F388037
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 287 | 187 | 281 | 106 |
Family's Representative Sequence
| Representative Sequence | 3300025914|Ga0207671_10264916|Ga0207671_102649162 |
| Length | 94 |
| Sequence | MDKVFEALSSTTRRKILAYLSATSLTAGEIADRFDVAKPTISKHLRRGQFIHYSLVRDNLVNTLNGFVPQVCPVSRPLRRESQAKAKVKRQSEA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 2 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 3 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 4 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 5 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 6 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 9 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 10 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 12 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 19 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 50 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 57 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 61 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 62 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 86 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 87 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 88 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 92 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 96 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 127 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 128 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 129 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 130 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 131 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 132 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 133 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 134 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 135 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 136 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 137 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 138 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 139 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 140 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 141 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 142 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 143 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 144 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 145 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 146 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 147 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 148 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 149 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 150 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 151 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 152 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 153 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 154 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 155 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 156 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 157 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 158 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 159 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 160 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 161 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 162 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 163 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 164 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 165 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 174 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 175 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 176 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 177 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 181 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 182 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 183 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 184 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 185 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 186 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 187 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.91 |
| Metatranscriptomes | 0 |
| Isolates | 2.09 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.45 |
| Nodule | 0 |
| Rhizoplane | 2.09 |
| Rhizosphere | 81.18 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10009360 | 3300002067 | Bacteria | 3148 |
| 2 | JGI24751J29686_10069881 | 3300002459 | Bacteria | 724 |
| 3 | JGI25159J45721_1000040 | 3300002987 | Bacteria | 68143 |
| 4 | JGI25160J50197_1000128 | 3300003354 | Bacteria | 68143 |
| 5 | JGI25161J50226_1000996 | 3300003374 | Bacteria | 9921 |
| 6 | Ga0055526_1001311 | 3300003771 | Bacteria | 17836 |
| 7 | Ga0055524_1078340 | 3300003775 | Bacteria | 610 |
| 8 | Ga0055536_1002507 | 3300003781 | Bacteria | 10298 |
| 9 | Ga0055530_10032143 | 3300003791 | Bacteria | 1368 |
| 10 | Ga0055540_1044053 | 3300003792 | Bacteria | 948 |
| 11 | Ga0055543_1000130 | 3300004625 | Bacteria | 62045 |
| 12 | Ga0065165_1000013 | 3300005262 | Bacteria | 301887 |
| 13 | Ga0065165_1012744 | 3300005262 | Bacteria | 3399 |
| 14 | Ga0065707_10195528 | 3300005295 | Unclassified | 1338 |
| 15 | Ga0065707_10400471 | 3300005295 | Unclassified | 853 |
| 16 | Ga0070658_10000002 | 3300005327 | Bacteria | 637290 |
| 17 | Ga0070658_10300241 | 3300005327 | Bacteria | 1369 |
| 18 | Ga0070658_10750144 | 3300005327 | Bacteria | 848 |
| 19 | Ga0070670_101150463 | 3300005331 | Bacteria | 708 |
| 20 | Ga0068869_101922934 | 3300005334 | Unclassified | 530 |
| 21 | Ga0070666_10001952 | 3300005335 | Bacteria | 12555 |
| 22 | Ga0070666_10021868 | 3300005335 | Bacteria | 4148 |
| 23 | Ga0068868_101099172 | 3300005338 | Bacteria | 731 |
| 24 | Ga0070660_100217977 | 3300005339 | Bacteria | 1551 |
| 25 | Ga0070660_100561728 | 3300005339 | Bacteria | 952 |
| 26 | Ga0070660_100789156 | 3300005339 | Bacteria | 798 |
| 27 | Ga0070661_100092164 | 3300005344 | Bacteria | 2245 |
| 28 | Ga0070668_100661858 | 3300005347 | Unclassified | 918 |
| 29 | Ga0070669_100223243 | 3300005353 | Bacteria | 1490 |
| 30 | Ga0070669_101864571 | 3300005353 | Unclassified | 525 |
| 31 | Ga0070671_100704629 | 3300005355 | Unclassified | 876 |
| 32 | Ga0070671_101755064 | 3300005355 | Unclassified | 551 |
| 33 | Ga0070674_100783691 | 3300005356 | Bacteria | 822 |
| 34 | Ga0070673_100440253 | 3300005364 | Bacteria | 1171 |
| 35 | Ga0070659_100961410 | 3300005366 | Bacteria | 748 |
| 36 | Ga0070667_100267318 | 3300005367 | Bacteria | 1532 |
| 37 | Ga0070711_100257980 | 3300005439 | Unclassified | 1370 |
| 38 | Ga0070663_100446509 | 3300005455 | Unclassified | 1065 |
| 39 | Ga0070681_10457599 | 3300005458 | Bacteria | 1188 |
| 40 | Ga0070679_100572218 | 3300005530 | Bacteria | 1073 |
| 41 | Ga0070679_100967128 | 3300005530 | Unclassified | 795 |
| 42 | Ga0070684_101795119 | 3300005535 | Unclassified | 579 |
| 43 | Ga0068853_100052284 | 3300005539 | Bacteria | 3519 |
| 44 | Ga0070695_101455902 | 3300005545 | Unclassified | 569 |
| 45 | Ga0070696_101113161 | 3300005546 | Unclassified | 664 |
| 46 | Ga0070665_100000058 | 3300005548 | Bacteria | 225040 |
| 47 | Ga0070665_100008989 | 3300005548 | Bacteria | 10119 |
| 48 | Ga0070665_100044568 | 3300005548 | Bacteria | 4454 |
| 49 | Ga0070665_100507216 | 3300005548 | Bacteria | 1218 |
| 50 | Ga0070665_100688637 | 3300005548 | Bacteria | 1035 |
| 51 | Ga0070665_101605502 | 3300005548 | Bacteria | 658 |
| 52 | Ga0068855_100231143 | 3300005563 | Bacteria | 2071 |
| 53 | Ga0068855_101147316 | 3300005563 | Bacteria | 810 |
| 54 | Ga0068857_100705847 | 3300005577 | Unclassified | 959 |
| 55 | Ga0068854_101977902 | 3300005578 | Bacteria | 537 |
| 56 | Ga0068856_100188698 | 3300005614 | Bacteria | 2075 |
| 57 | Ga0068856_100301687 | 3300005614 | Unclassified | 1619 |
| 58 | Ga0068852_100090496 | 3300005616 | Bacteria | 2737 |
| 59 | Ga0068864_102299944 | 3300005618 | Unclassified | 545 |
| 60 | Ga0068866_10506908 | 3300005718 | Unclassified | 799 |
| 61 | Ga0068851_10506196 | 3300005834 | Unclassified | 725 |
| 62 | Ga0068863_100211850 | 3300005841 | Bacteria | 1866 |
| 63 | Ga0068858_100423079 | 3300005842 | Unclassified | 1281 |
| 64 | Ga0068860_100640461 | 3300005843 | Bacteria | 1070 |
| 65 | Ga0068860_101097615 | 3300005843 | Bacteria | 815 |
| 66 | Ga0068860_102614244 | 3300005843 | Bacteria | 524 |
| 67 | Ga0068862_100150978 | 3300005844 | Bacteria | 2068 |
| 68 | Ga0068862_100852124 | 3300005844 | Bacteria | 893 |
| 69 | Ga0070717_11223885 | 3300006028 | Unclassified | 683 |
| 70 | Ga0075362_10728765 | 3300006177 | Bacteria | 518 |
| 71 | Ga0097621_100171479 | 3300006237 | Unclassified | 1870 |
| 72 | Ga0075370_10743520 | 3300006353 | Bacteria | 597 |
| 73 | Ga0068871_100174099 | 3300006358 | Bacteria | 1846 |
| 74 | Ga0075430_100252585 | 3300006846 | Bacteria | 1461 |
| 75 | Ga0075431_100770508 | 3300006847 | Bacteria | 937 |
| 76 | Ga0068865_100019187 | 3300006881 | Bacteria | 4423 |
| 77 | Ga0105240_10102294 | 3300009093 | Bacteria | 3482 |
| 78 | Ga0105240_10713898 | 3300009093 | Bacteria | 1093 |
| 79 | Ga0111539_13223784 | 3300009094 | Bacteria | 526 |
| 80 | Ga0105245_10144761 | 3300009098 | Bacteria | 2242 |
| 81 | Ga0105245_10230238 | 3300009098 | Bacteria | 1792 |
| 82 | Ga0105247_10694880 | 3300009101 | Unclassified | 765 |
| 83 | Ga0114129_10123997 | 3300009147 | Bacteria | 3553 |
| 84 | Ga0105242_11157255 | 3300009176 | Unclassified | 791 |
| 85 | Ga0105248_10494111 | 3300009177 | Bacteria | 1379 |
| 86 | Ga0105237_10080325 | 3300009545 | Bacteria | 3251 |
| 87 | Ga0105237_10187257 | 3300009545 | Bacteria | 2070 |
| 88 | Ga0105238_10011751 | 3300009551 | Bacteria | 8825 |
| 89 | Ga0105238_10017103 | 3300009551 | Bacteria | 7360 |
| 90 | Ga0105238_10078245 | 3300009551 | Bacteria | 3298 |
| 91 | Ga0105238_10242343 | 3300009551 | Bacteria | 1781 |
| 92 | Ga0105238_11011140 | 3300009551 | Bacteria | 852 |
| 93 | Ga0105249_10329695 | 3300009553 | Bacteria | 1540 |
| 94 | Ga0099796_10296124 | 3300010159 | Bacteria | 684 |
| 95 | Ga0105239_10170453 | 3300010375 | Bacteria | 2434 |
| 96 | Ga0105239_10483008 | 3300010375 | Bacteria | 1408 |
| 97 | Ga0157371_11255609 | 3300013102 | Bacteria | 572 |
| 98 | Ga0157370_10077198 | 3300013104 | Bacteria | 3138 |
| 99 | Ga0157369_10099012 | 3300013105 | Bacteria | 3108 |
| 100 | Ga0157374_10200125 | 3300013296 | Bacteria | 1956 |
| 101 | Ga0157378_10035460 | 3300013297 | Bacteria | 4412 |
| 102 | Ga0157378_12396353 | 3300013297 | Bacteria | 580 |
| 103 | Ga0163162_10028457 | 3300013306 | Bacteria | 5530 |
| 104 | Ga0163162_11586149 | 3300013306 | Unclassified | 746 |
| 105 | Ga0157372_10469438 | 3300013307 | Bacteria | 1467 |
| 106 | Ga0157375_10579921 | 3300013308 | Unclassified | 1282 |
| 107 | Ga0157375_11863979 | 3300013308 | Unclassified | 713 |
| 108 | Ga0157379_11197777 | 3300014968 | Bacteria | 730 |
| 109 | Ga0157376_11901214 | 3300014969 | Bacteria | 632 |
| 110 | Ga0213874_10210143 | 3300021377 | Bacteria | 703 |
| 111 | Ga0213876_10000998 | 3300021384 | Bacteria | 18468 |
| 112 | Ga0213876_10006721 | 3300021384 | Bacteria | 6279 |
| 113 | Ga0213875_10084571 | 3300021388 | Bacteria | 1480 |
| 114 | Ga0209436_102967 | 3300025208 | Bacteria | 4731 |
| 115 | Ga0209673_1109180 | 3300025273 | Bacteria | 582 |
| 116 | Ga0209130_1000034 | 3300025284 | Bacteria | 302439 |
| 117 | Ga0209675_1045882 | 3300025291 | Bacteria | 927 |
| 118 | Ga0209676_1001813 | 3300025292 | Bacteria | 17850 |
| 119 | Ga0209564_1000013 | 3300025295 | Bacteria | 775755 |
| 120 | Ga0209050_1002022 | 3300025298 | Bacteria | 18857 |
| 121 | Ga0209256_1007486 | 3300025299 | Bacteria | 5367 |
| 122 | Ga0207426_1000006 | 3300025302 | Bacteria | 1025969 |
| 123 | Ga0209051_1003936 | 3300025303 | Bacteria | 9464 |
| 124 | Ga0209257_1002648 | 3300025304 | Bacteria | 17217 |
| 125 | Ga0207680_10000710 | 3300025903 | Bacteria | 15636 |
| 126 | Ga0207680_10227369 | 3300025903 | Bacteria | 1281 |
| 127 | Ga0207647_10154350 | 3300025904 | Bacteria | 1341 |
| 128 | Ga0207705_10000008 | 3300025909 | Bacteria | 589717 |
| 129 | Ga0207705_10488565 | 3300025909 | Bacteria | 956 |
| 130 | Ga0207705_10554207 | 3300025909 | Bacteria | 894 |
| 131 | Ga0207707_10701193 | 3300025912 | Bacteria | 850 |
| 132 | Ga0207695_10068242 | 3300025913 | Bacteria | 3643 |
| 133 | Ga0207695_10381469 | 3300025913 | Bacteria | 1295 |
| 134 | Ga0207695_10809465 | 3300025913 | Bacteria | 817 |
| 135 | Ga0207671_10264916 | 3300025914 | Bacteria | 1353 |
| 136 | Ga0207657_10000231 | 3300025919 | Bacteria | 58585 |
| 137 | Ga0207657_10325448 | 3300025919 | Bacteria | 1215 |
| 138 | Ga0207649_10125241 | 3300025920 | Unclassified | 1738 |
| 139 | Ga0207649_11463584 | 3300025920 | Unclassified | 541 |
| 140 | Ga0207652_10354588 | 3300025921 | Bacteria | 1324 |
| 141 | Ga0207694_10022510 | 3300025924 | Bacteria | 4782 |
| 142 | Ga0207694_10050626 | 3300025924 | Bacteria | 3218 |
| 143 | Ga0207694_10056540 | 3300025924 | Bacteria | 3047 |
| 144 | Ga0207694_10059428 | 3300025924 | Bacteria | 2973 |
| 145 | Ga0207687_11623518 | 3300025927 | Bacteria | 555 |
| 146 | Ga0207690_10606606 | 3300025932 | Bacteria | 894 |
| 147 | Ga0207704_10269050 | 3300025938 | Bacteria | 1289 |
| 148 | Ga0207711_10229164 | 3300025941 | Bacteria | 1701 |
| 149 | Ga0207711_11645206 | 3300025941 | Unclassified | 585 |
| 150 | Ga0207689_11335229 | 3300025942 | Bacteria | 602 |
| 151 | Ga0207667_10541015 | 3300025949 | Bacteria | 1178 |
| 152 | Ga0207667_11017854 | 3300025949 | Bacteria | 815 |
| 153 | Ga0207651_10197685 | 3300025960 | Bacteria | 1609 |
| 154 | Ga0207712_10168726 | 3300025961 | Bacteria | 1708 |
| 155 | Ga0207658_12035957 | 3300025986 | Unclassified | 522 |
| 156 | Ga0207703_10684947 | 3300026035 | Bacteria | 974 |
| 157 | Ga0207639_10000095 | 3300026041 | Bacteria | 74687 |
| 158 | Ga0207702_10275885 | 3300026078 | Bacteria | 1587 |
| 159 | Ga0207702_10576630 | 3300026078 | Unclassified | 1102 |
| 160 | Ga0207641_10173132 | 3300026088 | Bacteria | 1972 |
| 161 | Ga0207698_10043178 | 3300026142 | Bacteria | 3376 |
| 162 | Ga0268266_10000005 | 3300028379 | Bacteria | 1448194 |
| 163 | Ga0268266_10012790 | 3300028379 | Bacteria | 7250 |
| 164 | Ga0268266_10069460 | 3300028379 | Bacteria | 3052 |
| 165 | Ga0268266_11154843 | 3300028379 | Bacteria | 749 |
| 166 | Ga0268265_10491625 | 3300028380 | Bacteria | 1154 |
| 167 | Ga0268265_11064727 | 3300028380 | Bacteria | 801 |
| 168 | Ga0268265_11254438 | 3300028380 | Unclassified | 740 |
| 169 | Ga0268265_11329478 | 3300028380 | Unclassified | 719 |
| 170 | Ga0268264_11194051 | 3300028381 | Bacteria | 770 |
| 171 | Ga0268264_11403096 | 3300028381 | Bacteria | 709 |
| 172 | Ga0265318_10000054 | 3300028577 | Bacteria | 114645 |
| 173 | Ga0265338_10245280 | 3300028800 | Bacteria | 1324 |
| 174 | Ga0307408_100863360 | 3300031548 | Bacteria | 826 |
| 175 | Ga0307405_10204039 | 3300031731 | Bacteria | 1438 |
| 176 | Ga0307405_10279655 | 3300031731 | Bacteria | 1255 |
| 177 | Ga0307405_10563927 | 3300031731 | Bacteria | 924 |
| 178 | Ga0307405_11961913 | 3300031731 | Bacteria | 523 |
| 179 | Ga0307413_10054823 | 3300031824 | Bacteria | 2422 |
| 180 | Ga0307413_10123982 | 3300031824 | Bacteria | 1755 |
| 181 | Ga0307413_10504516 | 3300031824 | Bacteria | 972 |
| 182 | Ga0307413_11016921 | 3300031824 | Bacteria | 711 |
| 183 | Ga0307410_10355756 | 3300031852 | Bacteria | 1171 |
| 184 | Ga0307410_10569426 | 3300031852 | Bacteria | 941 |
| 185 | Ga0307406_10056085 | 3300031901 | Bacteria | 2521 |
| 186 | Ga0307406_11286247 | 3300031901 | Bacteria | 638 |
| 187 | Ga0307406_11297278 | 3300031901 | Bacteria | 635 |
| 188 | Ga0307406_11524742 | 3300031901 | Bacteria | 589 |
| 189 | Ga0307407_10162420 | 3300031903 | Bacteria | 1463 |
| 190 | Ga0307412_10183775 | 3300031911 | Bacteria | 1575 |
| 191 | Ga0307412_10191006 | 3300031911 | Bacteria | 1548 |
| 192 | Ga0307412_10435649 | 3300031911 | Bacteria | 1076 |
| 193 | Ga0307412_10835614 | 3300031911 | Bacteria | 802 |
| 194 | Ga0307409_100047122 | 3300031995 | Bacteria | 3269 |
| 195 | Ga0307409_100437741 | 3300031995 | Bacteria | 1259 |
| 196 | Ga0307409_100638379 | 3300031995 | Unclassified | 1057 |
| 197 | Ga0307409_101759033 | 3300031995 | Bacteria | 649 |
| 198 | Ga0307416_100055725 | 3300032002 | Bacteria | 3186 |
| 199 | Ga0307416_100176104 | 3300032002 | Bacteria | 1998 |
| 200 | Ga0307416_100359937 | 3300032002 | Bacteria | 1477 |
| 201 | Ga0307416_100405596 | 3300032002 | Bacteria | 1402 |
| 202 | Ga0307416_100468939 | 3300032002 | Bacteria | 1316 |
| 203 | Ga0307416_100501054 | 3300032002 | Bacteria | 1279 |
| 204 | Ga0307416_100659309 | 3300032002 | Bacteria | 1132 |
| 205 | Ga0307414_10606038 | 3300032004 | Bacteria | 983 |
| 206 | Ga0307414_10762990 | 3300032004 | Bacteria | 880 |
| 207 | Ga0307414_11462460 | 3300032004 | Bacteria | 636 |
| 208 | Ga0307411_10116969 | 3300032005 | Bacteria | 1920 |
| 209 | Ga0307411_10171471 | 3300032005 | Bacteria | 1637 |
| 210 | Ga0307411_10180057 | 3300032005 | Bacteria | 1603 |
| 211 | Ga0307411_11048076 | 3300032005 | Bacteria | 732 |
| 212 | Ga0307411_11081850 | 3300032005 | Bacteria | 722 |
| 213 | Ga0307415_100203153 | 3300032126 | Bacteria | 1574 |
| 214 | Ga0307415_102557018 | 3300032126 | Bacteria | 503 |
| 215 | Ga0373945_0113176 | 3300035116 | Bacteria | 1072 |
| 216 | Ga0373954_0171763 | 3300035118 | Bacteria | 1062 |
| 217 | Ga0373931_0974328 | 3300035691 | Bacteria | 573 |
| 218 | Ga0373927_0067935 | 3300035695 | Bacteria | 2306 |
| 219 | Ga0373927_0672543 | 3300035695 | Bacteria | 684 |
| 220 | Ga0373947_0260535 | 3300035725 | Bacteria | 1149 |
| 221 | Ga0373947_0424104 | 3300035725 | Unclassified | 899 |
| 222 | Ga0373937_0214891 | 3300036401 | Unclassified | 1810 |
| 223 | Ga0373937_0567788 | 3300036401 | Bacteria | 1078 |
| 224 | Ga0373925_0609296 | 3300037068 | Bacteria | 899 |
| 225 | Ga0395899_0002702 | 3300037312 | Bacteria | 14300 |
| 226 | Ga0395899_0187039 | 3300037312 | Bacteria | 1451 |
| 227 | Ga0395900_0004764 | 3300037418 | Bacteria | 14296 |
| 228 | Ga0395900_0033583 | 3300037418 | Bacteria | 5280 |
| 229 | Ga0395900_0073713 | 3300037418 | Bacteria | 3510 |
| 230 | Ga0395900_0157530 | 3300037418 | Bacteria | 2319 |
| 231 | Ga0395900_0546275 | 3300037418 | Bacteria | 1104 |
| 232 | Ga0395900_1002086 | 3300037418 | Bacteria | 755 |
| 233 | Ga0395898_0009270 | 3300037466 | Bacteria | 10352 |
| 234 | Ga0395905_0002924 | 3300037471 | Bacteria | 18610 |
| 235 | Ga0395905_0005076 | 3300037471 | Bacteria | 13547 |
| 236 | Ga0395905_0188029 | 3300037471 | Bacteria | 1938 |
| 237 | Ga0395905_0188044 | 3300037471 | Bacteria | 1938 |
| 238 | Ga0436364_0091845 | 3300037853 | Bacteria | 1853 |
| 239 | Ga0395901_0004339 | 3300038443 | Bacteria | 14311 |
| 240 | Ga0395901_0573693 | 3300038443 | Bacteria | 1141 |
| 241 | Ga0395901_0861935 | 3300038443 | Bacteria | 890 |
| 242 | Ga0436365_0125993 | 3300039437 | Bacteria | 18465 |
| 243 | Ga0436365_1031309 | 3300039437 | Bacteria | 592 |
| 244 | Ga0436365_1180091 | 3300039437 | Bacteria | 18993 |
| 245 | Ga0436363_0658691 | 3300039450 | Bacteria | 1045 |
| 246 | Ga0436363_0907453 | 3300039450 | Bacteria | 508 |
| 247 | Ga0451807_0272796 | 3300041486 | Bacteria | 607 |
| 248 | Ga0451839_0893853 | 3300041496 | Bacteria | 638 |
| 249 | Ga0451853_0958219 | 3300041512 | Unclassified | 1013 |
| 250 | Ga0451853_3942217 | 3300041512 | Unclassified | 929 |
| 251 | Ga0439431_0112187 | 3300041997 | Bacteria | 756 |
| 252 | Ga0439446_0146775 | 3300042156 | Bacteria | 773 |
| 253 | Ga0439458_0001098 | 3300042157 | Bacteria | 6895 |
| 254 | Ga0439464_0268192 | 3300042439 | Bacteria | 554 |
| 255 | Ga0466963_0760912 | 3300044694 | Unclassified | 683 |
| 256 | Ga0466970_0901027 | 3300044765 | Unclassified | 520 |
| 257 | Ga0466958_0859470 | 3300045836 | Bacteria | 592 |
| 258 | Ga0495580_0004569 | 3300046472 | Bacteria | 11616 |
| 259 | Ga0495654_0244876 | 3300046530 | Unclassified | 749 |
| 260 | Ga0495665_0249053 | 3300046531 | Bacteria | 915 |
| 261 | Ga0495668_0118016 | 3300046616 | Bacteria | 1451 |
| 262 | Ga0495658_0071271 | 3300046683 | Bacteria | 2018 |
| 263 | Ga0495674_0258139 | 3300047319 | Bacteria | 1432 |
| 264 | Ga0495684_0427795 | 3300047471 | Bacteria | 924 |
| 265 | Ga0495686_0311619 | 3300047472 | Bacteria | 865 |
| 266 | Ga0496101_0417106 | 3300048904 | Bacteria | 1058 |
| 267 | Ga0496112_0003289 | 3300048915 | Bacteria | 13339 |
| 268 | Ga0496114_1124788 | 3300048917 | Unclassified | 670 |
| 269 | Ga0496115_0007576 | 3300048918 | Bacteria | 7995 |
| 270 | Ga0501075_1230225 | 3300049591 | Bacteria | 568 |
| 271 | nmdc:mga05p37_223929_c1 | 3300050507 | Bacteria | 2269 |
| 272 | nmdc:mga06r32_521204_c1 | 3300050510 | Bacteria | 1164 |
| 273 | Ga0500635_0171791 | 3300053080 | Unclassified | 835 |
| 274 | Ga0500644_0458255 | 3300053088 | Bacteria | 559 |
| 275 | Ga0500556_0000060 | 3300053104 | Bacteria | 112751 |
| 276 | Ga0500595_007769 | 3300053119 | Bacteria | 4427 |
| 277 | Ga0500652_097019 | 3300053131 | Bacteria | 1231 |
| 278 | Ga0500616_0024097 | 3300053153 | Bacteria | 3387 |
| 279 | Ga0590071_023755 | 3300059421 | Bacteria | 1451 |
| 280 | Ga0590075_003900 | 3300059424 | Bacteria | 3534 |
| 281 | Ga0590075_018646 | 3300059424 | Bacteria | 1717 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031824 | Ga0307413_10504516 | Ga0307413_105045161 | 91 |
| 2 | 3300031901 | Ga0307406_11286247 | Ga0307406_112862471 | 91 |
| 3 | 3300031911 | Ga0307412_10835614 | Ga0307412_108356141 | 91 |
| 4 | 3300031995 | Ga0307409_100047122 | Ga0307409_1000471223 | 91 |
| 5 | 3300032002 | Ga0307416_100055725 | Ga0307416_1000557253 | 91 |
| 6 | 3300032004 | Ga0307414_10606038 | Ga0307414_106060382 | 91 |
| 7 | 3300032005 | Ga0307411_10116969 | Ga0307411_101169693 | 91 |
| 8 | 3300032126 | Ga0307415_102557018 | Ga0307415_1025570181 | 91 |
| 9 | 3300041486 | Ga0451807_0272796 | Ga0451807_0272796_313_594 | 93 |
| 10 | 3300009545 | Ga0105237_10187257 | Ga0105237_101872573 | 94 |
| 11 | 3300025914 | Ga0207671_10264916 | Ga0207671_102649162 | 94 |
| 12 | 3300053088 | Ga0500644_0458255 | Ga0500644_0458255_43_393 | 95 |
| 13 | 3300013297 | Ga0157378_12396353 | Ga0157378_123963531 | 96 |
| 14 | 3300025912 | Ga0207707_10701193 | Ga0207707_107011932 | 98 |
| 15 | 3300005356 | Ga0070674_100783691 | Ga0070674_1007836911 | 99 |
| 16 | 3300005844 | Ga0068862_100852124 | Ga0068862_1008521242 | 100 |
| 17 | 3300028380 | Ga0268265_11329478 | Ga0268265_113294781 | 100 |
| 18 | 3300049591 | Ga0501075_1230225 | Ga0501075_1230225_28_330 | 100 |
| 19 | 3300002987 | JGI25159J45721_1000040 | JGI25159J45721_100004042 | 101 |
| 20 | 3300003354 | JGI25160J50197_1000128 | JGI25160J50197_100012839 | 101 |
| 21 | 3300003374 | JGI25161J50226_1000996 | JGI25161J50226_100099613 | 101 |
| 22 | 3300003771 | Ga0055526_1001311 | Ga0055526_10013114 | 101 |
| 23 | 3300003775 | Ga0055524_1078340 | Ga0055524_10783401 | 101 |
| 24 | 3300003781 | Ga0055536_1002507 | Ga0055536_10025076 | 101 |
| 25 | 3300003791 | Ga0055530_10032143 | Ga0055530_100321432 | 101 |
| 26 | 3300003792 | Ga0055540_1044053 | Ga0055540_10440532 | 101 |
| 27 | 3300004625 | Ga0055543_1000130 | Ga0055543_100013039 | 101 |
| 28 | 3300005262 | Ga0065165_1000013 | Ga0065165_1000013260 | 101 |
| 29 | 3300025208 | Ga0209436_102967 | Ga0209436_1029673 | 101 |
| 30 | 3300025273 | Ga0209673_1109180 | Ga0209673_11091801 | 101 |
| 31 | 3300025284 | Ga0209130_1000034 | Ga0209130_1000034251 | 101 |
| 32 | 3300025292 | Ga0209676_1001813 | Ga0209676_10018138 | 101 |
| 33 | 3300025295 | Ga0209564_1000013 | Ga0209564_1000013250 | 101 |
| 34 | 3300025298 | Ga0209050_1002022 | Ga0209050_10020226 | 101 |
| 35 | 3300025299 | Ga0209256_1007486 | Ga0209256_10074864 | 101 |
| 36 | 3300025302 | Ga0207426_1000006 | Ga0207426_1000006624 | 101 |
| 37 | 3300025303 | Ga0209051_1003936 | Ga0209051_10039365 | 101 |
| 38 | 3300025304 | Ga0209257_1002648 | Ga0209257_100264811 | 101 |
| 39 | 3300028577 | Ga0265318_10000054 | Ga0265318_1000005462 | 101 |
| 40 | 3300053104 | Ga0500556_0000060 | Ga0500556_0000060_59140_59445 | 101 |
| 41 | iso_pu_bacteria | 2599185352 | 2600194304 | 101 |
| 42 | iso_pu_bacteria | 2643221610 | 2644063545 | 101 |
| 43 | iso_pu_bacteria | 2643221675 | 2644414308 | 101 |
| 44 | iso_pu_bacteria | 2643221680 | 2644447836 | 101 |
| 45 | iso_pu_bacteria | 2643221723 | 2644676170 | 101 |
| 46 | iso_pu_bacteria | 2643221726 | 2644690309 | 101 |
| 47 | 3300005334 | Ga0068869_101922934 | Ga0068869_1019229341 | 102 |
| 48 | 3300005335 | Ga0070666_10021868 | Ga0070666_100218686 | 102 |
| 49 | 3300005355 | Ga0070671_100704629 | Ga0070671_1007046292 | 102 |
| 50 | 3300005367 | Ga0070667_100267318 | Ga0070667_1002673181 | 102 |
| 51 | 3300005439 | Ga0070711_100257980 | Ga0070711_1002579801 | 102 |
| 52 | 3300005545 | Ga0070695_101455902 | Ga0070695_1014559021 | 102 |
| 53 | 3300005548 | Ga0070665_100044568 | Ga0070665_1000445684 | 102 |
| 54 | 3300005614 | Ga0068856_100301687 | Ga0068856_1003016874 | 102 |
| 55 | 3300005843 | Ga0068860_100640461 | Ga0068860_1006404612 | 102 |
| 56 | 3300006237 | Ga0097621_100171479 | Ga0097621_1001714791 | 102 |
| 57 | 3300006353 | Ga0075370_10743520 | Ga0075370_107435202 | 102 |
| 58 | 3300006358 | Ga0068871_100174099 | Ga0068871_1001740991 | 102 |
| 59 | 3300006881 | Ga0068865_100019187 | Ga0068865_1000191873 | 102 |
| 60 | 3300009093 | Ga0105240_10713898 | Ga0105240_107138982 | 102 |
| 61 | 3300009098 | Ga0105245_10230238 | Ga0105245_102302382 | 102 |
| 62 | 3300009101 | Ga0105247_10694880 | Ga0105247_106948801 | 102 |
| 63 | 3300009176 | Ga0105242_11157255 | Ga0105242_111572552 | 102 |
| 64 | 3300009177 | Ga0105248_10494111 | Ga0105248_104941112 | 102 |
| 65 | 3300009545 | Ga0105237_10080325 | Ga0105237_100803256 | 102 |
| 66 | 3300010159 | Ga0099796_10296124 | Ga0099796_102961241 | 102 |
| 67 | 3300010375 | Ga0105239_10483008 | Ga0105239_104830082 | 102 |
| 68 | 3300013296 | Ga0157374_10200125 | Ga0157374_102001252 | 102 |
| 69 | 3300013297 | Ga0157378_10035460 | Ga0157378_100354603 | 102 |
| 70 | 3300013306 | Ga0163162_10028457 | Ga0163162_100284576 | 102 |
| 71 | 3300013308 | Ga0157375_10579921 | Ga0157375_105799213 | 102 |
| 72 | 3300014968 | Ga0157379_11197777 | Ga0157379_111977771 | 102 |
| 73 | 3300021388 | Ga0213875_10084571 | Ga0213875_100845711 | 102 |
| 74 | 3300025903 | Ga0207680_10227369 | Ga0207680_102273693 | 102 |
| 75 | 3300025913 | Ga0207695_10809465 | Ga0207695_108094652 | 102 |
| 76 | 3300025938 | Ga0207704_10269050 | Ga0207704_102690502 | 102 |
| 77 | 3300025941 | Ga0207711_10229164 | Ga0207711_102291643 | 102 |
| 78 | 3300025986 | Ga0207658_12035957 | Ga0207658_120359571 | 102 |
| 79 | 3300026035 | Ga0207703_10684947 | Ga0207703_106849471 | 102 |
| 80 | 3300026078 | Ga0207702_10576630 | Ga0207702_105766302 | 102 |
| 81 | 3300028379 | Ga0268266_10069460 | Ga0268266_100694605 | 102 |
| 82 | 3300028381 | Ga0268264_11194051 | Ga0268264_111940511 | 102 |
| 83 | 3300028800 | Ga0265338_10245280 | Ga0265338_102452801 | 102 |
| 84 | 3300031903 | Ga0307407_10162420 | Ga0307407_101624203 | 102 |
| 85 | 3300032005 | Ga0307411_10171471 | Ga0307411_101714713 | 102 |
| 86 | 3300035116 | Ga0373945_0113176 | Ga0373945_0113176_352_666 | 102 |
| 87 | 3300035118 | Ga0373954_0171763 | Ga0373954_0171763_46_360 | 102 |
| 88 | 3300035691 | Ga0373931_0974328 | Ga0373931_0974328_162_473 | 102 |
| 89 | 3300035695 | Ga0373927_0067935 | Ga0373927_0067935_710_1024 | 102 |
| 90 | 3300035725 | Ga0373947_0424104 | Ga0373947_0424104_543_857 | 102 |
| 91 | 3300036401 | Ga0373937_0214891 | Ga0373937_0214891_179_493 | 102 |
| 92 | 3300036401 | Ga0373937_0567788 | Ga0373937_0567788_491_799 | 102 |
| 93 | 3300037068 | Ga0373925_0609296 | Ga0373925_0609296_352_666 | 102 |
| 94 | 3300037853 | Ga0436364_0091845 | Ga0436364_0091845_198_506 | 102 |
| 95 | 3300041496 | Ga0451839_0893853 | Ga0451839_0893853_57_371 | 102 |
| 96 | 3300041512 | Ga0451853_0958219 | Ga0451853_0958219_220_534 | 102 |
| 97 | 3300046472 | Ga0495580_0004569 | Ga0495580_0004569_2751_3065 | 102 |
| 98 | 3300046530 | Ga0495654_0244876 | Ga0495654_0244876_423_731 | 102 |
| 99 | 3300046531 | Ga0495665_0249053 | Ga0495665_0249053_390_704 | 102 |
| 100 | 3300046683 | Ga0495658_0071271 | Ga0495658_0071271_1516_1830 | 102 |
| 101 | 3300047319 | Ga0495674_0258139 | Ga0495674_0258139_637_951 | 102 |
| 102 | 3300047471 | Ga0495684_0427795 | Ga0495684_0427795_254_568 | 102 |
| 103 | 3300048904 | Ga0496101_0417106 | Ga0496101_0417106_411_725 | 102 |
| 104 | 3300048917 | Ga0496114_1124788 | Ga0496114_1124788_215_529 | 102 |
| 105 | 3300053080 | Ga0500635_0171791 | Ga0500635_0171791_386_694 | 102 |
| 106 | 3300053131 | Ga0500652_097019 | Ga0500652_097019_55_375 | 102 |
| 107 | 3300053153 | Ga0500616_0024097 | Ga0500616_0024097_2533_2841 | 102 |
| 108 | 3300005841 | Ga0068863_100211850 | Ga0068863_1002118501 | 103 |
| 109 | 3300005842 | Ga0068858_100423079 | Ga0068858_1004230792 | 103 |
| 110 | 3300005843 | Ga0068860_102614244 | Ga0068860_1026142441 | 103 |
| 111 | 3300026088 | Ga0207641_10173132 | Ga0207641_101731324 | 103 |
| 112 | 3300031731 | Ga0307405_11961913 | Ga0307405_119619131 | 103 |
| 113 | 3300041997 | Ga0439431_0112187 | Ga0439431_0112187_46_357 | 103 |
| 114 | 3300042156 | Ga0439446_0146775 | Ga0439446_0146775_28_339 | 103 |
| 115 | 3300005548 | Ga0070665_100008989 | Ga0070665_1000089894 | 104 |
| 116 | 3300005563 | Ga0068855_101147316 | Ga0068855_1011473162 | 104 |
| 117 | 3300006177 | Ga0075362_10728765 | Ga0075362_107287651 | 104 |
| 118 | 3300006846 | Ga0075430_100252585 | Ga0075430_1002525853 | 104 |
| 119 | 3300006847 | Ga0075431_100770508 | Ga0075431_1007705083 | 104 |
| 120 | 3300009093 | Ga0105240_10102294 | Ga0105240_101022944 | 104 |
| 121 | 3300009147 | Ga0114129_10123997 | Ga0114129_101239974 | 104 |
| 122 | 3300025913 | Ga0207695_10068242 | Ga0207695_100682424 | 104 |
| 123 | 3300025942 | Ga0207689_11335229 | Ga0207689_113352292 | 104 |
| 124 | 3300025949 | Ga0207667_11017854 | Ga0207667_110178542 | 104 |
| 125 | 3300028379 | Ga0268266_10012790 | Ga0268266_100127904 | 104 |
| 126 | 3300042439 | Ga0439464_0268192 | Ga0439464_0268192_178_492 | 104 |
| 127 | 3300050507 | nmdc:mga05p37_223929_c1 | nmdc:mga05p37_223929_c1_461_775 | 104 |
| 128 | 3300050510 | nmdc:mga06r32_521204_c1 | nmdc:mga06r32_521204_c1_15_329 | 104 |
| 129 | 3300053119 | Ga0500595_007769 | Ga0500595_007769_658_972 | 104 |
| 130 | 3300059424 | Ga0590075_018646 | Ga0590075_018646_923_1249 | 104 |
| 131 | 3300002459 | JGI24751J29686_10069881 | JGI24751J29686_100698811 | 105 |
| 132 | 3300005331 | Ga0070670_101150463 | Ga0070670_1011504631 | 105 |
| 133 | 3300005335 | Ga0070666_10001952 | Ga0070666_100019524 | 105 |
| 134 | 3300005548 | Ga0070665_101605502 | Ga0070665_1016055021 | 105 |
| 135 | 3300005563 | Ga0068855_100231143 | Ga0068855_1002311433 | 105 |
| 136 | 3300006028 | Ga0070717_11223885 | Ga0070717_112238851 | 105 |
| 137 | 3300025903 | Ga0207680_10000710 | Ga0207680_1000071014 | 105 |
| 138 | 3300025949 | Ga0207667_10541015 | Ga0207667_105410152 | 105 |
| 139 | 3300028379 | Ga0268266_11154843 | Ga0268266_111548432 | 105 |
| 140 | 3300028380 | Ga0268265_11064727 | Ga0268265_110647272 | 105 |
| 141 | 3300046616 | Ga0495668_0118016 | Ga0495668_0118016_160_477 | 105 |
| 142 | 3300047472 | Ga0495686_0311619 | Ga0495686_0311619_123_440 | 105 |
| 143 | 3300005262 | Ga0065165_1012744 | Ga0065165_10127443 | 106 |
| 144 | 3300005327 | Ga0070658_10300241 | Ga0070658_103002412 | 106 |
| 145 | 3300005327 | Ga0070658_10750144 | Ga0070658_107501441 | 106 |
| 146 | 3300005339 | Ga0070660_100561728 | Ga0070660_1005617282 | 106 |
| 147 | 3300005535 | Ga0070684_101795119 | Ga0070684_1017951192 | 106 |
| 148 | 3300005548 | Ga0070665_100000058 | Ga0070665_100000058199 | 106 |
| 149 | 3300005548 | Ga0070665_100688637 | Ga0070665_1006886372 | 106 |
| 150 | 3300009094 | Ga0111539_13223784 | Ga0111539_132237841 | 106 |
| 151 | 3300009098 | Ga0105245_10144761 | Ga0105245_101447612 | 106 |
| 152 | 3300009551 | Ga0105238_10011751 | Ga0105238_100117517 | 106 |
| 153 | 3300009551 | Ga0105238_10017103 | Ga0105238_100171035 | 106 |
| 154 | 3300009551 | Ga0105238_10242343 | Ga0105238_102423432 | 106 |
| 155 | 3300009551 | Ga0105238_11011140 | Ga0105238_110111401 | 106 |
| 156 | 3300014969 | Ga0157376_11901214 | Ga0157376_119012141 | 106 |
| 157 | 3300021384 | Ga0213876_10006721 | Ga0213876_100067215 | 106 |
| 158 | 3300025909 | Ga0207705_10488565 | Ga0207705_104885651 | 106 |
| 159 | 3300025909 | Ga0207705_10554207 | Ga0207705_105542072 | 106 |
| 160 | 3300025913 | Ga0207695_10381469 | Ga0207695_103814692 | 106 |
| 161 | 3300025919 | Ga0207657_10325448 | Ga0207657_103254482 | 106 |
| 162 | 3300025924 | Ga0207694_10022510 | Ga0207694_100225105 | 106 |
| 163 | 3300025924 | Ga0207694_10050626 | Ga0207694_100506263 | 106 |
| 164 | 3300025924 | Ga0207694_10056540 | Ga0207694_100565403 | 106 |
| 165 | 3300025927 | Ga0207687_11623518 | Ga0207687_116235181 | 106 |
| 166 | 3300028379 | Ga0268266_10000005 | Ga0268266_10000005292 | 106 |
| 167 | 3300032004 | Ga0307414_11462460 | Ga0307414_114624602 | 106 |
| 168 | 3300037312 | Ga0395899_0002702 | Ga0395899_0002702_6237_6557 | 106 |
| 169 | 3300037312 | Ga0395899_0187039 | Ga0395899_0187039_455_775 | 106 |
| 170 | 3300037418 | Ga0395900_0004764 | Ga0395900_0004764_6216_6536 | 106 |
| 171 | 3300037418 | Ga0395900_0157530 | Ga0395900_0157530_750_1070 | 106 |
| 172 | 3300037466 | Ga0395898_0009270 | Ga0395898_0009270_3788_4108 | 106 |
| 173 | 3300037471 | Ga0395905_0005076 | Ga0395905_0005076_5459_5779 | 106 |
| 174 | 3300037471 | Ga0395905_0188044 | Ga0395905_0188044_94_414 | 106 |
| 175 | 3300038443 | Ga0395901_0004339 | Ga0395901_0004339_6223_6543 | 106 |
| 176 | 3300039437 | Ga0436365_1180091 | Ga0436365_1180091_3818_4150 | 106 |
| 177 | 3300044765 | Ga0466970_0901027 | Ga0466970_0901027_112_432 | 106 |
| 178 | 3300045836 | Ga0466958_0859470 | Ga0466958_0859470_39_359 | 106 |
| 179 | 3300048918 | Ga0496115_0007576 | Ga0496115_0007576_2171_2491 | 106 |
| 180 | 3300002067 | JGI24735J21928_10009360 | JGI24735J21928_100093602 | 107 |
| 181 | 3300005295 | Ga0065707_10195528 | Ga0065707_101955282 | 107 |
| 182 | 3300005295 | Ga0065707_10400471 | Ga0065707_104004712 | 107 |
| 183 | 3300005327 | Ga0070658_10000002 | Ga0070658_10000002566 | 107 |
| 184 | 3300005338 | Ga0068868_101099172 | Ga0068868_1010991721 | 107 |
| 185 | 3300005339 | Ga0070660_100217977 | Ga0070660_1002179772 | 107 |
| 186 | 3300005339 | Ga0070660_100789156 | Ga0070660_1007891561 | 107 |
| 187 | 3300005344 | Ga0070661_100092164 | Ga0070661_1000921641 | 107 |
| 188 | 3300005347 | Ga0070668_100661858 | Ga0070668_1006618582 | 107 |
| 189 | 3300005353 | Ga0070669_100223243 | Ga0070669_1002232432 | 107 |
| 190 | 3300005353 | Ga0070669_101864571 | Ga0070669_1018645711 | 107 |
| 191 | 3300005355 | Ga0070671_101755064 | Ga0070671_1017550641 | 107 |
| 192 | 3300005364 | Ga0070673_100440253 | Ga0070673_1004402532 | 107 |
| 193 | 3300005366 | Ga0070659_100961410 | Ga0070659_1009614101 | 107 |
| 194 | 3300005455 | Ga0070663_100446509 | Ga0070663_1004465092 | 107 |
| 195 | 3300005458 | Ga0070681_10457599 | Ga0070681_104575992 | 107 |
| 196 | 3300005530 | Ga0070679_100572218 | Ga0070679_1005722182 | 107 |
| 197 | 3300005530 | Ga0070679_100967128 | Ga0070679_1009671282 | 107 |
| 198 | 3300005539 | Ga0068853_100052284 | Ga0068853_1000522842 | 107 |
| 199 | 3300005546 | Ga0070696_101113161 | Ga0070696_1011131612 | 107 |
| 200 | 3300005548 | Ga0070665_100507216 | Ga0070665_1005072162 | 107 |
| 201 | 3300005577 | Ga0068857_100705847 | Ga0068857_1007058472 | 107 |
| 202 | 3300005578 | Ga0068854_101977902 | Ga0068854_1019779021 | 107 |
| 203 | 3300005614 | Ga0068856_100188698 | Ga0068856_1001886983 | 107 |
| 204 | 3300005616 | Ga0068852_100090496 | Ga0068852_1000904963 | 107 |
| 205 | 3300005618 | Ga0068864_102299944 | Ga0068864_1022999441 | 107 |
| 206 | 3300005718 | Ga0068866_10506908 | Ga0068866_105069082 | 107 |
| 207 | 3300005834 | Ga0068851_10506196 | Ga0068851_105061962 | 107 |
| 208 | 3300005843 | Ga0068860_101097615 | Ga0068860_1010976152 | 107 |
| 209 | 3300005844 | Ga0068862_100150978 | Ga0068862_1001509782 | 107 |
| 210 | 3300009551 | Ga0105238_10078245 | Ga0105238_100782452 | 107 |
| 211 | 3300009553 | Ga0105249_10329695 | Ga0105249_103296952 | 107 |
| 212 | 3300010375 | Ga0105239_10170453 | Ga0105239_101704532 | 107 |
| 213 | 3300013102 | Ga0157371_11255609 | Ga0157371_112556091 | 107 |
| 214 | 3300013104 | Ga0157370_10077198 | Ga0157370_100771985 | 107 |
| 215 | 3300013105 | Ga0157369_10099012 | Ga0157369_100990125 | 107 |
| 216 | 3300013306 | Ga0163162_11586149 | Ga0163162_115861491 | 107 |
| 217 | 3300013307 | Ga0157372_10469438 | Ga0157372_104694382 | 107 |
| 218 | 3300013308 | Ga0157375_11863979 | Ga0157375_118639792 | 107 |
| 219 | 3300021377 | Ga0213874_10210143 | Ga0213874_102101432 | 107 |
| 220 | 3300021384 | Ga0213876_10000998 | Ga0213876_100009986 | 107 |
| 221 | 3300025291 | Ga0209675_1045882 | Ga0209675_10458822 | 107 |
| 222 | 3300025904 | Ga0207647_10154350 | Ga0207647_101543501 | 107 |
| 223 | 3300025909 | Ga0207705_10000008 | Ga0207705_10000008224 | 107 |
| 224 | 3300025919 | Ga0207657_10000231 | Ga0207657_100002319 | 107 |
| 225 | 3300025920 | Ga0207649_10125241 | Ga0207649_101252413 | 107 |
| 226 | 3300025920 | Ga0207649_11463584 | Ga0207649_114635841 | 107 |
| 227 | 3300025921 | Ga0207652_10354588 | Ga0207652_103545883 | 107 |
| 228 | 3300025924 | Ga0207694_10059428 | Ga0207694_100594282 | 107 |
| 229 | 3300025932 | Ga0207690_10606606 | Ga0207690_106066062 | 107 |
| 230 | 3300025941 | Ga0207711_11645206 | Ga0207711_116452062 | 107 |
| 231 | 3300025960 | Ga0207651_10197685 | Ga0207651_101976852 | 107 |
| 232 | 3300025961 | Ga0207712_10168726 | Ga0207712_101687263 | 107 |
| 233 | 3300026041 | Ga0207639_10000095 | Ga0207639_1000009540 | 107 |
| 234 | 3300026078 | Ga0207702_10275885 | Ga0207702_102758851 | 107 |
| 235 | 3300026142 | Ga0207698_10043178 | Ga0207698_100431782 | 107 |
| 236 | 3300028380 | Ga0268265_10491625 | Ga0268265_104916252 | 107 |
| 237 | 3300028380 | Ga0268265_11254438 | Ga0268265_112544382 | 107 |
| 238 | 3300028381 | Ga0268264_11403096 | Ga0268264_114030962 | 107 |
| 239 | 3300031548 | Ga0307408_100863360 | Ga0307408_1008633602 | 107 |
| 240 | 3300031731 | Ga0307405_10204039 | Ga0307405_102040392 | 107 |
| 241 | 3300031731 | Ga0307405_10279655 | Ga0307405_102796552 | 107 |
| 242 | 3300031731 | Ga0307405_10563927 | Ga0307405_105639272 | 107 |
| 243 | 3300031824 | Ga0307413_10054823 | Ga0307413_100548234 | 107 |
| 244 | 3300031824 | Ga0307413_10123982 | Ga0307413_101239823 | 107 |
| 245 | 3300031824 | Ga0307413_11016921 | Ga0307413_110169212 | 107 |
| 246 | 3300031852 | Ga0307410_10355756 | Ga0307410_103557562 | 107 |
| 247 | 3300031852 | Ga0307410_10569426 | Ga0307410_105694262 | 107 |
| 248 | 3300031901 | Ga0307406_10056085 | Ga0307406_100560852 | 107 |
| 249 | 3300031901 | Ga0307406_11297278 | Ga0307406_112972782 | 107 |
| 250 | 3300031901 | Ga0307406_11524742 | Ga0307406_115247421 | 107 |
| 251 | 3300031911 | Ga0307412_10183775 | Ga0307412_101837752 | 107 |
| 252 | 3300031911 | Ga0307412_10191006 | Ga0307412_101910061 | 107 |
| 253 | 3300031911 | Ga0307412_10435649 | Ga0307412_104356492 | 107 |
| 254 | 3300031995 | Ga0307409_100437741 | Ga0307409_1004377412 | 107 |
| 255 | 3300031995 | Ga0307409_100638379 | Ga0307409_1006383791 | 107 |
| 256 | 3300031995 | Ga0307409_101759033 | Ga0307409_1017590332 | 107 |
| 257 | 3300032002 | Ga0307416_100176104 | Ga0307416_1001761042 | 107 |
| 258 | 3300032002 | Ga0307416_100359937 | Ga0307416_1003599371 | 107 |
| 259 | 3300032002 | Ga0307416_100405596 | Ga0307416_1004055962 | 107 |
| 260 | 3300032002 | Ga0307416_100468939 | Ga0307416_1004689392 | 107 |
| 261 | 3300032002 | Ga0307416_100501054 | Ga0307416_1005010542 | 107 |
| 262 | 3300032002 | Ga0307416_100659309 | Ga0307416_1006593091 | 107 |
| 263 | 3300032004 | Ga0307414_10762990 | Ga0307414_107629901 | 107 |
| 264 | 3300032005 | Ga0307411_10180057 | Ga0307411_101800572 | 107 |
| 265 | 3300032005 | Ga0307411_11048076 | Ga0307411_110480762 | 107 |
| 266 | 3300032005 | Ga0307411_11081850 | Ga0307411_110818501 | 107 |
| 267 | 3300032126 | Ga0307415_100203153 | Ga0307415_1002031531 | 107 |
| 268 | 3300035695 | Ga0373927_0672543 | Ga0373927_0672543_165_488 | 107 |
| 269 | 3300035725 | Ga0373947_0260535 | Ga0373947_0260535_79_402 | 107 |
| 270 | 3300037418 | Ga0395900_0033583 | Ga0395900_0033583_2317_2640 | 107 |
| 271 | 3300037418 | Ga0395900_0073713 | Ga0395900_0073713_2124_2447 | 107 |
| 272 | 3300037418 | Ga0395900_0546275 | Ga0395900_0546275_581_910 | 107 |
| 273 | 3300037418 | Ga0395900_1002086 | Ga0395900_1002086_51_374 | 107 |
| 274 | 3300037471 | Ga0395905_0002924 | Ga0395905_0002924_10683_11012 | 107 |
| 275 | 3300037471 | Ga0395905_0188029 | Ga0395905_0188029_1282_1605 | 107 |
| 276 | 3300038443 | Ga0395901_0573693 | Ga0395901_0573693_522_845 | 107 |
| 277 | 3300038443 | Ga0395901_0861935 | Ga0395901_0861935_98_421 | 107 |
| 278 | 3300039437 | Ga0436365_0125993 | Ga0436365_0125993_4478_4804 | 107 |
| 279 | 3300039437 | Ga0436365_1031309 | Ga0436365_1031309_78_419 | 107 |
| 280 | 3300039450 | Ga0436363_0658691 | Ga0436363_0658691_329_655 | 107 |
| 281 | 3300039450 | Ga0436363_0907453 | Ga0436363_0907453_118_444 | 107 |
| 282 | 3300041512 | Ga0451853_3942217 | Ga0451853_3942217_504_851 | 107 |
| 283 | 3300042157 | Ga0439458_0001098 | Ga0439458_0001098_6557_6880 | 107 |
| 284 | 3300044694 | Ga0466963_0760912 | Ga0466963_0760912_152_475 | 107 |
| 285 | 3300048915 | Ga0496112_0003289 | Ga0496112_0003289_1946_2269 | 107 |
| 286 | 3300059421 | Ga0590071_023755 | Ga0590071_023755_281_604 | 107 |
| 287 | 3300059424 | Ga0590075_003900 | Ga0590075_003900_2450_2773 | 107 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1sfu-assembly1.cif.gz_B | crystal structure of the viral zalpha domain bound to left-handed z-dna | 0.9426 | 24 | 67 |
| 3cuq-assembly1.cif.gz_B | integrated structural and functional model of the human escrt-ii complex | 0.93 | 24 | 67 |
| 4ooi-assembly1.cif.gz_B | reduced hlyu from vibrio cholerae n16961 | 0.9264 | 3 | 83 |
| 2kko-assembly1.cif.gz_A | solution nmr structure of the homodimeric winged helix-turn-helix dna-binding domain (fragment 1-100) mb0332 from mycobacterium bovis, a possible arsr-family transcriptional regulator. northeast structural genomics consortium target mbr242e. | 0.9184 | 2 | 83 |
| 2zme-assembly1.cif.gz_B | integrated structural and functional model of the human escrt-ii complex | 0.9134 | 24 | 67 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58793_322_389_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9583 | 8 | 67 | 1.10.10.10 |
| af_Q57824_147_206_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9582 | 10 | 66 | 1.10.10.10 |
| af_Q4DZU8_467_618_3.30.230.130 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 | 0.9549 | 24 | 67 | 3.30.230.130 |
| af_P76066_81_136_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9482 | 24 | 67 | 1.10.10.10 |
| 1sfuB00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9426 | 24 | 67 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3A0DL23-F1-model_v4 | ArsR family transcriptional regulator | 0.9683 | 2 | 70 |
GO:0003700
|
| AF-A0A0S8API7-F1-model_v4 | HTH arsR-type domain-containing protein | 0.9629 | 2 | 70 |
GO:0003700
|
| AF-A0A2V3VWL7-F1-model_v4 | Regulatory ArsR family protein | 0.9569 | 2 | 85 |
GO:0003677
GO:0003700 |
| AF-A0A2M7QV52-F1-model_v4 | HTH arsR-type domain-containing protein | 0.9547 | 3 | 80 |
GO:0003700
|
| AF-S5AFX2-F1-model_v4 | ArsR family transcriptional regulator | 0.9522 | 3 | 85 |
GO:0003700
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar