F388096
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 287 | 159 | 287 | 133 |
Family's Representative Sequence
| Representative Sequence | 3300032002|Ga0307416_100870388|Ga0307416_1008703881 |
| Length | 137 |
| Sequence | MNPKRKRTTRLVISLTAAVILASALVYTSFSASSEARSPSQLDDAVPGRSYELTGRVMPGYHRVGDVLVFRVRDRTGSSTATVPVRYAGAVPDPFRAGREVIVTVRRRGDVFVGQKDSLVTKCPSKFSDTPAPGTGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 4 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 6 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 13 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 19 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 21 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 22 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 23 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 24 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 25 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 26 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 27 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 28 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 29 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 30 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 31 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 32 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 33 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 34 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 35 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 36 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 37 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 38 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 39 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 59 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 60 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 61 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 90 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 91 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 92 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 93 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 94 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 95 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 96 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 97 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 98 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 99 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 100 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 101 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 102 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 103 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 104 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 105 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 106 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 107 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 108 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 109 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 110 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 111 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 112 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 113 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 114 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 115 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 116 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 117 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 118 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 119 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 120 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 121 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 122 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 123 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 124 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 125 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 126 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 127 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 128 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 129 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 130 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 131 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 132 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 133 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 134 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 135 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 136 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 137 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 138 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 139 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 140 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 141 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 142 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 144 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 145 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 146 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 147 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 148 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 149 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 150 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 151 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 152 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 153 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 154 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 157 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 159 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.3 |
| Metatranscriptomes | 0.7 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.23 |
| Nodule | 0 |
| Rhizoplane | 1.39 |
| Rhizosphere | 92.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10380262 | 3300005327 | Bacteria | 1211 |
| 2 | Ga0070683_100022699 | 3300005329 | Bacteria | 5612 |
| 3 | Ga0070680_100005163 | 3300005336 | Bacteria | 9874 |
| 4 | Ga0070660_100016143 | 3300005339 | Bacteria | 5414 |
| 5 | Ga0070692_10379760 | 3300005345 | Bacteria | 886 |
| 6 | Ga0070659_100006515 | 3300005366 | Bacteria | 8430 |
| 7 | Ga0070659_100392286 | 3300005366 | Bacteria | 1171 |
| 8 | Ga0070700_100314552 | 3300005441 | Bacteria | 1148 |
| 9 | Ga0070678_101033701 | 3300005456 | Viruses | 756 |
| 10 | Ga0070681_10091114 | 3300005458 | Bacteria | 2999 |
| 11 | Ga0070681_10769929 | 3300005458 | Bacteria | 879 |
| 12 | Ga0070681_12052651 | 3300005458 | Bacteria | 500 |
| 13 | Ga0070679_100017967 | 3300005530 | Bacteria | 6853 |
| 14 | Ga0070684_100052601 | 3300005535 | Bacteria | 3542 |
| 15 | Ga0070684_100074548 | 3300005535 | Bacteria | 2991 |
| 16 | Ga0070684_101146407 | 3300005535 | Bacteria | 731 |
| 17 | Ga0068853_100011930 | 3300005539 | Bacteria | 7066 |
| 18 | Ga0070672_100452404 | 3300005543 | Unclassified | 1106 |
| 19 | Ga0070686_101424487 | 3300005544 | Bacteria | 582 |
| 20 | Ga0070696_100556307 | 3300005546 | Bacteria | 920 |
| 21 | Ga0070693_101467815 | 3300005547 | Bacteria | 532 |
| 22 | Ga0070704_100402788 | 3300005549 | Bacteria | 1168 |
| 23 | Ga0068855_100806797 | 3300005563 | Bacteria | 997 |
| 24 | Ga0070664_100292499 | 3300005564 | Bacteria | 1471 |
| 25 | Ga0070664_100746599 | 3300005564 | Bacteria | 913 |
| 26 | Ga0068854_100208318 | 3300005578 | Bacteria | 1541 |
| 27 | Ga0068856_100010275 | 3300005614 | Bacteria | 9098 |
| 28 | Ga0068852_100119524 | 3300005616 | Bacteria | 2409 |
| 29 | Ga0068870_10686790 | 3300005840 | Bacteria | 705 |
| 30 | Ga0068858_100549423 | 3300005842 | Unclassified | 1118 |
| 31 | Ga0081455_10160293 | 3300005937 | Bacteria | 1725 |
| 32 | Ga0081538_10070853 | 3300005981 | Bacteria | 1922 |
| 33 | Ga0081539_10009179 | 3300005985 | Bacteria | 8340 |
| 34 | Ga0075365_10078501 | 3300006038 | Bacteria | 2232 |
| 35 | Ga0075365_10084909 | 3300006038 | Bacteria | 2149 |
| 36 | Ga0075365_10178707 | 3300006038 | Bacteria | 1483 |
| 37 | Ga0075365_10645101 | 3300006038 | Bacteria | 748 |
| 38 | Ga0075368_10028105 | 3300006042 | Bacteria | 2172 |
| 39 | Ga0075363_100007424 | 3300006048 | Bacteria | 5038 |
| 40 | Ga0075364_10058111 | 3300006051 | Bacteria | 2534 |
| 41 | Ga0075367_10201500 | 3300006178 | Bacteria | 1243 |
| 42 | Ga0075428_100123245 | 3300006844 | Bacteria | 2821 |
| 43 | Ga0075428_100614301 | 3300006844 | Bacteria | 1161 |
| 44 | Ga0075428_101334924 | 3300006844 | Bacteria | 754 |
| 45 | Ga0075428_101338051 | 3300006844 | Bacteria | 753 |
| 46 | Ga0075428_101340554 | 3300006844 | Bacteria | 752 |
| 47 | Ga0075430_100024461 | 3300006846 | Bacteria | 5138 |
| 48 | Ga0075430_100192366 | 3300006846 | Bacteria | 1696 |
| 49 | Ga0075431_100088838 | 3300006847 | Bacteria | 3190 |
| 50 | Ga0075431_101432953 | 3300006847 | Bacteria | 650 |
| 51 | Ga0075434_100126267 | 3300006871 | Bacteria | 2575 |
| 52 | Ga0075429_100107839 | 3300006880 | Bacteria | 2434 |
| 53 | Ga0075429_100433317 | 3300006880 | Bacteria | 1152 |
| 54 | Ga0075429_101003354 | 3300006880 | Bacteria | 730 |
| 55 | Ga0075429_101290836 | 3300006880 | Bacteria | 637 |
| 56 | Ga0068865_101607864 | 3300006881 | Unclassified | 584 |
| 57 | Ga0105240_10011892 | 3300009093 | Bacteria | 12076 |
| 58 | Ga0111539_10006560 | 3300009094 | Bacteria | 14996 |
| 59 | Ga0111539_10145270 | 3300009094 | Bacteria | 2777 |
| 60 | Ga0111539_10303695 | 3300009094 | Bacteria | 1857 |
| 61 | Ga0111539_10352152 | 3300009094 | Bacteria | 1714 |
| 62 | Ga0105245_10523680 | 3300009098 | Bacteria | 1204 |
| 63 | Ga0114129_10002955 | 3300009147 | Bacteria | 23781 |
| 64 | Ga0114129_10578712 | 3300009147 | Bacteria | 1457 |
| 65 | Ga0114129_10682192 | 3300009147 | Bacteria | 1323 |
| 66 | Ga0114129_11066880 | 3300009147 | Bacteria | 1013 |
| 67 | Ga0105243_10407448 | 3300009148 | Bacteria | 1265 |
| 68 | Ga0105243_11800937 | 3300009148 | Viruses | 643 |
| 69 | Ga0105242_10390622 | 3300009176 | Bacteria | 1296 |
| 70 | Ga0105248_13006010 | 3300009177 | Viruses | 537 |
| 71 | Ga0105237_10089582 | 3300009545 | Bacteria | 3066 |
| 72 | Ga0105238_10081120 | 3300009551 | Bacteria | 3233 |
| 73 | Ga0105249_10698345 | 3300009553 | Bacteria | 1074 |
| 74 | Ga0105239_10362276 | 3300010375 | Bacteria | 1638 |
| 75 | Ga0105246_11371601 | 3300011119 | Unclassified | 658 |
| 76 | Ga0157371_10035627 | 3300013102 | Bacteria | 3566 |
| 77 | Ga0157370_10005899 | 3300013104 | Bacteria | 13653 |
| 78 | Ga0157369_10023010 | 3300013105 | Bacteria | 6946 |
| 79 | Ga0157369_12216890 | 3300013105 | Bacteria | 557 |
| 80 | Ga0163162_12246388 | 3300013306 | Viruses | 627 |
| 81 | Ga0157372_10017054 | 3300013307 | Bacteria | 7796 |
| 82 | Ga0157372_10719995 | 3300013307 | Bacteria | 1161 |
| 83 | Ga0157375_10867503 | 3300013308 | Bacteria | 1048 |
| 84 | Ga0157380_12732946 | 3300014326 | Archaea | 560 |
| 85 | Ga0182008_10524064 | 3300014497 | Bacteria | 655 |
| 86 | Ga0206356_10104443 | 3300020070 | Bacteria | 854 |
| 87 | Ga0206353_11647415 | 3300020082 | Bacteria | 3619 |
| 88 | Ga0207647_10173617 | 3300025904 | Bacteria | 1254 |
| 89 | Ga0207643_10431959 | 3300025908 | Bacteria | 836 |
| 90 | Ga0207705_10292946 | 3300025909 | Bacteria | 1247 |
| 91 | Ga0207707_10003337 | 3300025912 | Bacteria | 14251 |
| 92 | Ga0207695_10221160 | 3300025913 | Bacteria | 1801 |
| 93 | Ga0207671_10023217 | 3300025914 | Bacteria | 4679 |
| 94 | Ga0207660_10023019 | 3300025917 | Bacteria | 4204 |
| 95 | Ga0207662_10922417 | 3300025918 | Bacteria | 619 |
| 96 | Ga0207657_10005840 | 3300025919 | Bacteria | 12825 |
| 97 | Ga0207657_10415046 | 3300025919 | Bacteria | 1058 |
| 98 | Ga0207649_10014135 | 3300025920 | Bacteria | 4468 |
| 99 | Ga0207649_10661623 | 3300025920 | Viruses | 808 |
| 100 | Ga0207652_10016967 | 3300025921 | Bacteria | 5955 |
| 101 | Ga0207694_10085130 | 3300025924 | Bacteria | 2488 |
| 102 | Ga0207687_10413356 | 3300025927 | Bacteria | 1112 |
| 103 | Ga0207690_10004895 | 3300025932 | Bacteria | 7901 |
| 104 | Ga0207691_10512125 | 3300025940 | Unclassified | 1019 |
| 105 | Ga0207661_10000443 | 3300025944 | Bacteria | 26690 |
| 106 | Ga0207661_10007297 | 3300025944 | Bacteria | 7864 |
| 107 | Ga0207661_10340812 | 3300025944 | Bacteria | 1351 |
| 108 | Ga0207661_11372605 | 3300025944 | Unclassified | 649 |
| 109 | Ga0207679_10270974 | 3300025945 | Bacteria | 1452 |
| 110 | Ga0207667_10699222 | 3300025949 | Bacteria | 1016 |
| 111 | Ga0207712_10154139 | 3300025961 | Bacteria | 1778 |
| 112 | Ga0207668_11108789 | 3300025972 | Bacteria | 710 |
| 113 | Ga0207640_10154579 | 3300025981 | Bacteria | 1689 |
| 114 | Ga0207640_10944803 | 3300025981 | Bacteria | 755 |
| 115 | Ga0207640_11014237 | 3300025981 | Bacteria | 731 |
| 116 | Ga0207658_10632409 | 3300025986 | Bacteria | 964 |
| 117 | Ga0207639_10999347 | 3300026041 | Unclassified | 783 |
| 118 | Ga0207639_11310590 | 3300026041 | Unclassified | 680 |
| 119 | Ga0207708_10620901 | 3300026075 | Bacteria | 917 |
| 120 | Ga0207702_10012481 | 3300026078 | Bacteria | 7069 |
| 121 | Ga0207702_11070579 | 3300026078 | Bacteria | 800 |
| 122 | Ga0207675_100073764 | 3300026118 | Bacteria | 3193 |
| 123 | Ga0207683_11162586 | 3300026121 | Bacteria | 715 |
| 124 | Ga0207698_10071102 | 3300026142 | Bacteria | 2760 |
| 125 | Ga0207698_11500565 | 3300026142 | Unclassified | 689 |
| 126 | Ga0207428_10038642 | 3300027907 | Bacteria | 3879 |
| 127 | Ga0307408_101413692 | 3300031548 | Bacteria | 655 |
| 128 | Ga0316576_10001940 | 3300031727 | Bacteria | 11553 |
| 129 | Ga0307405_10380255 | 3300031731 | Bacteria | 1099 |
| 130 | Ga0307405_10563602 | 3300031731 | Unclassified | 924 |
| 131 | Ga0307405_10995148 | 3300031731 | Unclassified | 715 |
| 132 | Ga0307413_10595061 | 3300031824 | Unclassified | 904 |
| 133 | Ga0307413_11295138 | 3300031824 | Bacteria | 637 |
| 134 | Ga0307410_10093378 | 3300031852 | Bacteria | 2141 |
| 135 | Ga0307410_10115911 | 3300031852 | Bacteria | 1946 |
| 136 | Ga0307410_10611452 | 3300031852 | Bacteria | 910 |
| 137 | Ga0307410_11277765 | 3300031852 | Bacteria | 641 |
| 138 | Ga0307406_10143232 | 3300031901 | Unclassified | 1695 |
| 139 | Ga0307406_10161223 | 3300031901 | Bacteria | 1612 |
| 140 | Ga0307406_10197004 | 3300031901 | Bacteria | 1480 |
| 141 | Ga0307406_10227145 | 3300031901 | Bacteria | 1391 |
| 142 | Ga0307406_10293946 | 3300031901 | Bacteria | 1245 |
| 143 | Ga0307406_10546178 | 3300031901 | Unclassified | 947 |
| 144 | Ga0307406_10792871 | 3300031901 | Unclassified | 799 |
| 145 | Ga0307407_10162844 | 3300031903 | Bacteria | 1461 |
| 146 | Ga0307412_10114050 | 3300031911 | Bacteria | 1935 |
| 147 | Ga0307412_10652233 | 3300031911 | Bacteria | 898 |
| 148 | Ga0307412_11103438 | 3300031911 | Unclassified | 706 |
| 149 | Ga0307409_100014932 | 3300031995 | Bacteria | 5075 |
| 150 | Ga0307409_100016239 | 3300031995 | Bacteria | 4919 |
| 151 | Ga0307409_100132011 | 3300031995 | Bacteria | 2136 |
| 152 | Ga0307409_100397946 | 3300031995 | Bacteria | 1315 |
| 153 | Ga0307409_100437569 | 3300031995 | Bacteria | 1259 |
| 154 | Ga0307416_100277217 | 3300032002 | Bacteria | 1651 |
| 155 | Ga0307416_100296290 | 3300032002 | Bacteria | 1605 |
| 156 | Ga0307416_100441776 | 3300032002 | Bacteria | 1351 |
| 157 | Ga0307416_100870388 | 3300032002 | Bacteria | 1000 |
| 158 | Ga0307416_101355035 | 3300032002 | Unclassified | 817 |
| 159 | Ga0307416_101615797 | 3300032002 | Bacteria | 753 |
| 160 | Ga0307416_101885927 | 3300032002 | Unclassified | 701 |
| 161 | Ga0307414_10866373 | 3300032004 | Bacteria | 827 |
| 162 | Ga0307411_10108842 | 3300032005 | Bacteria | 1978 |
| 163 | Ga0307411_10285799 | 3300032005 | Bacteria | 1315 |
| 164 | Ga0307415_100006363 | 3300032126 | Bacteria | 6360 |
| 165 | Ga0307415_100016500 | 3300032126 | Bacteria | 4406 |
| 166 | Ga0307415_100043403 | 3300032126 | Bacteria | 3000 |
| 167 | Ga0307415_100091760 | 3300032126 | Bacteria | 2201 |
| 168 | Ga0307415_100111251 | 3300032126 | Bacteria | 2033 |
| 169 | Ga0307415_100246840 | 3300032126 | Bacteria | 1448 |
| 170 | Ga0307415_100263823 | 3300032126 | Bacteria | 1407 |
| 171 | Ga0307415_100580697 | 3300032126 | Bacteria | 994 |
| 172 | Ga0307415_100953852 | 3300032126 | Unclassified | 794 |
| 173 | Ga0307415_101505987 | 3300032126 | Bacteria | 644 |
| 174 | Ga0316580_10143059 | 3300032139 | Bacteria | 734 |
| 175 | Ga0373960_0325163 | 3300035121 | Bacteria | 577 |
| 176 | Ga0316574_0046665 | 3300035398 | Bacteria | 2687 |
| 177 | Ga0316574_0116019 | 3300035398 | Bacteria | 1717 |
| 178 | Ga0316584_0056660 | 3300036712 | Bacteria | 2933 |
| 179 | Ga0395900_0745845 | 3300037418 | Unclassified | 910 |
| 180 | Ga0395898_0216935 | 3300037466 | Bacteria | 1825 |
| 181 | Ga0395898_0293193 | 3300037466 | Bacteria | 1552 |
| 182 | Ga0395905_0830743 | 3300037471 | Bacteria | 827 |
| 183 | Ga0395901_0067832 | 3300038443 | Bacteria | 3716 |
| 184 | Ga0395901_0536521 | 3300038443 | Bacteria | 1187 |
| 185 | Ga0395901_0802972 | 3300038443 | Bacteria | 930 |
| 186 | Ga0395901_0948817 | 3300038443 | Bacteria | 839 |
| 187 | Ga0395901_1166154 | 3300038443 | Unclassified | 738 |
| 188 | Ga0451837_1300303 | 3300041494 | Bacteria | 795 |
| 189 | Ga0466965_0114390 | 3300044683 | Bacteria | 1389 |
| 190 | Ga0466965_0227717 | 3300044683 | Bacteria | 995 |
| 191 | Ga0466965_0474521 | 3300044683 | Unclassified | 699 |
| 192 | Ga0466963_0029478 | 3300044694 | Bacteria | 3533 |
| 193 | Ga0466963_0242740 | 3300044694 | Bacteria | 1263 |
| 194 | Ga0466963_0525413 | 3300044694 | Bacteria | 836 |
| 195 | Ga0466963_1071432 | 3300044694 | Bacteria | 567 |
| 196 | Ga0466964_0137203 | 3300044706 | Bacteria | 1120 |
| 197 | Ga0466964_0302772 | 3300044706 | Bacteria | 806 |
| 198 | Ga0466964_0422815 | 3300044706 | Bacteria | 701 |
| 199 | Ga0466971_0220104 | 3300044719 | Bacteria | 900 |
| 200 | Ga0466971_0300622 | 3300044719 | Bacteria | 770 |
| 201 | Ga0466957_0430257 | 3300044842 | Bacteria | 907 |
| 202 | Ga0466957_1148579 | 3300044842 | Bacteria | 561 |
| 203 | Ga0466957_1188285 | 3300044842 | Unclassified | 552 |
| 204 | Ga0466960_0124480 | 3300044901 | Bacteria | 1354 |
| 205 | Ga0466960_0191357 | 3300044901 | Bacteria | 1114 |
| 206 | Ga0466960_0274604 | 3300044901 | Bacteria | 943 |
| 207 | Ga0466960_0352179 | 3300044901 | Bacteria | 840 |
| 208 | Ga0466960_0547795 | 3300044901 | Bacteria | 682 |
| 209 | Ga0466960_0619998 | 3300044901 | Bacteria | 643 |
| 210 | Ga0466967_0013701 | 3300045976 | Bacteria | 6280 |
| 211 | Ga0466967_0033230 | 3300045976 | Bacteria | 4365 |
| 212 | Ga0466967_0149354 | 3300045976 | Bacteria | 2183 |
| 213 | Ga0466967_0171553 | 3300045976 | Bacteria | 2041 |
| 214 | Ga0466967_0200915 | 3300045976 | Bacteria | 1888 |
| 215 | Ga0466967_0280541 | 3300045976 | Bacteria | 1598 |
| 216 | Ga0466967_0375658 | 3300045976 | Bacteria | 1379 |
| 217 | Ga0466967_0506334 | 3300045976 | Bacteria | 1185 |
| 218 | Ga0466967_0535545 | 3300045976 | Bacteria | 1152 |
| 219 | Ga0466967_0883632 | 3300045976 | Bacteria | 888 |
| 220 | Ga0466967_0924566 | 3300045976 | Bacteria | 868 |
| 221 | Ga0466967_1277625 | 3300045976 | Bacteria | 731 |
| 222 | Ga0496104_1557128 | 3300048907 | Bacteria | 564 |
| 223 | Ga0496107_0544079 | 3300048910 | Bacteria | 860 |
| 224 | Ga0496109_1248779 | 3300048912 | Bacteria | 679 |
| 225 | Ga0496112_0055480 | 3300048915 | Bacteria | 3896 |
| 226 | Ga0496124_0403528 | 3300048927 | Bacteria | 948 |
| 227 | Ga0501031_0154564 | 3300049568 | Bacteria | 1499 |
| 228 | Ga0501034_0008403 | 3300049571 | Bacteria | 10910 |
| 229 | Ga0501034_0388485 | 3300049571 | Bacteria | 1320 |
| 230 | Ga0501036_0046600 | 3300049572 | Bacteria | 3671 |
| 231 | Ga0501036_0049346 | 3300049572 | Bacteria | 3564 |
| 232 | Ga0501037_0154604 | 3300049573 | Bacteria | 1638 |
| 233 | Ga0501037_0240915 | 3300049573 | Bacteria | 1268 |
| 234 | Ga0501037_0328599 | 3300049573 | Bacteria | 1058 |
| 235 | Ga0501038_0673083 | 3300049574 | Unclassified | 777 |
| 236 | Ga0501039_0130475 | 3300049575 | Bacteria | 1972 |
| 237 | Ga0501039_0327223 | 3300049575 | Bacteria | 1204 |
| 238 | Ga0501040_0128013 | 3300049576 | Bacteria | 1784 |
| 239 | Ga0501041_0023141 | 3300049577 | Bacteria | 3726 |
| 240 | Ga0501041_0964356 | 3300049577 | Bacteria | 548 |
| 241 | Ga0501042_0072400 | 3300049578 | Bacteria | 2466 |
| 242 | Ga0501042_0237425 | 3300049578 | Bacteria | 1315 |
| 243 | Ga0501042_0308422 | 3300049578 | Bacteria | 1143 |
| 244 | Ga0501043_0132705 | 3300049579 | Bacteria | 1952 |
| 245 | Ga0501047_0254915 | 3300049581 | Bacteria | 1603 |
| 246 | Ga0501048_0023615 | 3300049582 | Bacteria | 4493 |
| 247 | Ga0501071_0011497 | 3300049587 | Bacteria | 5968 |
| 248 | Ga0501072_0064510 | 3300049588 | Bacteria | 2888 |
| 249 | Ga0501072_0420258 | 3300049588 | Unclassified | 1060 |
| 250 | Ga0501074_0587012 | 3300049590 | Bacteria | 788 |
| 251 | Ga0501075_0012953 | 3300049591 | Bacteria | 5941 |
| 252 | Ga0501075_0209807 | 3300049591 | Bacteria | 1486 |
| 253 | Ga0501076_0019685 | 3300049592 | Bacteria | 5161 |
| 254 | Ga0501076_0360869 | 3300049592 | Unclassified | 1194 |
| 255 | Ga0501081_0034089 | 3300049743 | Bacteria | 3462 |
| 256 | Ga0501081_0041301 | 3300049743 | Bacteria | 3158 |
| 257 | Ga0501035_0181880 | 3300049822 | Bacteria | 1811 |
| 258 | Ga0501035_0272866 | 3300049822 | Bacteria | 1431 |
| 259 | Ga0501045_0235693 | 3300049824 | Bacteria | 1362 |
| 260 | nmdc:mga03n38_142945_c1 | 3300050490 | Bacteria | 1197 |
| 261 | nmdc:mga00v17_55756_c1 | 3300050491 | Bacteria | 2414 |
| 262 | nmdc:mga0yw44_483741_c1 | 3300050492 | Unclassified | 840 |
| 263 | nmdc:mga0yw44_49196_c1 | 3300050492 | Bacteria | 2544 |
| 264 | nmdc:mga0yw44_670251_c1 | 3300050492 | Bacteria | 705 |
| 265 | nmdc:mga06z11_323177_c1 | 3300050494 | Bacteria | 921 |
| 266 | nmdc:mga04h51_16865_c1 | 3300050495 | Bacteria | 2126 |
| 267 | nmdc:mga05p37_582441_c1 | 3300050507 | Bacteria | 1267 |
| 268 | nmdc:mga05p37_628928_c1 | 3300050507 | Bacteria | 1206 |
| 269 | nmdc:mga05p37_703984_c1 | 3300050507 | Bacteria | 1121 |
| 270 | nmdc:mga05p37_8890_c1 | 3300050507 | Bacteria | 11869 |
| 271 | nmdc:mga09592_101135_c1 | 3300050508 | Bacteria | 2469 |
| 272 | nmdc:mga09592_593750_c1 | 3300050508 | Bacteria | 949 |
| 273 | nmdc:mga0qj67_124732_c1 | 3300050509 | Bacteria | 2084 |
| 274 | nmdc:mga06r32_271100_c1 | 3300050510 | Bacteria | 1684 |
| 275 | nmdc:mga06r32_747420_c1 | 3300050510 | Bacteria | 941 |
| 276 | nmdc:mga06r32_941239_c1 | 3300050510 | Bacteria | 819 |
| 277 | nmdc:mga08y16_23610_c1 | 3300050511 | Bacteria | 6495 |
| 278 | nmdc:mga08y16_34965_c1 | 3300050511 | Bacteria | 5279 |
| 279 | nmdc:mga08y16_946824_c1 | 3300050511 | Bacteria | 844 |
| 280 | nmdc:mga0n895_453587_c1 | 3300050512 | Unclassified | 1294 |
| 281 | Ga0495655_0020068 | 3300053083 | Bacteria | 1494 |
| 282 | Ga0501084_0030550 | 3300054114 | Bacteria | 4505 |
| 283 | Ga0501084_0107620 | 3300054114 | Bacteria | 2342 |
| 284 | Ga0501082_0036340 | 3300060353 | Bacteria | 4244 |
| 285 | Ga0466962_0055335 | 3300061719 | Bacteria | 1896 |
| 286 | Ga0530510_0014146 | 3300061734 | Bacteria | 5625 |
| 287 | Ga0530510_0099335 | 3300061734 | Bacteria | 2128 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300038443 | Ga0395901_0948817 | Ga0395901_0948817_385_747 | 120 |
| 2 | 3300009553 | Ga0105249_10698345 | Ga0105249_106983452 | 121 |
| 3 | 3300013105 | Ga0157369_12216890 | Ga0157369_122168901 | 121 |
| 4 | 3300025961 | Ga0207712_10154139 | Ga0207712_101541392 | 121 |
| 5 | 3300025920 | Ga0207649_10661623 | Ga0207649_106616232 | 124 |
| 6 | 3300011119 | Ga0105246_11371601 | Ga0105246_113716011 | 125 |
| 7 | 3300038443 | Ga0395901_0802972 | Ga0395901_0802972_49_438 | 129 |
| 8 | 3300044694 | Ga0466963_0525413 | Ga0466963_0525413_384_776 | 129 |
| 9 | 3300005547 | Ga0070693_101467815 | Ga0070693_1014678151 | 130 |
| 10 | 3300025981 | Ga0207640_11014237 | Ga0207640_110142372 | 130 |
| 11 | 3300031731 | Ga0307405_10380255 | Ga0307405_103802551 | 130 |
| 12 | 3300031852 | Ga0307410_11277765 | Ga0307410_112777652 | 130 |
| 13 | 3300031901 | Ga0307406_10197004 | Ga0307406_101970042 | 130 |
| 14 | 3300031995 | Ga0307409_100132011 | Ga0307409_1001320112 | 130 |
| 15 | 3300032002 | Ga0307416_100277217 | Ga0307416_1002772172 | 130 |
| 16 | 3300032004 | Ga0307414_10866373 | Ga0307414_108663731 | 130 |
| 17 | 3300032005 | Ga0307411_10108842 | Ga0307411_101088422 | 130 |
| 18 | 3300032126 | Ga0307415_100043403 | Ga0307415_1000434032 | 130 |
| 19 | 3300049568 | Ga0501031_0154564 | Ga0501031_0154564_303_740 | 130 |
| 20 | 3300049572 | Ga0501036_0046600 | Ga0501036_0046600_808_1245 | 130 |
| 21 | 3300049573 | Ga0501037_0328599 | Ga0501037_0328599_461_853 | 130 |
| 22 | 3300049575 | Ga0501039_0327223 | Ga0501039_0327223_86_523 | 130 |
| 23 | 3300049577 | Ga0501041_0023141 | Ga0501041_0023141_2168_2605 | 130 |
| 24 | 3300049578 | Ga0501042_0072400 | Ga0501042_0072400_144_536 | 130 |
| 25 | 3300049587 | Ga0501071_0011497 | Ga0501071_0011497_4836_5273 | 130 |
| 26 | 3300049588 | Ga0501072_0064510 | Ga0501072_0064510_764_1201 | 130 |
| 27 | 3300049591 | Ga0501075_0012953 | Ga0501075_0012953_3503_3940 | 130 |
| 28 | 3300049592 | Ga0501076_0019685 | Ga0501076_0019685_3964_4401 | 130 |
| 29 | 3300049743 | Ga0501081_0041301 | Ga0501081_0041301_1379_1816 | 130 |
| 30 | 3300049822 | Ga0501035_0181880 | Ga0501035_0181880_618_1055 | 130 |
| 31 | 3300054114 | Ga0501084_0107620 | Ga0501084_0107620_1217_1654 | 130 |
| 32 | 3300060353 | Ga0501082_0036340 | Ga0501082_0036340_551_988 | 130 |
| 33 | 3300061734 | Ga0530510_0014146 | Ga0530510_0014146_2262_2699 | 130 |
| 34 | 3300005366 | Ga0070659_100392286 | Ga0070659_1003922861 | 131 |
| 35 | 3300005441 | Ga0070700_100314552 | Ga0070700_1003145523 | 131 |
| 36 | 3300005456 | Ga0070678_101033701 | Ga0070678_1010337012 | 131 |
| 37 | 3300005458 | Ga0070681_10769929 | Ga0070681_107699292 | 131 |
| 38 | 3300005535 | Ga0070684_101146407 | Ga0070684_1011464072 | 131 |
| 39 | 3300005543 | Ga0070672_100452404 | Ga0070672_1004524042 | 131 |
| 40 | 3300005544 | Ga0070686_101424487 | Ga0070686_1014244871 | 131 |
| 41 | 3300005546 | Ga0070696_100556307 | Ga0070696_1005563072 | 131 |
| 42 | 3300005549 | Ga0070704_100402788 | Ga0070704_1004027883 | 131 |
| 43 | 3300005840 | Ga0068870_10686790 | Ga0068870_106867901 | 131 |
| 44 | 3300005842 | Ga0068858_100549423 | Ga0068858_1005494233 | 131 |
| 45 | 3300005937 | Ga0081455_10160293 | Ga0081455_101602933 | 131 |
| 46 | 3300005981 | Ga0081538_10070853 | Ga0081538_100708532 | 131 |
| 47 | 3300005985 | Ga0081539_10009179 | Ga0081539_100091795 | 131 |
| 48 | 3300006038 | Ga0075365_10078501 | Ga0075365_100785012 | 131 |
| 49 | 3300006038 | Ga0075365_10084909 | Ga0075365_100849092 | 131 |
| 50 | 3300006038 | Ga0075365_10178707 | Ga0075365_101787072 | 131 |
| 51 | 3300006038 | Ga0075365_10645101 | Ga0075365_106451011 | 131 |
| 52 | 3300006042 | Ga0075368_10028105 | Ga0075368_100281052 | 131 |
| 53 | 3300006048 | Ga0075363_100007424 | Ga0075363_1000074242 | 131 |
| 54 | 3300006051 | Ga0075364_10058111 | Ga0075364_100581112 | 131 |
| 55 | 3300006178 | Ga0075367_10201500 | Ga0075367_102015002 | 131 |
| 56 | 3300006844 | Ga0075428_101334924 | Ga0075428_1013349242 | 131 |
| 57 | 3300006844 | Ga0075428_101338051 | Ga0075428_1013380512 | 131 |
| 58 | 3300006844 | Ga0075428_101340554 | Ga0075428_1013405542 | 131 |
| 59 | 3300006846 | Ga0075430_100024461 | Ga0075430_1000244615 | 131 |
| 60 | 3300006846 | Ga0075430_100192366 | Ga0075430_1001923663 | 131 |
| 61 | 3300006847 | Ga0075431_100088838 | Ga0075431_1000888382 | 131 |
| 62 | 3300006847 | Ga0075431_101432953 | Ga0075431_1014329531 | 131 |
| 63 | 3300006871 | Ga0075434_100126267 | Ga0075434_1001262672 | 131 |
| 64 | 3300006880 | Ga0075429_100107839 | Ga0075429_1001078393 | 131 |
| 65 | 3300006881 | Ga0068865_101607864 | Ga0068865_1016078641 | 131 |
| 66 | 3300009094 | Ga0111539_10145270 | Ga0111539_101452702 | 131 |
| 67 | 3300009094 | Ga0111539_10303695 | Ga0111539_103036952 | 131 |
| 68 | 3300009094 | Ga0111539_10352152 | Ga0111539_103521522 | 131 |
| 69 | 3300009098 | Ga0105245_10523680 | Ga0105245_105236801 | 131 |
| 70 | 3300009147 | Ga0114129_10002955 | Ga0114129_100029556 | 131 |
| 71 | 3300009147 | Ga0114129_10578712 | Ga0114129_105787122 | 131 |
| 72 | 3300009147 | Ga0114129_11066880 | Ga0114129_110668802 | 131 |
| 73 | 3300009148 | Ga0105243_10407448 | Ga0105243_104074484 | 131 |
| 74 | 3300009177 | Ga0105248_13006010 | Ga0105248_130060101 | 131 |
| 75 | 3300013306 | Ga0163162_12246388 | Ga0163162_122463881 | 131 |
| 76 | 3300013307 | Ga0157372_10719995 | Ga0157372_107199954 | 131 |
| 77 | 3300013308 | Ga0157375_10867503 | Ga0157375_108675032 | 131 |
| 78 | 3300025908 | Ga0207643_10431959 | Ga0207643_104319592 | 131 |
| 79 | 3300025918 | Ga0207662_10922417 | Ga0207662_109224172 | 131 |
| 80 | 3300025919 | Ga0207657_10415046 | Ga0207657_104150461 | 131 |
| 81 | 3300025927 | Ga0207687_10413356 | Ga0207687_104133562 | 131 |
| 82 | 3300025940 | Ga0207691_10512125 | Ga0207691_105121252 | 131 |
| 83 | 3300025944 | Ga0207661_11372605 | Ga0207661_113726051 | 131 |
| 84 | 3300025972 | Ga0207668_11108789 | Ga0207668_111087892 | 131 |
| 85 | 3300025981 | Ga0207640_10944803 | Ga0207640_109448032 | 131 |
| 86 | 3300025986 | Ga0207658_10632409 | Ga0207658_106324092 | 131 |
| 87 | 3300026041 | Ga0207639_11310590 | Ga0207639_113105902 | 131 |
| 88 | 3300026075 | Ga0207708_10620901 | Ga0207708_106209012 | 131 |
| 89 | 3300026118 | Ga0207675_100073764 | Ga0207675_1000737643 | 131 |
| 90 | 3300026121 | Ga0207683_11162586 | Ga0207683_111625862 | 131 |
| 91 | 3300027907 | Ga0207428_10038642 | Ga0207428_100386422 | 131 |
| 92 | 3300031548 | Ga0307408_101413692 | Ga0307408_1014136922 | 131 |
| 93 | 3300031727 | Ga0316576_10001940 | Ga0316576_1000194010 | 131 |
| 94 | 3300031731 | Ga0307405_10563602 | Ga0307405_105636021 | 131 |
| 95 | 3300031824 | Ga0307413_10595061 | Ga0307413_105950612 | 131 |
| 96 | 3300031824 | Ga0307413_11295138 | Ga0307413_112951381 | 131 |
| 97 | 3300031852 | Ga0307410_10093378 | Ga0307410_100933781 | 131 |
| 98 | 3300031852 | Ga0307410_10611452 | Ga0307410_106114521 | 131 |
| 99 | 3300031901 | Ga0307406_10161223 | Ga0307406_101612232 | 131 |
| 100 | 3300031901 | Ga0307406_10293946 | Ga0307406_102939462 | 131 |
| 101 | 3300031901 | Ga0307406_10546178 | Ga0307406_105461782 | 131 |
| 102 | 3300031903 | Ga0307407_10162844 | Ga0307407_101628442 | 131 |
| 103 | 3300031911 | Ga0307412_10114050 | Ga0307412_101140502 | 131 |
| 104 | 3300031995 | Ga0307409_100014932 | Ga0307409_1000149329 | 131 |
| 105 | 3300031995 | Ga0307409_100016239 | Ga0307409_1000162395 | 131 |
| 106 | 3300032002 | Ga0307416_100870388 | Ga0307416_1008703881 | 131 |
| 107 | 3300032005 | Ga0307411_10285799 | Ga0307411_102857992 | 131 |
| 108 | 3300032126 | Ga0307415_100006363 | Ga0307415_1000063634 | 131 |
| 109 | 3300032126 | Ga0307415_100091760 | Ga0307415_1000917602 | 131 |
| 110 | 3300032126 | Ga0307415_100953852 | Ga0307415_1009538522 | 131 |
| 111 | 3300032139 | Ga0316580_10143059 | Ga0316580_101430591 | 131 |
| 112 | 3300035398 | Ga0316574_0046665 | Ga0316574_0046665_961_1359 | 131 |
| 113 | 3300035398 | Ga0316574_0116019 | Ga0316574_0116019_341_739 | 131 |
| 114 | 3300036712 | Ga0316584_0056660 | Ga0316584_0056660_609_1007 | 131 |
| 115 | 3300037418 | Ga0395900_0745845 | Ga0395900_0745845_439_834 | 131 |
| 116 | 3300037466 | Ga0395898_0293193 | Ga0395898_0293193_89_484 | 131 |
| 117 | 3300038443 | Ga0395901_1166154 | Ga0395901_1166154_258_653 | 131 |
| 118 | 3300041494 | Ga0451837_1300303 | Ga0451837_1300303_301_702 | 131 |
| 119 | 3300044719 | Ga0466971_0220104 | Ga0466971_0220104_202_597 | 131 |
| 120 | 3300045976 | Ga0466967_0535545 | Ga0466967_0535545_191_586 | 131 |
| 121 | 3300048910 | Ga0496107_0544079 | Ga0496107_0544079_358_753 | 131 |
| 122 | 3300048912 | Ga0496109_1248779 | Ga0496109_1248779_182_577 | 131 |
| 123 | 3300048927 | Ga0496124_0403528 | Ga0496124_0403528_190_591 | 131 |
| 124 | 3300049571 | Ga0501034_0008403 | Ga0501034_0008403_6045_6446 | 131 |
| 125 | 3300049573 | Ga0501037_0154604 | Ga0501037_0154604_440_841 | 131 |
| 126 | 3300049579 | Ga0501043_0132705 | Ga0501043_0132705_939_1340 | 131 |
| 127 | 3300049581 | Ga0501047_0254915 | Ga0501047_0254915_1092_1493 | 131 |
| 128 | 3300049822 | Ga0501035_0272866 | Ga0501035_0272866_325_726 | 131 |
| 129 | 3300050490 | nmdc:mga03n38_142945_c1 | nmdc:mga03n38_142945_c1_467_868 | 131 |
| 130 | 3300050491 | nmdc:mga00v17_55756_c1 | nmdc:mga00v17_55756_c1_1741_2142 | 131 |
| 131 | 3300050492 | nmdc:mga0yw44_483741_c1 | nmdc:mga0yw44_483741_c1_240_641 | 131 |
| 132 | 3300050492 | nmdc:mga0yw44_49196_c1 | nmdc:mga0yw44_49196_c1_756_1157 | 131 |
| 133 | 3300050492 | nmdc:mga0yw44_670251_c1 | nmdc:mga0yw44_670251_c1_278_679 | 131 |
| 134 | 3300050494 | nmdc:mga06z11_323177_c1 | nmdc:mga06z11_323177_c1_432_833 | 131 |
| 135 | 3300050495 | nmdc:mga04h51_16865_c1 | nmdc:mga04h51_16865_c1_1304_1705 | 131 |
| 136 | 3300050507 | nmdc:mga05p37_628928_c1 | nmdc:mga05p37_628928_c1_189_584 | 131 |
| 137 | 3300050507 | nmdc:mga05p37_703984_c1 | nmdc:mga05p37_703984_c1_603_998 | 131 |
| 138 | 3300050507 | nmdc:mga05p37_8890_c1 | nmdc:mga05p37_8890_c1_7796_8194 | 131 |
| 139 | 3300050508 | nmdc:mga09592_101135_c1 | nmdc:mga09592_101135_c1_1194_1589 | 131 |
| 140 | 3300050509 | nmdc:mga0qj67_124732_c1 | nmdc:mga0qj67_124732_c1_538_936 | 131 |
| 141 | 3300050510 | nmdc:mga06r32_271100_c1 | nmdc:mga06r32_271100_c1_612_1007 | 131 |
| 142 | 3300050510 | nmdc:mga06r32_747420_c1 | nmdc:mga06r32_747420_c1_344_739 | 131 |
| 143 | 3300050510 | nmdc:mga06r32_941239_c1 | nmdc:mga06r32_941239_c1_202_600 | 131 |
| 144 | 3300050511 | nmdc:mga08y16_23610_c1 | nmdc:mga08y16_23610_c1_2945_3340 | 131 |
| 145 | 3300050511 | nmdc:mga08y16_946824_c1 | nmdc:mga08y16_946824_c1_260_655 | 131 |
| 146 | 3300050512 | nmdc:mga0n895_453587_c1 | nmdc:mga0n895_453587_c1_849_1244 | 131 |
| 147 | 3300005327 | Ga0070658_10380262 | Ga0070658_103802622 | 132 |
| 148 | 3300005329 | Ga0070683_100022699 | Ga0070683_1000226992 | 132 |
| 149 | 3300005336 | Ga0070680_100005163 | Ga0070680_1000051634 | 132 |
| 150 | 3300005339 | Ga0070660_100016143 | Ga0070660_1000161437 | 132 |
| 151 | 3300005345 | Ga0070692_10379760 | Ga0070692_103797602 | 132 |
| 152 | 3300005366 | Ga0070659_100006515 | Ga0070659_1000065154 | 132 |
| 153 | 3300005458 | Ga0070681_10091114 | Ga0070681_100911142 | 132 |
| 154 | 3300005458 | Ga0070681_12052651 | Ga0070681_120526511 | 132 |
| 155 | 3300005530 | Ga0070679_100017967 | Ga0070679_1000179676 | 132 |
| 156 | 3300005535 | Ga0070684_100052601 | Ga0070684_1000526012 | 132 |
| 157 | 3300005535 | Ga0070684_100074548 | Ga0070684_1000745484 | 132 |
| 158 | 3300005539 | Ga0068853_100011930 | Ga0068853_1000119305 | 132 |
| 159 | 3300005563 | Ga0068855_100806797 | Ga0068855_1008067972 | 132 |
| 160 | 3300005564 | Ga0070664_100292499 | Ga0070664_1002924992 | 132 |
| 161 | 3300005564 | Ga0070664_100746599 | Ga0070664_1007465991 | 132 |
| 162 | 3300005578 | Ga0068854_100208318 | Ga0068854_1002083182 | 132 |
| 163 | 3300005614 | Ga0068856_100010275 | Ga0068856_1000102755 | 132 |
| 164 | 3300005616 | Ga0068852_100119524 | Ga0068852_1001195242 | 132 |
| 165 | 3300006844 | Ga0075428_100123245 | Ga0075428_1001232452 | 132 |
| 166 | 3300006844 | Ga0075428_100614301 | Ga0075428_1006143012 | 132 |
| 167 | 3300006880 | Ga0075429_100433317 | Ga0075429_1004333172 | 132 |
| 168 | 3300006880 | Ga0075429_101003354 | Ga0075429_1010033542 | 132 |
| 169 | 3300006880 | Ga0075429_101290836 | Ga0075429_1012908362 | 132 |
| 170 | 3300009093 | Ga0105240_10011892 | Ga0105240_100118922 | 132 |
| 171 | 3300009094 | Ga0111539_10006560 | Ga0111539_1000656015 | 132 |
| 172 | 3300009147 | Ga0114129_10682192 | Ga0114129_106821922 | 132 |
| 173 | 3300009148 | Ga0105243_11800937 | Ga0105243_118009372 | 132 |
| 174 | 3300009176 | Ga0105242_10390622 | Ga0105242_103906222 | 132 |
| 175 | 3300009545 | Ga0105237_10089582 | Ga0105237_100895822 | 132 |
| 176 | 3300009551 | Ga0105238_10081120 | Ga0105238_100811202 | 132 |
| 177 | 3300010375 | Ga0105239_10362276 | Ga0105239_103622762 | 132 |
| 178 | 3300013102 | Ga0157371_10035627 | Ga0157371_100356271 | 132 |
| 179 | 3300013104 | Ga0157370_10005899 | Ga0157370_100058997 | 132 |
| 180 | 3300013105 | Ga0157369_10023010 | Ga0157369_100230104 | 132 |
| 181 | 3300013307 | Ga0157372_10017054 | Ga0157372_100170542 | 132 |
| 182 | 3300014326 | Ga0157380_12732946 | Ga0157380_127329461 | 132 |
| 183 | 3300014497 | Ga0182008_10524064 | Ga0182008_105240642 | 132 |
| 184 | 3300020070 | Ga0206356_10104443 | Ga0206356_101044432 | 132 |
| 185 | 3300020082 | Ga0206353_11647415 | Ga0206353_116474152 | 132 |
| 186 | 3300025904 | Ga0207647_10173617 | Ga0207647_101736171 | 132 |
| 187 | 3300025909 | Ga0207705_10292946 | Ga0207705_102929462 | 132 |
| 188 | 3300025912 | Ga0207707_10003337 | Ga0207707_1000333710 | 132 |
| 189 | 3300025913 | Ga0207695_10221160 | Ga0207695_102211602 | 132 |
| 190 | 3300025914 | Ga0207671_10023217 | Ga0207671_100232176 | 132 |
| 191 | 3300025917 | Ga0207660_10023019 | Ga0207660_100230193 | 132 |
| 192 | 3300025919 | Ga0207657_10005840 | Ga0207657_100058408 | 132 |
| 193 | 3300025920 | Ga0207649_10014135 | Ga0207649_100141351 | 132 |
| 194 | 3300025921 | Ga0207652_10016967 | Ga0207652_100169674 | 132 |
| 195 | 3300025924 | Ga0207694_10085130 | Ga0207694_100851302 | 132 |
| 196 | 3300025932 | Ga0207690_10004895 | Ga0207690_100048955 | 132 |
| 197 | 3300025944 | Ga0207661_10000443 | Ga0207661_1000044313 | 132 |
| 198 | 3300025944 | Ga0207661_10007297 | Ga0207661_100072978 | 132 |
| 199 | 3300025944 | Ga0207661_10340812 | Ga0207661_103408122 | 132 |
| 200 | 3300025945 | Ga0207679_10270974 | Ga0207679_102709742 | 132 |
| 201 | 3300025949 | Ga0207667_10699222 | Ga0207667_106992222 | 132 |
| 202 | 3300025981 | Ga0207640_10154579 | Ga0207640_101545792 | 132 |
| 203 | 3300026041 | Ga0207639_10999347 | Ga0207639_109993472 | 132 |
| 204 | 3300026078 | Ga0207702_10012481 | Ga0207702_100124816 | 132 |
| 205 | 3300026078 | Ga0207702_11070579 | Ga0207702_110705791 | 132 |
| 206 | 3300026142 | Ga0207698_10071102 | Ga0207698_100711022 | 132 |
| 207 | 3300026142 | Ga0207698_11500565 | Ga0207698_115005652 | 132 |
| 208 | 3300031731 | Ga0307405_10995148 | Ga0307405_109951481 | 132 |
| 209 | 3300031852 | Ga0307410_10115911 | Ga0307410_101159112 | 132 |
| 210 | 3300031901 | Ga0307406_10143232 | Ga0307406_101432322 | 132 |
| 211 | 3300031901 | Ga0307406_10227145 | Ga0307406_102271451 | 132 |
| 212 | 3300031901 | Ga0307406_10792871 | Ga0307406_107928712 | 132 |
| 213 | 3300031911 | Ga0307412_10652233 | Ga0307412_106522332 | 132 |
| 214 | 3300031911 | Ga0307412_11103438 | Ga0307412_111034381 | 132 |
| 215 | 3300031995 | Ga0307409_100397946 | Ga0307409_1003979462 | 132 |
| 216 | 3300031995 | Ga0307409_100437569 | Ga0307409_1004375692 | 132 |
| 217 | 3300032002 | Ga0307416_100296290 | Ga0307416_1002962902 | 132 |
| 218 | 3300032002 | Ga0307416_100441776 | Ga0307416_1004417762 | 132 |
| 219 | 3300032002 | Ga0307416_101355035 | Ga0307416_1013550352 | 132 |
| 220 | 3300032002 | Ga0307416_101615797 | Ga0307416_1016157972 | 132 |
| 221 | 3300032002 | Ga0307416_101885927 | Ga0307416_1018859272 | 132 |
| 222 | 3300032126 | Ga0307415_100016500 | Ga0307415_1000165005 | 132 |
| 223 | 3300032126 | Ga0307415_100111251 | Ga0307415_1001112512 | 132 |
| 224 | 3300032126 | Ga0307415_100246840 | Ga0307415_1002468402 | 132 |
| 225 | 3300032126 | Ga0307415_100263823 | Ga0307415_1002638232 | 132 |
| 226 | 3300032126 | Ga0307415_100580697 | Ga0307415_1005806972 | 132 |
| 227 | 3300032126 | Ga0307415_101505987 | Ga0307415_1015059872 | 132 |
| 228 | 3300035121 | Ga0373960_0325163 | Ga0373960_0325163_59_460 | 132 |
| 229 | 3300037466 | Ga0395898_0216935 | Ga0395898_0216935_762_1163 | 132 |
| 230 | 3300037471 | Ga0395905_0830743 | Ga0395905_0830743_59_463 | 132 |
| 231 | 3300038443 | Ga0395901_0067832 | Ga0395901_0067832_470_871 | 132 |
| 232 | 3300038443 | Ga0395901_0536521 | Ga0395901_0536521_62_463 | 132 |
| 233 | 3300044683 | Ga0466965_0114390 | Ga0466965_0114390_111_512 | 132 |
| 234 | 3300044683 | Ga0466965_0227717 | Ga0466965_0227717_248_652 | 132 |
| 235 | 3300044683 | Ga0466965_0474521 | Ga0466965_0474521_199_600 | 132 |
| 236 | 3300044694 | Ga0466963_0029478 | Ga0466963_0029478_1467_1868 | 132 |
| 237 | 3300044694 | Ga0466963_0242740 | Ga0466963_0242740_519_920 | 132 |
| 238 | 3300044694 | Ga0466963_1071432 | Ga0466963_1071432_105_503 | 132 |
| 239 | 3300044706 | Ga0466964_0137203 | Ga0466964_0137203_395_796 | 132 |
| 240 | 3300044706 | Ga0466964_0302772 | Ga0466964_0302772_56_454 | 132 |
| 241 | 3300044706 | Ga0466964_0422815 | Ga0466964_0422815_162_566 | 132 |
| 242 | 3300044719 | Ga0466971_0300622 | Ga0466971_0300622_225_629 | 132 |
| 243 | 3300044842 | Ga0466957_0430257 | Ga0466957_0430257_458_865 | 132 |
| 244 | 3300044842 | Ga0466957_1148579 | Ga0466957_1148579_133_534 | 132 |
| 245 | 3300044842 | Ga0466957_1188285 | Ga0466957_1188285_102_506 | 132 |
| 246 | 3300044901 | Ga0466960_0124480 | Ga0466960_0124480_479_880 | 132 |
| 247 | 3300044901 | Ga0466960_0191357 | Ga0466960_0191357_658_1065 | 132 |
| 248 | 3300044901 | Ga0466960_0274604 | Ga0466960_0274604_319_771 | 132 |
| 249 | 3300044901 | Ga0466960_0352179 | Ga0466960_0352179_132_536 | 132 |
| 250 | 3300044901 | Ga0466960_0547795 | Ga0466960_0547795_254_655 | 132 |
| 251 | 3300044901 | Ga0466960_0619998 | Ga0466960_0619998_202_603 | 132 |
| 252 | 3300045976 | Ga0466967_0013701 | Ga0466967_0013701_3270_3674 | 132 |
| 253 | 3300045976 | Ga0466967_0033230 | Ga0466967_0033230_679_1077 | 132 |
| 254 | 3300045976 | Ga0466967_0149354 | Ga0466967_0149354_1639_2055 | 132 |
| 255 | 3300045976 | Ga0466967_0171553 | Ga0466967_0171553_630_1031 | 132 |
| 256 | 3300045976 | Ga0466967_0200915 | Ga0466967_0200915_842_1240 | 132 |
| 257 | 3300045976 | Ga0466967_0280541 | Ga0466967_0280541_1110_1511 | 132 |
| 258 | 3300045976 | Ga0466967_0375658 | Ga0466967_0375658_603_1004 | 132 |
| 259 | 3300045976 | Ga0466967_0506334 | Ga0466967_0506334_446_850 | 132 |
| 260 | 3300045976 | Ga0466967_0883632 | Ga0466967_0883632_414_812 | 132 |
| 261 | 3300045976 | Ga0466967_0924566 | Ga0466967_0924566_440_841 | 132 |
| 262 | 3300045976 | Ga0466967_1277625 | Ga0466967_1277625_42_443 | 132 |
| 263 | 3300048907 | Ga0496104_1557128 | Ga0496104_1557128_23_427 | 132 |
| 264 | 3300048915 | Ga0496112_0055480 | Ga0496112_0055480_2017_2421 | 132 |
| 265 | 3300049571 | Ga0501034_0388485 | Ga0501034_0388485_525_926 | 132 |
| 266 | 3300049572 | Ga0501036_0049346 | Ga0501036_0049346_2022_2423 | 132 |
| 267 | 3300049573 | Ga0501037_0240915 | Ga0501037_0240915_317_718 | 132 |
| 268 | 3300049574 | Ga0501038_0673083 | Ga0501038_0673083_235_636 | 132 |
| 269 | 3300049575 | Ga0501039_0130475 | Ga0501039_0130475_149_550 | 132 |
| 270 | 3300049576 | Ga0501040_0128013 | Ga0501040_0128013_887_1288 | 132 |
| 271 | 3300049577 | Ga0501041_0964356 | Ga0501041_0964356_66_467 | 132 |
| 272 | 3300049578 | Ga0501042_0237425 | Ga0501042_0237425_95_496 | 132 |
| 273 | 3300049578 | Ga0501042_0308422 | Ga0501042_0308422_667_1068 | 132 |
| 274 | 3300049582 | Ga0501048_0023615 | Ga0501048_0023615_880_1281 | 132 |
| 275 | 3300049588 | Ga0501072_0420258 | Ga0501072_0420258_383_784 | 132 |
| 276 | 3300049590 | Ga0501074_0587012 | Ga0501074_0587012_55_456 | 132 |
| 277 | 3300049591 | Ga0501075_0209807 | Ga0501075_0209807_763_1164 | 132 |
| 278 | 3300049592 | Ga0501076_0360869 | Ga0501076_0360869_740_1141 | 132 |
| 279 | 3300049743 | Ga0501081_0034089 | Ga0501081_0034089_2707_3108 | 132 |
| 280 | 3300049824 | Ga0501045_0235693 | Ga0501045_0235693_789_1190 | 132 |
| 281 | 3300050507 | nmdc:mga05p37_582441_c1 | nmdc:mga05p37_582441_c1_97_498 | 132 |
| 282 | 3300050508 | nmdc:mga09592_593750_c1 | nmdc:mga09592_593750_c1_245_646 | 132 |
| 283 | 3300050511 | nmdc:mga08y16_34965_c1 | nmdc:mga08y16_34965_c1_2467_2868 | 132 |
| 284 | 3300053083 | Ga0495655_0020068 | Ga0495655_0020068_567_974 | 132 |
| 285 | 3300054114 | Ga0501084_0030550 | Ga0501084_0030550_2653_3054 | 132 |
| 286 | 3300061719 | Ga0466962_0055335 | Ga0466962_0055335_414_818 | 132 |
| 287 | 3300061734 | Ga0530510_0099335 | Ga0530510_0099335_601_1002 | 132 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1j6q-assembly1.cif.gz_A | solution structure and characterization of the heme chaperone ccme | 0.811 | 36 | 122 |
| 1sr3-assembly1.cif.gz_A | solution structure of the heme chaperone ccme of escherichia coli | 0.7832 | 33 | 127 |
| 2pi2-assembly3.cif.gz_C | full-length replication protein a subunits rpa14 and rpa32 | 0.7822 | 51 | 121 |
| 1w3s-assembly1.cif.gz_A | the crystal structure of reco from deinococcus radiodurans. | 0.7667 | 49 | 122 |
| 2kct-assembly1.cif.gz_A | solution nmr structure of the ob-fold domain of heme chaperone ccme from desulfovibrio vulgaris. northeast structural genomics target dvr115g. | 0.7615 | 45 | 123 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1j6qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.811 | 36 | 122 | 2.40.50.140 |
| af_P9WF31_10_105_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8019 | 51 | 119 | 2.40.50.140 |
| 4xtcT03 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.7907 | 55 | 99 | 2.40.50.140 |
| 3f8tA02 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.7901 | 48 | 122 | 2.40.50.140 |
| af_P87307_123_212_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.7862 | 51 | 125 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A259GXA6-F1-model_v4 | Cytochrome c biogenesis protein CcmE | 0.8846 | 33 | 126 |
GO:0005886
GO:0017004 GO:0020037 GO:0046872 |
| AF-A0A1J1EKI3-F1-model_v4 | deleted | 0.8772 | 53 | 123 |
|
| AF-A0A0A2VYA4-F1-model_v4 | Heme exporter protein C | 0.8752 | 34 | 127 |
GO:0005886
GO:0015232 GO:0017004 GO:0020037 |
| AF-A0A1Q7GS37-F1-model_v4 | Cytochrome c maturation protein CcmE | 0.8744 | 32 | 126 |
GO:0005886
GO:0017004 GO:0020037 |
| AF-A0A5E8XGC1-F1-model_v4 | deleted | 0.8582 | 49 | 126 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar