F388037

General Info

Members Datasets Scaffolds Average Seq Length
287 187 281 106

Family's Representative Sequence

Representative Sequence 3300025914|Ga0207671_10264916|Ga0207671_102649162
Length 94
Sequence MDKVFEALSSTTRRKILAYLSATSLTAGEIADRFDVAKPTISKHLRRGQFIHYSLVRDNLVNTLNGFVPQVCPVSRPLRRESQAKAKVKRQSEA

Samples

Sample ID Description Type Environment
1 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
2 2643221610 Ensifer sp. Root74 Isolate Unclassified
3 2643221675 Ensifer sp. Root1298 Isolate Unclassified
4 2643221680 Ensifer sp. Root1312 Isolate Unclassified
5 2643221723 Ensifer sp. Root278 Isolate Unclassified
6 2643221726 Ensifer sp. Root954 Isolate Unclassified
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
17 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
88 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
89 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
97 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
141 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
144 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
155 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
156 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
157 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
158 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
159 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
160 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
161 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
162 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
163 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
166 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
167 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
168 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
169 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
170 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
171 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
172 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
181 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
182 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
183 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
184 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
185 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
186 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
187 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.91
Metatranscriptomes 0
Isolates 2.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.45
Nodule 0
Rhizoplane 2.09
Rhizosphere 81.18
Stem 0
Stem Tuber 0
Unclassified 6.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10009360 3300002067 Bacteria 3148
2 JGI24751J29686_10069881 3300002459 Bacteria 724
3 JGI25159J45721_1000040 3300002987 Bacteria 68143
4 JGI25160J50197_1000128 3300003354 Bacteria 68143
5 JGI25161J50226_1000996 3300003374 Bacteria 9921
6 Ga0055526_1001311 3300003771 Bacteria 17836
7 Ga0055524_1078340 3300003775 Bacteria 610
8 Ga0055536_1002507 3300003781 Bacteria 10298
9 Ga0055530_10032143 3300003791 Bacteria 1368
10 Ga0055540_1044053 3300003792 Bacteria 948
11 Ga0055543_1000130 3300004625 Bacteria 62045
12 Ga0065165_1000013 3300005262 Bacteria 301887
13 Ga0065165_1012744 3300005262 Bacteria 3399
14 Ga0065707_10195528 3300005295 Unclassified 1338
15 Ga0065707_10400471 3300005295 Unclassified 853
16 Ga0070658_10000002 3300005327 Bacteria 637290
17 Ga0070658_10300241 3300005327 Bacteria 1369
18 Ga0070658_10750144 3300005327 Bacteria 848
19 Ga0070670_101150463 3300005331 Bacteria 708
20 Ga0068869_101922934 3300005334 Unclassified 530
21 Ga0070666_10001952 3300005335 Bacteria 12555
22 Ga0070666_10021868 3300005335 Bacteria 4148
23 Ga0068868_101099172 3300005338 Bacteria 731
24 Ga0070660_100217977 3300005339 Bacteria 1551
25 Ga0070660_100561728 3300005339 Bacteria 952
26 Ga0070660_100789156 3300005339 Bacteria 798
27 Ga0070661_100092164 3300005344 Bacteria 2245
28 Ga0070668_100661858 3300005347 Unclassified 918
29 Ga0070669_100223243 3300005353 Bacteria 1490
30 Ga0070669_101864571 3300005353 Unclassified 525
31 Ga0070671_100704629 3300005355 Unclassified 876
32 Ga0070671_101755064 3300005355 Unclassified 551
33 Ga0070674_100783691 3300005356 Bacteria 822
34 Ga0070673_100440253 3300005364 Bacteria 1171
35 Ga0070659_100961410 3300005366 Bacteria 748
36 Ga0070667_100267318 3300005367 Bacteria 1532
37 Ga0070711_100257980 3300005439 Unclassified 1370
38 Ga0070663_100446509 3300005455 Unclassified 1065
39 Ga0070681_10457599 3300005458 Bacteria 1188
40 Ga0070679_100572218 3300005530 Bacteria 1073
41 Ga0070679_100967128 3300005530 Unclassified 795
42 Ga0070684_101795119 3300005535 Unclassified 579
43 Ga0068853_100052284 3300005539 Bacteria 3519
44 Ga0070695_101455902 3300005545 Unclassified 569
45 Ga0070696_101113161 3300005546 Unclassified 664
46 Ga0070665_100000058 3300005548 Bacteria 225040
47 Ga0070665_100008989 3300005548 Bacteria 10119
48 Ga0070665_100044568 3300005548 Bacteria 4454
49 Ga0070665_100507216 3300005548 Bacteria 1218
50 Ga0070665_100688637 3300005548 Bacteria 1035
51 Ga0070665_101605502 3300005548 Bacteria 658
52 Ga0068855_100231143 3300005563 Bacteria 2071
53 Ga0068855_101147316 3300005563 Bacteria 810
54 Ga0068857_100705847 3300005577 Unclassified 959
55 Ga0068854_101977902 3300005578 Bacteria 537
56 Ga0068856_100188698 3300005614 Bacteria 2075
57 Ga0068856_100301687 3300005614 Unclassified 1619
58 Ga0068852_100090496 3300005616 Bacteria 2737
59 Ga0068864_102299944 3300005618 Unclassified 545
60 Ga0068866_10506908 3300005718 Unclassified 799
61 Ga0068851_10506196 3300005834 Unclassified 725
62 Ga0068863_100211850 3300005841 Bacteria 1866
63 Ga0068858_100423079 3300005842 Unclassified 1281
64 Ga0068860_100640461 3300005843 Bacteria 1070
65 Ga0068860_101097615 3300005843 Bacteria 815
66 Ga0068860_102614244 3300005843 Bacteria 524
67 Ga0068862_100150978 3300005844 Bacteria 2068
68 Ga0068862_100852124 3300005844 Bacteria 893
69 Ga0070717_11223885 3300006028 Unclassified 683
70 Ga0075362_10728765 3300006177 Bacteria 518
71 Ga0097621_100171479 3300006237 Unclassified 1870
72 Ga0075370_10743520 3300006353 Bacteria 597
73 Ga0068871_100174099 3300006358 Bacteria 1846
74 Ga0075430_100252585 3300006846 Bacteria 1461
75 Ga0075431_100770508 3300006847 Bacteria 937
76 Ga0068865_100019187 3300006881 Bacteria 4423
77 Ga0105240_10102294 3300009093 Bacteria 3482
78 Ga0105240_10713898 3300009093 Bacteria 1093
79 Ga0111539_13223784 3300009094 Bacteria 526
80 Ga0105245_10144761 3300009098 Bacteria 2242
81 Ga0105245_10230238 3300009098 Bacteria 1792
82 Ga0105247_10694880 3300009101 Unclassified 765
83 Ga0114129_10123997 3300009147 Bacteria 3553
84 Ga0105242_11157255 3300009176 Unclassified 791
85 Ga0105248_10494111 3300009177 Bacteria 1379
86 Ga0105237_10080325 3300009545 Bacteria 3251
87 Ga0105237_10187257 3300009545 Bacteria 2070
88 Ga0105238_10011751 3300009551 Bacteria 8825
89 Ga0105238_10017103 3300009551 Bacteria 7360
90 Ga0105238_10078245 3300009551 Bacteria 3298
91 Ga0105238_10242343 3300009551 Bacteria 1781
92 Ga0105238_11011140 3300009551 Bacteria 852
93 Ga0105249_10329695 3300009553 Bacteria 1540
94 Ga0099796_10296124 3300010159 Bacteria 684
95 Ga0105239_10170453 3300010375 Bacteria 2434
96 Ga0105239_10483008 3300010375 Bacteria 1408
97 Ga0157371_11255609 3300013102 Bacteria 572
98 Ga0157370_10077198 3300013104 Bacteria 3138
99 Ga0157369_10099012 3300013105 Bacteria 3108
100 Ga0157374_10200125 3300013296 Bacteria 1956
101 Ga0157378_10035460 3300013297 Bacteria 4412
102 Ga0157378_12396353 3300013297 Bacteria 580
103 Ga0163162_10028457 3300013306 Bacteria 5530
104 Ga0163162_11586149 3300013306 Unclassified 746
105 Ga0157372_10469438 3300013307 Bacteria 1467
106 Ga0157375_10579921 3300013308 Unclassified 1282
107 Ga0157375_11863979 3300013308 Unclassified 713
108 Ga0157379_11197777 3300014968 Bacteria 730
109 Ga0157376_11901214 3300014969 Bacteria 632
110 Ga0213874_10210143 3300021377 Bacteria 703
111 Ga0213876_10000998 3300021384 Bacteria 18468
112 Ga0213876_10006721 3300021384 Bacteria 6279
113 Ga0213875_10084571 3300021388 Bacteria 1480
114 Ga0209436_102967 3300025208 Bacteria 4731
115 Ga0209673_1109180 3300025273 Bacteria 582
116 Ga0209130_1000034 3300025284 Bacteria 302439
117 Ga0209675_1045882 3300025291 Bacteria 927
118 Ga0209676_1001813 3300025292 Bacteria 17850
119 Ga0209564_1000013 3300025295 Bacteria 775755
120 Ga0209050_1002022 3300025298 Bacteria 18857
121 Ga0209256_1007486 3300025299 Bacteria 5367
122 Ga0207426_1000006 3300025302 Bacteria 1025969
123 Ga0209051_1003936 3300025303 Bacteria 9464
124 Ga0209257_1002648 3300025304 Bacteria 17217
125 Ga0207680_10000710 3300025903 Bacteria 15636
126 Ga0207680_10227369 3300025903 Bacteria 1281
127 Ga0207647_10154350 3300025904 Bacteria 1341
128 Ga0207705_10000008 3300025909 Bacteria 589717
129 Ga0207705_10488565 3300025909 Bacteria 956
130 Ga0207705_10554207 3300025909 Bacteria 894
131 Ga0207707_10701193 3300025912 Bacteria 850
132 Ga0207695_10068242 3300025913 Bacteria 3643
133 Ga0207695_10381469 3300025913 Bacteria 1295
134 Ga0207695_10809465 3300025913 Bacteria 817
135 Ga0207671_10264916 3300025914 Bacteria 1353
136 Ga0207657_10000231 3300025919 Bacteria 58585
137 Ga0207657_10325448 3300025919 Bacteria 1215
138 Ga0207649_10125241 3300025920 Unclassified 1738
139 Ga0207649_11463584 3300025920 Unclassified 541
140 Ga0207652_10354588 3300025921 Bacteria 1324
141 Ga0207694_10022510 3300025924 Bacteria 4782
142 Ga0207694_10050626 3300025924 Bacteria 3218
143 Ga0207694_10056540 3300025924 Bacteria 3047
144 Ga0207694_10059428 3300025924 Bacteria 2973
145 Ga0207687_11623518 3300025927 Bacteria 555
146 Ga0207690_10606606 3300025932 Bacteria 894
147 Ga0207704_10269050 3300025938 Bacteria 1289
148 Ga0207711_10229164 3300025941 Bacteria 1701
149 Ga0207711_11645206 3300025941 Unclassified 585
150 Ga0207689_11335229 3300025942 Bacteria 602
151 Ga0207667_10541015 3300025949 Bacteria 1178
152 Ga0207667_11017854 3300025949 Bacteria 815
153 Ga0207651_10197685 3300025960 Bacteria 1609
154 Ga0207712_10168726 3300025961 Bacteria 1708
155 Ga0207658_12035957 3300025986 Unclassified 522
156 Ga0207703_10684947 3300026035 Bacteria 974
157 Ga0207639_10000095 3300026041 Bacteria 74687
158 Ga0207702_10275885 3300026078 Bacteria 1587
159 Ga0207702_10576630 3300026078 Unclassified 1102
160 Ga0207641_10173132 3300026088 Bacteria 1972
161 Ga0207698_10043178 3300026142 Bacteria 3376
162 Ga0268266_10000005 3300028379 Bacteria 1448194
163 Ga0268266_10012790 3300028379 Bacteria 7250
164 Ga0268266_10069460 3300028379 Bacteria 3052
165 Ga0268266_11154843 3300028379 Bacteria 749
166 Ga0268265_10491625 3300028380 Bacteria 1154
167 Ga0268265_11064727 3300028380 Bacteria 801
168 Ga0268265_11254438 3300028380 Unclassified 740
169 Ga0268265_11329478 3300028380 Unclassified 719
170 Ga0268264_11194051 3300028381 Bacteria 770
171 Ga0268264_11403096 3300028381 Bacteria 709
172 Ga0265318_10000054 3300028577 Bacteria 114645
173 Ga0265338_10245280 3300028800 Bacteria 1324
174 Ga0307408_100863360 3300031548 Bacteria 826
175 Ga0307405_10204039 3300031731 Bacteria 1438
176 Ga0307405_10279655 3300031731 Bacteria 1255
177 Ga0307405_10563927 3300031731 Bacteria 924
178 Ga0307405_11961913 3300031731 Bacteria 523
179 Ga0307413_10054823 3300031824 Bacteria 2422
180 Ga0307413_10123982 3300031824 Bacteria 1755
181 Ga0307413_10504516 3300031824 Bacteria 972
182 Ga0307413_11016921 3300031824 Bacteria 711
183 Ga0307410_10355756 3300031852 Bacteria 1171
184 Ga0307410_10569426 3300031852 Bacteria 941
185 Ga0307406_10056085 3300031901 Bacteria 2521
186 Ga0307406_11286247 3300031901 Bacteria 638
187 Ga0307406_11297278 3300031901 Bacteria 635
188 Ga0307406_11524742 3300031901 Bacteria 589
189 Ga0307407_10162420 3300031903 Bacteria 1463
190 Ga0307412_10183775 3300031911 Bacteria 1575
191 Ga0307412_10191006 3300031911 Bacteria 1548
192 Ga0307412_10435649 3300031911 Bacteria 1076
193 Ga0307412_10835614 3300031911 Bacteria 802
194 Ga0307409_100047122 3300031995 Bacteria 3269
195 Ga0307409_100437741 3300031995 Bacteria 1259
196 Ga0307409_100638379 3300031995 Unclassified 1057
197 Ga0307409_101759033 3300031995 Bacteria 649
198 Ga0307416_100055725 3300032002 Bacteria 3186
199 Ga0307416_100176104 3300032002 Bacteria 1998
200 Ga0307416_100359937 3300032002 Bacteria 1477
201 Ga0307416_100405596 3300032002 Bacteria 1402
202 Ga0307416_100468939 3300032002 Bacteria 1316
203 Ga0307416_100501054 3300032002 Bacteria 1279
204 Ga0307416_100659309 3300032002 Bacteria 1132
205 Ga0307414_10606038 3300032004 Bacteria 983
206 Ga0307414_10762990 3300032004 Bacteria 880
207 Ga0307414_11462460 3300032004 Bacteria 636
208 Ga0307411_10116969 3300032005 Bacteria 1920
209 Ga0307411_10171471 3300032005 Bacteria 1637
210 Ga0307411_10180057 3300032005 Bacteria 1603
211 Ga0307411_11048076 3300032005 Bacteria 732
212 Ga0307411_11081850 3300032005 Bacteria 722
213 Ga0307415_100203153 3300032126 Bacteria 1574
214 Ga0307415_102557018 3300032126 Bacteria 503
215 Ga0373945_0113176 3300035116 Bacteria 1072
216 Ga0373954_0171763 3300035118 Bacteria 1062
217 Ga0373931_0974328 3300035691 Bacteria 573
218 Ga0373927_0067935 3300035695 Bacteria 2306
219 Ga0373927_0672543 3300035695 Bacteria 684
220 Ga0373947_0260535 3300035725 Bacteria 1149
221 Ga0373947_0424104 3300035725 Unclassified 899
222 Ga0373937_0214891 3300036401 Unclassified 1810
223 Ga0373937_0567788 3300036401 Bacteria 1078
224 Ga0373925_0609296 3300037068 Bacteria 899
225 Ga0395899_0002702 3300037312 Bacteria 14300
226 Ga0395899_0187039 3300037312 Bacteria 1451
227 Ga0395900_0004764 3300037418 Bacteria 14296
228 Ga0395900_0033583 3300037418 Bacteria 5280
229 Ga0395900_0073713 3300037418 Bacteria 3510
230 Ga0395900_0157530 3300037418 Bacteria 2319
231 Ga0395900_0546275 3300037418 Bacteria 1104
232 Ga0395900_1002086 3300037418 Bacteria 755
233 Ga0395898_0009270 3300037466 Bacteria 10352
234 Ga0395905_0002924 3300037471 Bacteria 18610
235 Ga0395905_0005076 3300037471 Bacteria 13547
236 Ga0395905_0188029 3300037471 Bacteria 1938
237 Ga0395905_0188044 3300037471 Bacteria 1938
238 Ga0436364_0091845 3300037853 Bacteria 1853
239 Ga0395901_0004339 3300038443 Bacteria 14311
240 Ga0395901_0573693 3300038443 Bacteria 1141
241 Ga0395901_0861935 3300038443 Bacteria 890
242 Ga0436365_0125993 3300039437 Bacteria 18465
243 Ga0436365_1031309 3300039437 Bacteria 592
244 Ga0436365_1180091 3300039437 Bacteria 18993
245 Ga0436363_0658691 3300039450 Bacteria 1045
246 Ga0436363_0907453 3300039450 Bacteria 508
247 Ga0451807_0272796 3300041486 Bacteria 607
248 Ga0451839_0893853 3300041496 Bacteria 638
249 Ga0451853_0958219 3300041512 Unclassified 1013
250 Ga0451853_3942217 3300041512 Unclassified 929
251 Ga0439431_0112187 3300041997 Bacteria 756
252 Ga0439446_0146775 3300042156 Bacteria 773
253 Ga0439458_0001098 3300042157 Bacteria 6895
254 Ga0439464_0268192 3300042439 Bacteria 554
255 Ga0466963_0760912 3300044694 Unclassified 683
256 Ga0466970_0901027 3300044765 Unclassified 520
257 Ga0466958_0859470 3300045836 Bacteria 592
258 Ga0495580_0004569 3300046472 Bacteria 11616
259 Ga0495654_0244876 3300046530 Unclassified 749
260 Ga0495665_0249053 3300046531 Bacteria 915
261 Ga0495668_0118016 3300046616 Bacteria 1451
262 Ga0495658_0071271 3300046683 Bacteria 2018
263 Ga0495674_0258139 3300047319 Bacteria 1432
264 Ga0495684_0427795 3300047471 Bacteria 924
265 Ga0495686_0311619 3300047472 Bacteria 865
266 Ga0496101_0417106 3300048904 Bacteria 1058
267 Ga0496112_0003289 3300048915 Bacteria 13339
268 Ga0496114_1124788 3300048917 Unclassified 670
269 Ga0496115_0007576 3300048918 Bacteria 7995
270 Ga0501075_1230225 3300049591 Bacteria 568
271 nmdc:mga05p37_223929_c1 3300050507 Bacteria 2269
272 nmdc:mga06r32_521204_c1 3300050510 Bacteria 1164
273 Ga0500635_0171791 3300053080 Unclassified 835
274 Ga0500644_0458255 3300053088 Bacteria 559
275 Ga0500556_0000060 3300053104 Bacteria 112751
276 Ga0500595_007769 3300053119 Bacteria 4427
277 Ga0500652_097019 3300053131 Bacteria 1231
278 Ga0500616_0024097 3300053153 Bacteria 3387
279 Ga0590071_023755 3300059421 Bacteria 1451
280 Ga0590075_003900 3300059424 Bacteria 3534
281 Ga0590075_018646 3300059424 Bacteria 1717

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031824 Ga0307413_10504516 Ga0307413_105045161 91
2 3300031901 Ga0307406_11286247 Ga0307406_112862471 91
3 3300031911 Ga0307412_10835614 Ga0307412_108356141 91
4 3300031995 Ga0307409_100047122 Ga0307409_1000471223 91
5 3300032002 Ga0307416_100055725 Ga0307416_1000557253 91
6 3300032004 Ga0307414_10606038 Ga0307414_106060382 91
7 3300032005 Ga0307411_10116969 Ga0307411_101169693 91
8 3300032126 Ga0307415_102557018 Ga0307415_1025570181 91
9 3300041486 Ga0451807_0272796 Ga0451807_0272796_313_594 93
10 3300009545 Ga0105237_10187257 Ga0105237_101872573 94
11 3300025914 Ga0207671_10264916 Ga0207671_102649162 94
12 3300053088 Ga0500644_0458255 Ga0500644_0458255_43_393 95
13 3300013297 Ga0157378_12396353 Ga0157378_123963531 96
14 3300025912 Ga0207707_10701193 Ga0207707_107011932 98
15 3300005356 Ga0070674_100783691 Ga0070674_1007836911 99
16 3300005844 Ga0068862_100852124 Ga0068862_1008521242 100
17 3300028380 Ga0268265_11329478 Ga0268265_113294781 100
18 3300049591 Ga0501075_1230225 Ga0501075_1230225_28_330 100
19 3300002987 JGI25159J45721_1000040 JGI25159J45721_100004042 101
20 3300003354 JGI25160J50197_1000128 JGI25160J50197_100012839 101
21 3300003374 JGI25161J50226_1000996 JGI25161J50226_100099613 101
22 3300003771 Ga0055526_1001311 Ga0055526_10013114 101
23 3300003775 Ga0055524_1078340 Ga0055524_10783401 101
24 3300003781 Ga0055536_1002507 Ga0055536_10025076 101
25 3300003791 Ga0055530_10032143 Ga0055530_100321432 101
26 3300003792 Ga0055540_1044053 Ga0055540_10440532 101
27 3300004625 Ga0055543_1000130 Ga0055543_100013039 101
28 3300005262 Ga0065165_1000013 Ga0065165_1000013260 101
29 3300025208 Ga0209436_102967 Ga0209436_1029673 101
30 3300025273 Ga0209673_1109180 Ga0209673_11091801 101
31 3300025284 Ga0209130_1000034 Ga0209130_1000034251 101
32 3300025292 Ga0209676_1001813 Ga0209676_10018138 101
33 3300025295 Ga0209564_1000013 Ga0209564_1000013250 101
34 3300025298 Ga0209050_1002022 Ga0209050_10020226 101
35 3300025299 Ga0209256_1007486 Ga0209256_10074864 101
36 3300025302 Ga0207426_1000006 Ga0207426_1000006624 101
37 3300025303 Ga0209051_1003936 Ga0209051_10039365 101
38 3300025304 Ga0209257_1002648 Ga0209257_100264811 101
39 3300028577 Ga0265318_10000054 Ga0265318_1000005462 101
40 3300053104 Ga0500556_0000060 Ga0500556_0000060_59140_59445 101
41 iso_pu_bacteria 2599185352 2600194304 101
42 iso_pu_bacteria 2643221610 2644063545 101
43 iso_pu_bacteria 2643221675 2644414308 101
44 iso_pu_bacteria 2643221680 2644447836 101
45 iso_pu_bacteria 2643221723 2644676170 101
46 iso_pu_bacteria 2643221726 2644690309 101
47 3300005334 Ga0068869_101922934 Ga0068869_1019229341 102
48 3300005335 Ga0070666_10021868 Ga0070666_100218686 102
49 3300005355 Ga0070671_100704629 Ga0070671_1007046292 102
50 3300005367 Ga0070667_100267318 Ga0070667_1002673181 102
51 3300005439 Ga0070711_100257980 Ga0070711_1002579801 102
52 3300005545 Ga0070695_101455902 Ga0070695_1014559021 102
53 3300005548 Ga0070665_100044568 Ga0070665_1000445684 102
54 3300005614 Ga0068856_100301687 Ga0068856_1003016874 102
55 3300005843 Ga0068860_100640461 Ga0068860_1006404612 102
56 3300006237 Ga0097621_100171479 Ga0097621_1001714791 102
57 3300006353 Ga0075370_10743520 Ga0075370_107435202 102
58 3300006358 Ga0068871_100174099 Ga0068871_1001740991 102
59 3300006881 Ga0068865_100019187 Ga0068865_1000191873 102
60 3300009093 Ga0105240_10713898 Ga0105240_107138982 102
61 3300009098 Ga0105245_10230238 Ga0105245_102302382 102
62 3300009101 Ga0105247_10694880 Ga0105247_106948801 102
63 3300009176 Ga0105242_11157255 Ga0105242_111572552 102
64 3300009177 Ga0105248_10494111 Ga0105248_104941112 102
65 3300009545 Ga0105237_10080325 Ga0105237_100803256 102
66 3300010159 Ga0099796_10296124 Ga0099796_102961241 102
67 3300010375 Ga0105239_10483008 Ga0105239_104830082 102
68 3300013296 Ga0157374_10200125 Ga0157374_102001252 102
69 3300013297 Ga0157378_10035460 Ga0157378_100354603 102
70 3300013306 Ga0163162_10028457 Ga0163162_100284576 102
71 3300013308 Ga0157375_10579921 Ga0157375_105799213 102
72 3300014968 Ga0157379_11197777 Ga0157379_111977771 102
73 3300021388 Ga0213875_10084571 Ga0213875_100845711 102
74 3300025903 Ga0207680_10227369 Ga0207680_102273693 102
75 3300025913 Ga0207695_10809465 Ga0207695_108094652 102
76 3300025938 Ga0207704_10269050 Ga0207704_102690502 102
77 3300025941 Ga0207711_10229164 Ga0207711_102291643 102
78 3300025986 Ga0207658_12035957 Ga0207658_120359571 102
79 3300026035 Ga0207703_10684947 Ga0207703_106849471 102
80 3300026078 Ga0207702_10576630 Ga0207702_105766302 102
81 3300028379 Ga0268266_10069460 Ga0268266_100694605 102
82 3300028381 Ga0268264_11194051 Ga0268264_111940511 102
83 3300028800 Ga0265338_10245280 Ga0265338_102452801 102
84 3300031903 Ga0307407_10162420 Ga0307407_101624203 102
85 3300032005 Ga0307411_10171471 Ga0307411_101714713 102
86 3300035116 Ga0373945_0113176 Ga0373945_0113176_352_666 102
87 3300035118 Ga0373954_0171763 Ga0373954_0171763_46_360 102
88 3300035691 Ga0373931_0974328 Ga0373931_0974328_162_473 102
89 3300035695 Ga0373927_0067935 Ga0373927_0067935_710_1024 102
90 3300035725 Ga0373947_0424104 Ga0373947_0424104_543_857 102
91 3300036401 Ga0373937_0214891 Ga0373937_0214891_179_493 102
92 3300036401 Ga0373937_0567788 Ga0373937_0567788_491_799 102
93 3300037068 Ga0373925_0609296 Ga0373925_0609296_352_666 102
94 3300037853 Ga0436364_0091845 Ga0436364_0091845_198_506 102
95 3300041496 Ga0451839_0893853 Ga0451839_0893853_57_371 102
96 3300041512 Ga0451853_0958219 Ga0451853_0958219_220_534 102
97 3300046472 Ga0495580_0004569 Ga0495580_0004569_2751_3065 102
98 3300046530 Ga0495654_0244876 Ga0495654_0244876_423_731 102
99 3300046531 Ga0495665_0249053 Ga0495665_0249053_390_704 102
100 3300046683 Ga0495658_0071271 Ga0495658_0071271_1516_1830 102
101 3300047319 Ga0495674_0258139 Ga0495674_0258139_637_951 102
102 3300047471 Ga0495684_0427795 Ga0495684_0427795_254_568 102
103 3300048904 Ga0496101_0417106 Ga0496101_0417106_411_725 102
104 3300048917 Ga0496114_1124788 Ga0496114_1124788_215_529 102
105 3300053080 Ga0500635_0171791 Ga0500635_0171791_386_694 102
106 3300053131 Ga0500652_097019 Ga0500652_097019_55_375 102
107 3300053153 Ga0500616_0024097 Ga0500616_0024097_2533_2841 102
108 3300005841 Ga0068863_100211850 Ga0068863_1002118501 103
109 3300005842 Ga0068858_100423079 Ga0068858_1004230792 103
110 3300005843 Ga0068860_102614244 Ga0068860_1026142441 103
111 3300026088 Ga0207641_10173132 Ga0207641_101731324 103
112 3300031731 Ga0307405_11961913 Ga0307405_119619131 103
113 3300041997 Ga0439431_0112187 Ga0439431_0112187_46_357 103
114 3300042156 Ga0439446_0146775 Ga0439446_0146775_28_339 103
115 3300005548 Ga0070665_100008989 Ga0070665_1000089894 104
116 3300005563 Ga0068855_101147316 Ga0068855_1011473162 104
117 3300006177 Ga0075362_10728765 Ga0075362_107287651 104
118 3300006846 Ga0075430_100252585 Ga0075430_1002525853 104
119 3300006847 Ga0075431_100770508 Ga0075431_1007705083 104
120 3300009093 Ga0105240_10102294 Ga0105240_101022944 104
121 3300009147 Ga0114129_10123997 Ga0114129_101239974 104
122 3300025913 Ga0207695_10068242 Ga0207695_100682424 104
123 3300025942 Ga0207689_11335229 Ga0207689_113352292 104
124 3300025949 Ga0207667_11017854 Ga0207667_110178542 104
125 3300028379 Ga0268266_10012790 Ga0268266_100127904 104
126 3300042439 Ga0439464_0268192 Ga0439464_0268192_178_492 104
127 3300050507 nmdc:mga05p37_223929_c1 nmdc:mga05p37_223929_c1_461_775 104
128 3300050510 nmdc:mga06r32_521204_c1 nmdc:mga06r32_521204_c1_15_329 104
129 3300053119 Ga0500595_007769 Ga0500595_007769_658_972 104
130 3300059424 Ga0590075_018646 Ga0590075_018646_923_1249 104
131 3300002459 JGI24751J29686_10069881 JGI24751J29686_100698811 105
132 3300005331 Ga0070670_101150463 Ga0070670_1011504631 105
133 3300005335 Ga0070666_10001952 Ga0070666_100019524 105
134 3300005548 Ga0070665_101605502 Ga0070665_1016055021 105
135 3300005563 Ga0068855_100231143 Ga0068855_1002311433 105
136 3300006028 Ga0070717_11223885 Ga0070717_112238851 105
137 3300025903 Ga0207680_10000710 Ga0207680_1000071014 105
138 3300025949 Ga0207667_10541015 Ga0207667_105410152 105
139 3300028379 Ga0268266_11154843 Ga0268266_111548432 105
140 3300028380 Ga0268265_11064727 Ga0268265_110647272 105
141 3300046616 Ga0495668_0118016 Ga0495668_0118016_160_477 105
142 3300047472 Ga0495686_0311619 Ga0495686_0311619_123_440 105
143 3300005262 Ga0065165_1012744 Ga0065165_10127443 106
144 3300005327 Ga0070658_10300241 Ga0070658_103002412 106
145 3300005327 Ga0070658_10750144 Ga0070658_107501441 106
146 3300005339 Ga0070660_100561728 Ga0070660_1005617282 106
147 3300005535 Ga0070684_101795119 Ga0070684_1017951192 106
148 3300005548 Ga0070665_100000058 Ga0070665_100000058199 106
149 3300005548 Ga0070665_100688637 Ga0070665_1006886372 106
150 3300009094 Ga0111539_13223784 Ga0111539_132237841 106
151 3300009098 Ga0105245_10144761 Ga0105245_101447612 106
152 3300009551 Ga0105238_10011751 Ga0105238_100117517 106
153 3300009551 Ga0105238_10017103 Ga0105238_100171035 106
154 3300009551 Ga0105238_10242343 Ga0105238_102423432 106
155 3300009551 Ga0105238_11011140 Ga0105238_110111401 106
156 3300014969 Ga0157376_11901214 Ga0157376_119012141 106
157 3300021384 Ga0213876_10006721 Ga0213876_100067215 106
158 3300025909 Ga0207705_10488565 Ga0207705_104885651 106
159 3300025909 Ga0207705_10554207 Ga0207705_105542072 106
160 3300025913 Ga0207695_10381469 Ga0207695_103814692 106
161 3300025919 Ga0207657_10325448 Ga0207657_103254482 106
162 3300025924 Ga0207694_10022510 Ga0207694_100225105 106
163 3300025924 Ga0207694_10050626 Ga0207694_100506263 106
164 3300025924 Ga0207694_10056540 Ga0207694_100565403 106
165 3300025927 Ga0207687_11623518 Ga0207687_116235181 106
166 3300028379 Ga0268266_10000005 Ga0268266_10000005292 106
167 3300032004 Ga0307414_11462460 Ga0307414_114624602 106
168 3300037312 Ga0395899_0002702 Ga0395899_0002702_6237_6557 106
169 3300037312 Ga0395899_0187039 Ga0395899_0187039_455_775 106
170 3300037418 Ga0395900_0004764 Ga0395900_0004764_6216_6536 106
171 3300037418 Ga0395900_0157530 Ga0395900_0157530_750_1070 106
172 3300037466 Ga0395898_0009270 Ga0395898_0009270_3788_4108 106
173 3300037471 Ga0395905_0005076 Ga0395905_0005076_5459_5779 106
174 3300037471 Ga0395905_0188044 Ga0395905_0188044_94_414 106
175 3300038443 Ga0395901_0004339 Ga0395901_0004339_6223_6543 106
176 3300039437 Ga0436365_1180091 Ga0436365_1180091_3818_4150 106
177 3300044765 Ga0466970_0901027 Ga0466970_0901027_112_432 106
178 3300045836 Ga0466958_0859470 Ga0466958_0859470_39_359 106
179 3300048918 Ga0496115_0007576 Ga0496115_0007576_2171_2491 106
180 3300002067 JGI24735J21928_10009360 JGI24735J21928_100093602 107
181 3300005295 Ga0065707_10195528 Ga0065707_101955282 107
182 3300005295 Ga0065707_10400471 Ga0065707_104004712 107
183 3300005327 Ga0070658_10000002 Ga0070658_10000002566 107
184 3300005338 Ga0068868_101099172 Ga0068868_1010991721 107
185 3300005339 Ga0070660_100217977 Ga0070660_1002179772 107
186 3300005339 Ga0070660_100789156 Ga0070660_1007891561 107
187 3300005344 Ga0070661_100092164 Ga0070661_1000921641 107
188 3300005347 Ga0070668_100661858 Ga0070668_1006618582 107
189 3300005353 Ga0070669_100223243 Ga0070669_1002232432 107
190 3300005353 Ga0070669_101864571 Ga0070669_1018645711 107
191 3300005355 Ga0070671_101755064 Ga0070671_1017550641 107
192 3300005364 Ga0070673_100440253 Ga0070673_1004402532 107
193 3300005366 Ga0070659_100961410 Ga0070659_1009614101 107
194 3300005455 Ga0070663_100446509 Ga0070663_1004465092 107
195 3300005458 Ga0070681_10457599 Ga0070681_104575992 107
196 3300005530 Ga0070679_100572218 Ga0070679_1005722182 107
197 3300005530 Ga0070679_100967128 Ga0070679_1009671282 107
198 3300005539 Ga0068853_100052284 Ga0068853_1000522842 107
199 3300005546 Ga0070696_101113161 Ga0070696_1011131612 107
200 3300005548 Ga0070665_100507216 Ga0070665_1005072162 107
201 3300005577 Ga0068857_100705847 Ga0068857_1007058472 107
202 3300005578 Ga0068854_101977902 Ga0068854_1019779021 107
203 3300005614 Ga0068856_100188698 Ga0068856_1001886983 107
204 3300005616 Ga0068852_100090496 Ga0068852_1000904963 107
205 3300005618 Ga0068864_102299944 Ga0068864_1022999441 107
206 3300005718 Ga0068866_10506908 Ga0068866_105069082 107
207 3300005834 Ga0068851_10506196 Ga0068851_105061962 107
208 3300005843 Ga0068860_101097615 Ga0068860_1010976152 107
209 3300005844 Ga0068862_100150978 Ga0068862_1001509782 107
210 3300009551 Ga0105238_10078245 Ga0105238_100782452 107
211 3300009553 Ga0105249_10329695 Ga0105249_103296952 107
212 3300010375 Ga0105239_10170453 Ga0105239_101704532 107
213 3300013102 Ga0157371_11255609 Ga0157371_112556091 107
214 3300013104 Ga0157370_10077198 Ga0157370_100771985 107
215 3300013105 Ga0157369_10099012 Ga0157369_100990125 107
216 3300013306 Ga0163162_11586149 Ga0163162_115861491 107
217 3300013307 Ga0157372_10469438 Ga0157372_104694382 107
218 3300013308 Ga0157375_11863979 Ga0157375_118639792 107
219 3300021377 Ga0213874_10210143 Ga0213874_102101432 107
220 3300021384 Ga0213876_10000998 Ga0213876_100009986 107
221 3300025291 Ga0209675_1045882 Ga0209675_10458822 107
222 3300025904 Ga0207647_10154350 Ga0207647_101543501 107
223 3300025909 Ga0207705_10000008 Ga0207705_10000008224 107
224 3300025919 Ga0207657_10000231 Ga0207657_100002319 107
225 3300025920 Ga0207649_10125241 Ga0207649_101252413 107
226 3300025920 Ga0207649_11463584 Ga0207649_114635841 107
227 3300025921 Ga0207652_10354588 Ga0207652_103545883 107
228 3300025924 Ga0207694_10059428 Ga0207694_100594282 107
229 3300025932 Ga0207690_10606606 Ga0207690_106066062 107
230 3300025941 Ga0207711_11645206 Ga0207711_116452062 107
231 3300025960 Ga0207651_10197685 Ga0207651_101976852 107
232 3300025961 Ga0207712_10168726 Ga0207712_101687263 107
233 3300026041 Ga0207639_10000095 Ga0207639_1000009540 107
234 3300026078 Ga0207702_10275885 Ga0207702_102758851 107
235 3300026142 Ga0207698_10043178 Ga0207698_100431782 107
236 3300028380 Ga0268265_10491625 Ga0268265_104916252 107
237 3300028380 Ga0268265_11254438 Ga0268265_112544382 107
238 3300028381 Ga0268264_11403096 Ga0268264_114030962 107
239 3300031548 Ga0307408_100863360 Ga0307408_1008633602 107
240 3300031731 Ga0307405_10204039 Ga0307405_102040392 107
241 3300031731 Ga0307405_10279655 Ga0307405_102796552 107
242 3300031731 Ga0307405_10563927 Ga0307405_105639272 107
243 3300031824 Ga0307413_10054823 Ga0307413_100548234 107
244 3300031824 Ga0307413_10123982 Ga0307413_101239823 107
245 3300031824 Ga0307413_11016921 Ga0307413_110169212 107
246 3300031852 Ga0307410_10355756 Ga0307410_103557562 107
247 3300031852 Ga0307410_10569426 Ga0307410_105694262 107
248 3300031901 Ga0307406_10056085 Ga0307406_100560852 107
249 3300031901 Ga0307406_11297278 Ga0307406_112972782 107
250 3300031901 Ga0307406_11524742 Ga0307406_115247421 107
251 3300031911 Ga0307412_10183775 Ga0307412_101837752 107
252 3300031911 Ga0307412_10191006 Ga0307412_101910061 107
253 3300031911 Ga0307412_10435649 Ga0307412_104356492 107
254 3300031995 Ga0307409_100437741 Ga0307409_1004377412 107
255 3300031995 Ga0307409_100638379 Ga0307409_1006383791 107
256 3300031995 Ga0307409_101759033 Ga0307409_1017590332 107
257 3300032002 Ga0307416_100176104 Ga0307416_1001761042 107
258 3300032002 Ga0307416_100359937 Ga0307416_1003599371 107
259 3300032002 Ga0307416_100405596 Ga0307416_1004055962 107
260 3300032002 Ga0307416_100468939 Ga0307416_1004689392 107
261 3300032002 Ga0307416_100501054 Ga0307416_1005010542 107
262 3300032002 Ga0307416_100659309 Ga0307416_1006593091 107
263 3300032004 Ga0307414_10762990 Ga0307414_107629901 107
264 3300032005 Ga0307411_10180057 Ga0307411_101800572 107
265 3300032005 Ga0307411_11048076 Ga0307411_110480762 107
266 3300032005 Ga0307411_11081850 Ga0307411_110818501 107
267 3300032126 Ga0307415_100203153 Ga0307415_1002031531 107
268 3300035695 Ga0373927_0672543 Ga0373927_0672543_165_488 107
269 3300035725 Ga0373947_0260535 Ga0373947_0260535_79_402 107
270 3300037418 Ga0395900_0033583 Ga0395900_0033583_2317_2640 107
271 3300037418 Ga0395900_0073713 Ga0395900_0073713_2124_2447 107
272 3300037418 Ga0395900_0546275 Ga0395900_0546275_581_910 107
273 3300037418 Ga0395900_1002086 Ga0395900_1002086_51_374 107
274 3300037471 Ga0395905_0002924 Ga0395905_0002924_10683_11012 107
275 3300037471 Ga0395905_0188029 Ga0395905_0188029_1282_1605 107
276 3300038443 Ga0395901_0573693 Ga0395901_0573693_522_845 107
277 3300038443 Ga0395901_0861935 Ga0395901_0861935_98_421 107
278 3300039437 Ga0436365_0125993 Ga0436365_0125993_4478_4804 107
279 3300039437 Ga0436365_1031309 Ga0436365_1031309_78_419 107
280 3300039450 Ga0436363_0658691 Ga0436363_0658691_329_655 107
281 3300039450 Ga0436363_0907453 Ga0436363_0907453_118_444 107
282 3300041512 Ga0451853_3942217 Ga0451853_3942217_504_851 107
283 3300042157 Ga0439458_0001098 Ga0439458_0001098_6557_6880 107
284 3300044694 Ga0466963_0760912 Ga0466963_0760912_152_475 107
285 3300048915 Ga0496112_0003289 Ga0496112_0003289_1946_2269 107
286 3300059421 Ga0590071_023755 Ga0590071_023755_281_604 107
287 3300059424 Ga0590075_003900 Ga0590075_003900_2450_2773 107

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

10

47

0.96

PF12840

HTH_20

Helix-turn-helix domain

8

47

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1sfu-assembly1.cif.gz_B crystal structure of the viral zalpha domain bound to left-handed z-dna 0.9426 24 67
3cuq-assembly1.cif.gz_B integrated structural and functional model of the human escrt-ii complex 0.93 24 67
4ooi-assembly1.cif.gz_B reduced hlyu from vibrio cholerae n16961 0.9264 3 83
2kko-assembly1.cif.gz_A solution nmr structure of the homodimeric winged helix-turn-helix dna-binding domain (fragment 1-100) mb0332 from mycobacterium bovis, a possible arsr-family transcriptional regulator. northeast structural genomics consortium target mbr242e. 0.9184 2 83
2zme-assembly1.cif.gz_B integrated structural and functional model of the human escrt-ii complex 0.9134 24 67
ID Description Score Start End Superfamily
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9583 8 67 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9582 10 66 1.10.10.10
af_Q4DZU8_467_618_3.30.230.130 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 0.9549 24 67 3.30.230.130
af_P76066_81_136_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9482 24 67 1.10.10.10
1sfuB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9426 24 67 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A3A0DL23-F1-model_v4 ArsR family transcriptional regulator 0.9683 2 70 GO:0003700
AF-A0A0S8API7-F1-model_v4 HTH arsR-type domain-containing protein 0.9629 2 70 GO:0003700
AF-A0A2V3VWL7-F1-model_v4 Regulatory ArsR family protein 0.9569 2 85 GO:0003677
GO:0003700
AF-A0A2M7QV52-F1-model_v4 HTH arsR-type domain-containing protein 0.9547 3 80 GO:0003700
AF-S5AFX2-F1-model_v4 ArsR family transcriptional regulator 0.9522 3 85 GO:0003700

Feature Viewer

pLDDT pTM Quality
87.27 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map