Ga0466957_1148579 3300044842 Bacteria 561
203 Ga0466957_1188285 3300044842 Unclassified 552
204 Ga0466960_0124480 3300044901 Bacteria 1354
205 Ga0466960_0191357 3300044901 Bacteria 1114
206 Ga0466960_0274604 3300044901 Bacteria 943
207 Ga0466960_0352179 3300044901 Bacteria 840
208 Ga0466960_0547795 3300044901 Bacteria 682
209 Ga0466960_0619998 3300044901 Bacteria 643
210 Ga0466967_0013701 3300045976 Bacteria 6280
211 Ga0466967_0033230 3300045976 Bacteria 4365
212 Ga0466967_0149354 3300045976 Bacteria 2183
213 Ga0466967_0171553 3300045976 Bacteria 2041
214 Ga0466967_0200915 3300045976 Bacteria 1888
215 Ga0466967_0280541 3300045976 Bacteria 1598
216 Ga0466967_0375658 3300045976 Bacteria 1379
217 Ga0466967_0506334 3300045976 Bacteria 1185
218 Ga0466967_0535545 3300045976 Bacteria 1152
219 Ga0466967_0883632 3300045976 Bacteria 888
220 Ga0466967_0924566 3300045976 Bacteria 868
221 Ga0466967_1277625 3300045976 Bacteria 731
222 Ga0496104_1557128 3300048907 Bacteria 564
223 Ga0496107_0544079 3300048910 Bacteria 860
224 Ga0496109_1248779 3300048912 Bacteria 679
225 Ga0496112_0055480 3300048915 Bacteria 3896
226 Ga0496124_0403528 3300048927 Bacteria 948
227 Ga0501031_0154564 3300049568 Bacteria 1499
228 Ga0501034_0008403 3300049571 Bacteria 10910
229 Ga0501034_0388485 3300049571 Bacteria 1320
230 Ga0501036_0046600 3300049572 Bacteria 3671
231 Ga0501036_0049346 3300049572 Bacteria 3564
232 Ga0501037_0154604 3300049573 Bacteria 1638
233 Ga0501037_0240915 3300049573 Bacteria 1268
234 Ga0501037_0328599 3300049573 Bacteria 1058
235 Ga0501038_0673083 3300049574 Unclassified 777
236 Ga0501039_0130475 3300049575 Bacteria 1972
237 Ga0501039_0327223 3300049575 Bacteria 1204
238 Ga0501040_0128013 3300049576 Bacteria 1784
239 Ga0501041_0023141 3300049577 Bacteria 3726
240 Ga0501041_0964356 3300049577 Bacteria 548
241 Ga0501042_0072400 3300049578 Bacteria 2466
242 Ga0501042_0237425 3300049578 Bacteria 1315
243 Ga0501042_0308422 3300049578 Bacteria 1143
244 Ga0501043_0132705 3300049579 Bacteria 1952
245 Ga0501047_0254915 3300049581 Bacteria 1603
246 Ga0501048_0023615 3300049582 Bacteria 4493
247 Ga0501071_0011497 3300049587 Bacteria 5968
248 Ga0501072_0064510 3300049588 Bacteria 2888
249 Ga0501072_0420258 3300049588 Unclassified 1060
250 Ga0501074_0587012 3300049590 Bacteria 788
251 Ga0501075_0012953 3300049591 Bacteria 5941
252 Ga0501075_0209807 3300049591 Bacteria 1486
253 Ga0501076_0019685 3300049592 Bacteria 5161
254 Ga0501076_0360869 3300049592 Unclassified 1194
255 Ga0501081_0034089 3300049743 Bacteria 3462
256 Ga0501081_0041301 3300049743 Bacteria 3158
257 Ga0501035_0181880 3300049822 Bacteria 1811
258 Ga0501035_0272866 3300049822 Bacteria 1431
259 Ga0501045_0235693 3300049824 Bacteria 1362
260 nmdc:mga03n38_142945_c1 3300050490 Bacteria 1197
261 nmdc:mga00v17_55756_c1 3300050491 Bacteria 2414
262 nmdc:mga0yw44_483741_c1 3300050492 Unclassified 840
263 nmdc:mga0yw44_49196_c1 3300050492 Bacteria 2544
264 nmdc:mga0yw44_670251_c1 3300050492 Bacteria 705
265 nmdc:mga06z11_323177_c1 3300050494 Bacteria 921
266 nmdc:mga04h51_16865_c1 3300050495 Bacteria 2126
267 nmdc:mga05p37_582441_c1 3300050507 Bacteria 1267
268 nmdc:mga05p37_628928_c1 3300050507 Bacteria 1206
269 nmdc:mga05p37_703984_c1 3300050507 Bacteria 1121
270 nmdc:mga05p37_8890_c1 3300050507 Bacteria 11869
271 nmdc:mga09592_101135_c1 3300050508 Bacteria 2469
272 nmdc:mga09592_593750_c1 3300050508 Bacteria 949
273 nmdc:mga0qj67_124732_c1 3300050509 Bacteria 2084
274 nmdc:mga06r32_271100_c1 3300050510 Bacteria 1684
275 nmdc:mga06r32_747420_c1 3300050510 Bacteria 941
276 nmdc:mga06r32_941239_c1 3300050510 Bacteria 819
277 nmdc:mga08y16_23610_c1 3300050511 Bacteria 6495
278 nmdc:mga08y16_34965_c1 3300050511 Bacteria 5279
279 nmdc:mga08y16_946824_c1 3300050511 Bacteria 844
280 nmdc:mga0n895_453587_c1 3300050512 Unclassified 1294
281 Ga0495655_0020068 3300053083 Bacteria 1494
282 Ga0501084_0030550 3300054114 Bacteria 4505
283 Ga0501084_0107620 3300054114 Bacteria 2342
284 Ga0501082_0036340 3300060353 Bacteria 4244
285 Ga0466962_0055335 3300061719 Bacteria 1896
286 Ga0530510_0014146 3300061734 Bacteria 5625
287 Ga0530510_0099335 3300061734 Bacteria 2128

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038443 Ga0395901_0948817 Ga0395901_0948817_385_747 120
2 3300009553 Ga0105249_10698345 Ga0105249_106983452 121
3 3300013105 Ga0157369_12216890 Ga0157369_122168901 121
4 3300025961 Ga0207712_10154139 Ga0207712_101541392 121
5 3300025920 Ga0207649_10661623 Ga0207649_106616232 124
6 3300011119 Ga0105246_11371601 Ga0105246_113716011 125
7 3300038443 Ga0395901_0802972 Ga0395901_0802972_49_438 129
8 3300044694 Ga0466963_0525413 Ga0466963_0525413_384_776 129
9 3300005547 Ga0070693_101467815 Ga0070693_1014678151 130
10 3300025981 Ga0207640_11014237 Ga0207640_110142372 130
11 3300031731 Ga0307405_10380255 Ga0307405_103802551 130
12 3300031852 Ga0307410_11277765 Ga0307410_112777652 130
13 3300031901 Ga0307406_10197004 Ga0307406_101970042 130
14 3300031995 Ga0307409_100132011 Ga0307409_1001320112 130
15 3300032002 Ga0307416_100277217 Ga0307416_1002772172 130
16 3300032004 Ga0307414_10866373 Ga0307414_108663731 130
17 3300032005 Ga0307411_10108842 Ga0307411_101088422 130
18 3300032126 Ga0307415_100043403 Ga0307415_1000434032 130
19 3300049568 Ga0501031_0154564 Ga0501031_0154564_303_740 130
20 3300049572 Ga0501036_0046600 Ga0501036_0046600_808_1245 130
21 3300049573 Ga0501037_0328599 Ga0501037_0328599_461_853 130
22 3300049575 Ga0501039_0327223 Ga0501039_0327223_86_523 130
23 3300049577 Ga0501041_0023141 Ga0501041_0023141_2168_2605 130
24 3300049578 Ga0501042_0072400 Ga0501042_0072400_144_536 130
25 3300049587 Ga0501071_0011497 Ga0501071_0011497_4836_5273 130
26 3300049588 Ga0501072_0064510 Ga0501072_0064510_764_1201 130
27 3300049591 Ga0501075_0012953 Ga0501075_0012953_3503_3940 130
28 3300049592 Ga0501076_0019685 Ga0501076_0019685_3964_4401 130
29 3300049743 Ga0501081_0041301 Ga0501081_0041301_1379_1816 130
30 3300049822 Ga0501035_0181880 Ga0501035_0181880_618_1055 130
31 3300054114 Ga0501084_0107620 Ga0501084_0107620_1217_1654 130
32 3300060353 Ga0501082_0036340 Ga0501082_0036340_551_988 130
33 3300061734 Ga0530510_0014146 Ga0530510_0014146_2262_2699 130
34 3300005366 Ga0070659_100392286 Ga0070659_1003922861 131
35 3300005441 Ga0070700_100314552 Ga0070700_1003145523 131
36 3300005456 Ga0070678_101033701 Ga0070678_1010337012 131
37 3300005458 Ga0070681_10769929 Ga0070681_107699292 131
38 3300005535 Ga0070684_101146407 Ga0070684_1011464072 131
39 3300005543 Ga0070672_100452404 Ga0070672_1004524042 131
40 3300005544 Ga0070686_101424487 Ga0070686_1014244871 131
41 3300005546 Ga0070696_100556307 Ga0070696_1005563072 131
42 3300005549 Ga0070704_100402788 Ga0070704_1004027883 131
43 3300005840 Ga0068870_10686790 Ga0068870_106867901 131
44 3300005842 Ga0068858_100549423 Ga0068858_1005494233 131
45 3300005937 Ga0081455_10160293 Ga0081455_101602933 131
46 3300005981 Ga0081538_10070853 Ga0081538_100708532 131
47 3300005985 Ga0081539_10009179 Ga0081539_100091795 131
48 3300006038 Ga0075365_10078501 Ga0075365_100785012 131
49 3300006038 Ga0075365_10084909 Ga0075365_100849092 131
50 3300006038 Ga0075365_10178707 Ga0075365_101787072 131
51 3300006038 Ga0075365_10645101 Ga0075365_106451011 131
52 3300006042 Ga0075368_10028105 Ga0075368_100281052 131
53 3300006048 Ga0075363_100007424 Ga0075363_1000074242 131
54 3300006051 Ga0075364_10058111 Ga0075364_100581112 131
55 3300006178 Ga0075367_10201500 Ga0075367_102015002 131
56 3300006844 Ga0075428_101334924 Ga0075428_1013349242 131
57 3300006844 Ga0075428_101338051 Ga0075428_1013380512 131
58 3300006844 Ga0075428_101340554 Ga0075428_1013405542 131
59 3300006846 Ga0075430_100024461 Ga0075430_1000244615 131
60 3300006846 Ga0075430_100192366 Ga0075430_1001923663 131
61 3300006847 Ga0075431_100088838 Ga0075431_1000888382 131
62 3300006847 Ga0075431_101432953 Ga0075431_1014329531 131
63 3300006871 Ga0075434_100126267 Ga0075434_1001262672 131
64 3300006880 Ga0075429_100107839 Ga0075429_1001078393 131
65 3300006881 Ga0068865_101607864 Ga0068865_1016078641 131
66 3300009094 Ga0111539_10145270 Ga0111539_101452702 131
67 3300009094 Ga0111539_10303695 Ga0111539_103036952 131
68 3300009094 Ga0111539_10352152 Ga0111539_103521522 131
69 3300009098 Ga0105245_10523680 Ga0105245_105236801 131
70 3300009147 Ga0114129_10002955 Ga0114129_100029556 131
71 3300009147 Ga0114129_10578712 Ga0114129_105787122 131
72 3300009147 Ga0114129_11066880 Ga0114129_110668802 131
73 3300009148 Ga0105243_10407448 Ga0105243_104074484 131
74 3300009177 Ga0105248_13006010 Ga0105248_130060101 131
75 3300013306 Ga0163162_12246388 Ga0163162_122463881 131
76 3300013307 Ga0157372_10719995 Ga0157372_107199954 131
77 3300013308 Ga0157375_10867503 Ga0157375_108675032 131
78 3300025908 Ga0207643_10431959 Ga0207643_104319592 131
79 3300025918 Ga0207662_10922417 Ga0207662_109224172 131
80 3300025919 Ga0207657_10415046 Ga0207657_104150461 131
81 3300025927 Ga0207687_10413356 Ga0207687_104133562 131
82 3300025940 Ga0207691_10512125 Ga0207691_105121252 131
83 3300025944 Ga0207661_11372605 Ga0207661_113726051 131
84 3300025972 Ga0207668_11108789 Ga0207668_111087892 131
85 3300025981 Ga0207640_10944803 Ga0207640_109448032 131
86 3300025986 Ga0207658_10632409 Ga0207658_106324092 131
87 3300026041 Ga0207639_11310590 Ga0207639_113105902 131
88 3300026075 Ga0207708_10620901 Ga0207708_106209012 131
89 3300026118 Ga0207675_100073764 Ga0207675_1000737643 131
90 3300026121 Ga0207683_11162586 Ga0207683_111625862 131
91 3300027907 Ga0207428_10038642 Ga0207428_100386422 131
92 3300031548 Ga0307408_101413692 Ga0307408_1014136922 131
93 3300031727 Ga0316576_10001940 Ga0316576_1000194010 131
94 3300031731 Ga0307405_10563602 Ga0307405_105636021 131
95 3300031824 Ga0307413_10595061 Ga0307413_105950612 131
96 3300031824 Ga0307413_11295138 Ga0307413_112951381 131
97 3300031852 Ga0307410_10093378 Ga0307410_100933781 131
98 3300031852 Ga0307410_10611452 Ga0307410_106114521 131
99 3300031901 Ga0307406_10161223 Ga0307406_101612232 131
100 3300031901 Ga0307406_10293946 Ga0307406_102939462 131
101 3300031901 Ga0307406_10546178 Ga0307406_105461782 131
102 3300031903 Ga0307407_10162844 Ga0307407_101628442 131
103 3300031911 Ga0307412_10114050 Ga0307412_101140502 131
104 3300031995 Ga0307409_100014932 Ga0307409_1000149329 131
105 3300031995 Ga0307409_100016239 Ga0307409_1000162395 131
106 3300032002 Ga0307416_100870388 Ga0307416_1008703881 131
107 3300032005 Ga0307411_10285799 Ga0307411_102857992 131
108 3300032126 Ga0307415_100006363 Ga0307415_1000063634 131
109 3300032126 Ga0307415_100091760 Ga0307415_1000917602 131
110 3300032126 Ga0307415_100953852 Ga0307415_1009538522 131
111 3300032139 Ga0316580_10143059 Ga0316580_101430591 131
112 3300035398 Ga0316574_0046665 Ga0316574_0046665_961_1359 131
113 3300035398 Ga0316574_0116019 Ga0316574_0116019_341_739 131
114 3300036712 Ga0316584_0056660 Ga0316584_0056660_609_1007 131
115 3300037418 Ga0395900_0745845 Ga0395900_0745845_439_834 131
116 3300037466 Ga0395898_0293193 Ga0395898_0293193_89_484 131
117 3300038443 Ga0395901_1166154 Ga0395901_1166154_258_653 131
118 3300041494 Ga0451837_1300303 Ga0451837_1300303_301_702 131
119 3300044719 Ga0466971_0220104 Ga0466971_0220104_202_597 131
120 3300045976 Ga0466967_0535545 Ga0466967_0535545_191_586 131
121 3300048910 Ga0496107_0544079 Ga0496107_0544079_358_753 131
122 3300048912 Ga0496109_1248779 Ga0496109_1248779_182_577 131
123 3300048927 Ga0496124_0403528 Ga0496124_0403528_190_591 131
124 3300049571 Ga0501034_0008403 Ga0501034_0008403_6045_6446 131
125 3300049573 Ga0501037_0154604 Ga0501037_0154604_440_841 131
126 3300049579 Ga0501043_0132705 Ga0501043_0132705_939_1340 131
127 3300049581 Ga0501047_0254915 Ga0501047_0254915_1092_1493 131
128 3300049822 Ga0501035_0272866 Ga0501035_0272866_325_726 131
129 3300050490 nmdc:mga03n38_142945_c1 nmdc:mga03n38_142945_c1_467_868 131
130 3300050491 nmdc:mga00v17_55756_c1 nmdc:mga00v17_55756_c1_1741_2142 131
131 3300050492 nmdc:mga0yw44_483741_c1 nmdc:mga0yw44_483741_c1_240_641 131
132 3300050492 nmdc:mga0yw44_49196_c1 nmdc:mga0yw44_49196_c1_756_1157 131
133 3300050492 nmdc:mga0yw44_670251_c1 nmdc:mga0yw44_670251_c1_278_679 131
134 3300050494 nmdc:mga06z11_323177_c1 nmdc:mga06z11_323177_c1_432_833 131
135 3300050495 nmdc:mga04h51_16865_c1 nmdc:mga04h51_16865_c1_1304_1705 131
136 3300050507 nmdc:mga05p37_628928_c1 nmdc:mga05p37_628928_c1_189_584 131
137 3300050507 nmdc:mga05p37_703984_c1 nmdc:mga05p37_703984_c1_603_998 131
138 3300050507 nmdc:mga05p37_8890_c1 nmdc:mga05p37_8890_c1_7796_8194 131
139 3300050508 nmdc:mga09592_101135_c1 nmdc:mga09592_101135_c1_1194_1589 131
140 3300050509 nmdc:mga0qj67_124732_c1 nmdc:mga0qj67_124732_c1_538_936 131
141 3300050510 nmdc:mga06r32_271100_c1 nmdc:mga06r32_271100_c1_612_1007 131
142 3300050510 nmdc:mga06r32_747420_c1 nmdc:mga06r32_747420_c1_344_739 131
143 3300050510 nmdc:mga06r32_941239_c1 nmdc:mga06r32_941239_c1_202_600 131
144 3300050511 nmdc:mga08y16_23610_c1 nmdc:mga08y16_23610_c1_2945_3340 131
145 3300050511 nmdc:mga08y16_946824_c1 nmdc:mga08y16_946824_c1_260_655 131
146 3300050512 nmdc:mga0n895_453587_c1 nmdc:mga0n895_453587_c1_849_1244 131
147 3300005327 Ga0070658_10380262 Ga0070658_103802622 132
148 3300005329 Ga0070683_100022699 Ga0070683_1000226992 132
149 3300005336 Ga0070680_100005163 Ga0070680_1000051634 132
150 3300005339 Ga0070660_100016143 Ga0070660_1000161437 132
151 3300005345 Ga0070692_10379760 Ga0070692_103797602 132
152 3300005366 Ga0070659_100006515 Ga0070659_1000065154 132
153 3300005458 Ga0070681_10091114 Ga0070681_100911142 132
154 3300005458 Ga0070681_12052651 Ga0070681_120526511 132
155 3300005530 Ga0070679_100017967 Ga0070679_1000179676 132
156 3300005535 Ga0070684_100052601 Ga0070684_1000526012 132
157 3300005535 Ga0070684_100074548 Ga0070684_1000745484 132
158 3300005539 Ga0068853_100011930 Ga0068853_1000119305 132
159 3300005563 Ga0068855_100806797 Ga0068855_1008067972 132
160 3300005564 Ga0070664_100292499 Ga0070664_1002924992 132
161 3300005564 Ga0070664_100746599 Ga0070664_1007465991 132
162 3300005578 Ga0068854_100208318 Ga0068854_1002083182 132
163 3300005614 Ga0068856_100010275 Ga0068856_1000102755 132
164 3300005616 Ga0068852_100119524 Ga0068852_1001195242 132
165 3300006844 Ga0075428_100123245 Ga0075428_1001232452 132
166 3300006844 Ga0075428_100614301 Ga0075428_1006143012 132
167 3300006880 Ga0075429_100433317 Ga0075429_1004333172 132
168 3300006880 Ga0075429_101003354 Ga0075429_1010033542 132
169 3300006880 Ga0075429_101290836 Ga0075429_1012908362 132
170 3300009093 Ga0105240_10011892 Ga0105240_100118922 132
171 3300009094 Ga0111539_10006560 Ga0111539_1000656015 132
172 3300009147 Ga0114129_10682192 Ga0114129_106821922 132
173 3300009148 Ga0105243_11800937 Ga0105243_118009372 132
174 3300009176 Ga0105242_10390622 Ga0105242_103906222 132
175 3300009545 Ga0105237_10089582 Ga0105237_100895822 132
176 3300009551 Ga0105238_10081120 Ga0105238_100811202 132
177 3300010375 Ga0105239_10362276 Ga0105239_103622762 132
178 3300013102 Ga0157371_10035627 Ga0157371_100356271 132
179 3300013104 Ga0157370_10005899 Ga0157370_100058997 132
180 3300013105 Ga0157369_10023010 Ga0157369_100230104 132
181 3300013307 Ga0157372_10017054 Ga0157372_100170542 132
182 3300014326 Ga0157380_12732946 Ga0157380_127329461 132
183 3300014497 Ga0182008_10524064 Ga0182008_105240642 132
184 3300020070 Ga0206356_10104443 Ga0206356_101044432 132
185 3300020082 Ga0206353_11647415 Ga0206353_116474152 132
186 3300025904 Ga0207647_10173617 Ga0207647_101736171 132
187 3300025909 Ga0207705_10292946 Ga0207705_102929462 132
188 3300025912 Ga0207707_10003337 Ga0207707_1000333710 132
189 3300025913 Ga0207695_10221160 Ga0207695_102211602 132
190 3300025914 Ga0207671_10023217 Ga0207671_100232176 132
191 3300025917 Ga0207660_10023019 Ga0207660_100230193 132
192 3300025919 Ga0207657_10005840 Ga0207657_100058408 132
193 3300025920 Ga0207649_10014135 Ga0207649_100141351 132
194 3300025921 Ga0207652_10016967 Ga0207652_100169674 132
195 3300025924 Ga0207694_10085130 Ga0207694_100851302 132
196 3300025932 Ga0207690_10004895 Ga0207690_100048955 132
197 3300025944 Ga0207661_10000443 Ga0207661_1000044313 132
198 3300025944 Ga0207661_10007297 Ga0207661_100072978 132
199 3300025944 Ga0207661_10340812 Ga0207661_103408122 132
200 3300025945 Ga0207679_10270974 Ga0207679_102709742 132
201 3300025949 Ga0207667_10699222 Ga0207667_106992222 132
202 3300025981 Ga0207640_10154579 Ga0207640_101545792 132
203 3300026041 Ga0207639_10999347 Ga0207639_109993472 132
204 3300026078 Ga0207702_10012481 Ga0207702_100124816 132
205 3300026078 Ga0207702_11070579 Ga0207702_110705791 132
206 3300026142 Ga0207698_10071102 Ga0207698_100711022 132
207 3300026142 Ga0207698_11500565 Ga0207698_115005652 132
208 3300031731 Ga0307405_10995148 Ga0307405_109951481 132
209 3300031852 Ga0307410_10115911 Ga0307410_101159112 132
210 3300031901 Ga0307406_10143232 Ga0307406_101432322 132
211 3300031901 Ga0307406_10227145 Ga0307406_102271451 132
212 3300031901 Ga0307406_10792871 Ga0307406_107928712 132
213 3300031911 Ga0307412_10652233 Ga0307412_106522332 132
214 3300031911 Ga0307412_11103438 Ga0307412_111034381 132
215 3300031995 Ga0307409_100397946 Ga0307409_1003979462 132
216 3300031995 Ga0307409_100437569 Ga0307409_1004375692 132
217 3300032002 Ga0307416_100296290 Ga0307416_1002962902 132
218 3300032002 Ga0307416_100441776 Ga0307416_1004417762 132
219 3300032002 Ga0307416_101355035 Ga0307416_1013550352 132
220 3300032002 Ga0307416_101615797 Ga0307416_1016157972 132
221 3300032002 Ga0307416_101885927 Ga0307416_1018859272 132
222 3300032126 Ga0307415_100016500 Ga0307415_1000165005 132
223 3300032126 Ga0307415_100111251 Ga0307415_1001112512 132
224 3300032126 Ga0307415_100246840 Ga0307415_1002468402 132
225 3300032126 Ga0307415_100263823 Ga0307415_1002638232 132
226 3300032126 Ga0307415_100580697 Ga0307415_1005806972 132
227 3300032126 Ga0307415_101505987 Ga0307415_1015059872 132
228 3300035121 Ga0373960_0325163 Ga0373960_0325163_59_460 132
229 3300037466 Ga0395898_0216935 Ga0395898_0216935_762_1163 132
230 3300037471 Ga0395905_0830743 Ga0395905_0830743_59_463 132
231 3300038443 Ga0395901_0067832 Ga0395901_0067832_470_871 132
232 3300038443 Ga0395901_0536521 Ga0395901_0536521_62_463 132
233 3300044683 Ga0466965_0114390 Ga0466965_0114390_111_512 132
234 3300044683 Ga0466965_0227717 Ga0466965_0227717_248_652 132
235 3300044683 Ga0466965_0474521 Ga0466965_0474521_199_600 132
236 3300044694 Ga0466963_0029478 Ga0466963_0029478_1467_1868 132
237 3300044694 Ga0466963_0242740 Ga0466963_0242740_519_920 132
238 3300044694 Ga0466963_1071432 Ga0466963_1071432_105_503 132
239 3300044706 Ga0466964_0137203 Ga0466964_0137203_395_796 132
240 3300044706 Ga0466964_0302772 Ga0466964_0302772_56_454 132
241 3300044706 Ga0466964_0422815 Ga0466964_0422815_162_566 132
242 3300044719 Ga0466971_0300622 Ga0466971_0300622_225_629 132
243 3300044842 Ga0466957_0430257 Ga0466957_0430257_458_865 132
244 3300044842 Ga0466957_1148579 Ga0466957_1148579_133_534 132
245 3300044842 Ga0466957_1188285 Ga0466957_1188285_102_506 132
246 3300044901 Ga0466960_0124480 Ga0466960_0124480_479_880 132
247 3300044901 Ga0466960_0191357 Ga0466960_0191357_658_1065 132
248 3300044901 Ga0466960_0274604 Ga0466960_0274604_319_771 132
249 3300044901 Ga0466960_0352179 Ga0466960_0352179_132_536 132
250 3300044901 Ga0466960_0547795 Ga0466960_0547795_254_655 132
251 3300044901 Ga0466960_0619998 Ga0466960_0619998_202_603 132
252 3300045976 Ga0466967_0013701 Ga0466967_0013701_3270_3674 132
253 3300045976 Ga0466967_0033230 Ga0466967_0033230_679_1077 132
254 3300045976 Ga0466967_0149354 Ga0466967_0149354_1639_2055 132
255 3300045976 Ga0466967_0171553 Ga0466967_0171553_630_1031 132
256 3300045976 Ga0466967_0200915 Ga0466967_0200915_842_1240 132
257 3300045976 Ga0466967_0280541 Ga0466967_0280541_1110_1511 132
258 3300045976 Ga0466967_0375658 Ga0466967_0375658_603_1004 132
259 3300045976 Ga0466967_0506334 Ga0466967_0506334_446_850 132
260 3300045976 Ga0466967_0883632 Ga0466967_0883632_414_812 132
261 3300045976 Ga0466967_0924566 Ga0466967_0924566_440_841 132
262 3300045976 Ga0466967_1277625 Ga0466967_1277625_42_443 132
263 3300048907 Ga0496104_1557128 Ga0496104_1557128_23_427 132
264 3300048915 Ga0496112_0055480 Ga0496112_0055480_2017_2421 132
265 3300049571 Ga0501034_0388485 Ga0501034_0388485_525_926 132
266 3300049572 Ga0501036_0049346 Ga0501036_0049346_2022_2423 132
267 3300049573 Ga0501037_0240915 Ga0501037_0240915_317_718 132
268 3300049574 Ga0501038_0673083 Ga0501038_0673083_235_636 132
269 3300049575 Ga0501039_0130475 Ga0501039_0130475_149_550 132
270 3300049576 Ga0501040_0128013 Ga0501040_0128013_887_1288 132
271 3300049577 Ga0501041_0964356 Ga0501041_0964356_66_467 132
272 3300049578 Ga0501042_0237425 Ga0501042_0237425_95_496 132
273 3300049578 Ga0501042_0308422 Ga0501042_0308422_667_1068 132
274 3300049582 Ga0501048_0023615 Ga0501048_0023615_880_1281 132
275 3300049588 Ga0501072_0420258 Ga0501072_0420258_383_784 132
276 3300049590 Ga0501074_0587012 Ga0501074_0587012_55_456 132
277 3300049591 Ga0501075_0209807 Ga0501075_0209807_763_1164 132
278 3300049592 Ga0501076_0360869 Ga0501076_0360869_740_1141 132
279 3300049743 Ga0501081_0034089 Ga0501081_0034089_2707_3108 132
280 3300049824 Ga0501045_0235693 Ga0501045_0235693_789_1190 132
281 3300050507 nmdc:mga05p37_582441_c1 nmdc:mga05p37_582441_c1_97_498 132
282 3300050508 nmdc:mga09592_593750_c1 nmdc:mga09592_593750_c1_245_646 132
283 3300050511 nmdc:mga08y16_34965_c1 nmdc:mga08y16_34965_c1_2467_2868 132
284 3300053083 Ga0495655_0020068 Ga0495655_0020068_567_974 132
285 3300054114 Ga0501084_0030550 Ga0501084_0030550_2653_3054 132
286 3300061719 Ga0466962_0055335 Ga0466962_0055335_414_818 132
287 3300061734 Ga0530510_0099335 Ga0530510_0099335_601_1002 132

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03100

CcmE

CcmE

4

130

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j6q-assembly1.cif.gz_A solution structure and characterization of the heme chaperone ccme 0.811 36 122
1sr3-assembly1.cif.gz_A solution structure of the heme chaperone ccme of escherichia coli 0.7832 33 127
2pi2-assembly3.cif.gz_C full-length replication protein a subunits rpa14 and rpa32 0.7822 51 121
1w3s-assembly1.cif.gz_A the crystal structure of reco from deinococcus radiodurans. 0.7667 49 122
2kct-assembly1.cif.gz_A solution nmr structure of the ob-fold domain of heme chaperone ccme from desulfovibrio vulgaris. northeast structural genomics target dvr115g. 0.7615 45 123
ID Description Score Start End Superfamily
1j6qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.811 36 122 2.40.50.140
af_P9WF31_10_105_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8019 51 119 2.40.50.140
4xtcT03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7907 55 99 2.40.50.140
3f8tA02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7901 48 122 2.40.50.140
af_P87307_123_212_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7862 51 125 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A259GXA6-F1-model_v4 Cytochrome c biogenesis protein CcmE 0.8846 33 126 GO:0005886
GO:0017004
GO:0020037
GO:0046872
AF-A0A1J1EKI3-F1-model_v4 deleted 0.8772 53 123
AF-A0A0A2VYA4-F1-model_v4 Heme exporter protein C 0.8752 34 127 GO:0005886
GO:0015232
GO:0017004
GO:0020037
AF-A0A1Q7GS37-F1-model_v4 Cytochrome c maturation protein CcmE 0.8744 32 126 GO:0005886
GO:0017004
GO:0020037
AF-A0A5E8XGC1-F1-model_v4 deleted 0.8582 49 126

Feature Viewer

pLDDT pTM Quality
84.95 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map