F388036

General Info

Members Datasets Scaffolds Average Seq Length
287 186 574 83

Family's Representative Sequence

Representative Sequence 3300025909|Ga0207705_10311385|Ga0207705_103113853
Length 89
Sequence VEKENKMSDAPRNNTHCSIPDDPDQSTYRFIIVAAKRARQLQGGQRPVLPTSSKKSTVIAMEEARRGLVKYEIQGDVIVPEEIEEPAQF

Samples

Sample ID Description Type Environment
1 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300019161 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300019162 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300019166 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300019176 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300019181 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300019183 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300019188 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300019190 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300019192 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
84 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
89 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300023547 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300023552 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300023660 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300030762 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300030880 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300030886 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
132 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
133 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
134 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
135 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
136 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
137 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
139 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
140 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
141 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
142 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
143 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
156 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
157 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
160 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
165 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
166 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
167 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
168 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
173 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
174 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
177 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 68.99
Metatranscriptomes 31.01
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.35
Rhizosphere 96.17
Stem 0
Stem Tuber 0
Unclassified 35.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207705_10311385 3300025909 Unclassified 1209
2 Ga0058859_11489889 3300004798 Unclassified 574
3 Ga0058863_11345949 3300004799 Bacteria 620
4 Ga0058863_11477529 3300004799 Unclassified 1193
5 Ga0058863_11904543 3300004799 Bacteria 649
6 Ga0058861_11300492 3300004800 Bacteria 522
7 Ga0058861_11692285 3300004800 Unclassified 833
8 Ga0058861_11692662 3300004800 Unclassified 641
9 Ga0058861_12000499 3300004800 Bacteria 793
10 Ga0058861_12059768 3300004800 Bacteria 582
11 Ga0058860_11795563 3300004801 Unclassified 644
12 Ga0058860_12026196 3300004801 Bacteria 575
13 Ga0058862_11833396 3300004803 Unclassified 566
14 Ga0065707_10290159 3300005295 Bacteria 1027
15 Ga0070658_10007012 3300005327 Bacteria 9101
16 Ga0070676_10951168 3300005328 Unclassified 642
17 Ga0070683_100000039 3300005329 Bacteria 119209
18 Ga0070683_100313420 3300005329 Bacteria 1493
19 Ga0068869_100440661 3300005334 Bacteria 1078
20 Ga0070680_100000412 3300005336 Bacteria 29160
21 Ga0070680_100157635 3300005336 Unclassified 1907
22 Ga0070680_100817086 3300005336 Unclassified 803
23 Ga0070660_100316722 3300005339 Bacteria 1281
24 Ga0070671_100341623 3300005355 Bacteria 1277
25 Ga0070709_10503948 3300005434 Bacteria 920
26 Ga0070714_100062984 3300005435 Bacteria 3188
27 Ga0070713_100002563 3300005436 Bacteria 11888
28 Ga0070713_100863940 3300005436 Bacteria 869
29 Ga0070713_100994063 3300005436 Unclassified 809
30 Ga0070711_100093375 3300005439 Bacteria 2173
31 Ga0070705_101290068 3300005440 Unclassified 605
32 Ga0070694_100133128 3300005444 Bacteria 1798
33 Ga0070681_10046047 3300005458 Bacteria 4362
34 Ga0070681_10077579 3300005458 Bacteria 3279
35 Ga0070706_100074757 3300005467 Bacteria 3136
36 Ga0070699_100034470 3300005518 Unclassified 4375
37 Ga0070679_100188670 3300005530 Bacteria 2031
38 Ga0070679_100600458 3300005530 Bacteria 1044
39 Ga0070679_100814971 3300005530 Unclassified 877
40 Ga0070679_101554645 3300005530 Unclassified 609
41 Ga0070684_100000027 3300005535 Bacteria 119209
42 Ga0070684_100558043 3300005535 Bacteria 1063
43 Ga0070684_101562824 3300005535 Bacteria 622
44 Ga0070697_100398080 3300005536 Bacteria 1195
45 Ga0070697_101566521 3300005536 Unclassified 589
46 Ga0068853_100238490 3300005539 Unclassified 1666
47 Ga0070686_100161408 3300005544 Bacteria 1579
48 Ga0070686_101064220 3300005544 Unclassified 666
49 Ga0070695_101515564 3300005545 Unclassified 558
50 Ga0070696_100010976 3300005546 Bacteria 6067
51 Ga0070693_100859312 3300005547 Bacteria 677
52 Ga0070665_100851240 3300005548 Bacteria 925
53 Ga0068855_100005042 3300005563 Bacteria 16117
54 Ga0068855_100061767 3300005563 Bacteria 4377
55 Ga0068855_100099004 3300005563 Bacteria 3358
56 Ga0068856_100373309 3300005614 Bacteria 1445
57 Ga0068856_100525062 3300005614 Unclassified 1205
58 Ga0068852_100007781 3300005616 Bacteria 7845
59 Ga0068859_101277051 3300005617 Bacteria 809
60 Ga0068851_11095020 3300005834 Unclassified 505
61 Ga0070717_10014748 3300006028 Bacteria 6013
62 Ga0070717_10692437 3300006028 Bacteria 926
63 Ga0070716_101041059 3300006173 Unclassified 649
64 Ga0097621_100485636 3300006237 Bacteria 1117
65 Ga0075431_100876619 3300006847 Bacteria 868
66 Ga0075433_11347550 3300006852 Bacteria 618
67 Ga0075434_101306482 3300006871 Unclassified 736
68 Ga0068865_100838082 3300006881 Bacteria 796
69 Ga0075436_100270260 3300006914 Bacteria 1214
70 Ga0097620_101277332 3300006931 Bacteria 809
71 Ga0075435_101629789 3300007076 Bacteria 566
72 Ga0105240_10678541 3300009093 Bacteria 1127
73 Ga0105240_10709444 3300009093 Bacteria 1097
74 Ga0111539_12567296 3300009094 Bacteria 591
75 Ga0105245_10383186 3300009098 Unclassified 1401
76 Ga0105245_10568900 3300009098 Bacteria 1157
77 Ga0105247_10875829 3300009101 Bacteria 691
78 Ga0114129_10449258 3300009147 Bacteria 1691
79 Ga0105243_11274799 3300009148 Bacteria 751
80 Ga0105243_11530174 3300009148 Bacteria 692
81 Ga0105241_10827694 3300009174 Unclassified 855
82 Ga0105241_11816831 3300009174 Unclassified 595
83 Ga0105242_10337807 3300009176 Bacteria 1387
84 Ga0105242_12734701 3300009176 Unclassified 543
85 Ga0105248_13000162 3300009177 Unclassified 538
86 Ga0105237_11905419 3300009545 Unclassified 602
87 Ga0105249_10636802 3300009553 Bacteria 1123
88 Ga0105239_10089340 3300010375 Bacteria 3397
89 Ga0105246_11659842 3300011119 Unclassified 606
90 Ga0157371_11206483 3300013102 Bacteria 583
91 Ga0157370_10000765 3300013104 Bacteria 40244
92 Ga0157369_10001703 3300013105 Bacteria 26778
93 Ga0157369_11362055 3300013105 Bacteria 723
94 Ga0157378_10338544 3300013297 Unclassified 1466
95 Ga0163162_10632059 3300013306 Bacteria 1195
96 Ga0163162_10883996 3300013306 Unclassified 1007
97 Ga0157372_10096570 3300013307 Bacteria 3368
98 Ga0157372_10229059 3300013307 Bacteria 2154
99 Ga0163163_10854975 3300014325 Bacteria 973
100 Ga0157380_12502140 3300014326 Bacteria 582
101 Ga0157380_13025865 3300014326 Unclassified 536
102 Ga0157379_10535176 3300014968 Unclassified 1089
103 Ga0157379_10545377 3300014968 Bacteria 1078
104 Ga0157376_12488305 3300014969 Bacteria 557
105 Ga0157376_12639353 3300014969 Bacteria 542
106 Ga0184602_120723 3300019161 Bacteria 599
107 Ga0184597_115016 3300019162 Unclassified 624
108 Ga0184595_112482 3300019166 Unclassified 619
109 Ga0184596_127687 3300019176 Unclassified 517
110 Ga0184594_117863 3300019181 Unclassified 520
111 Ga0184601_130211 3300019183 Bacteria 627
112 Ga0184599_121524 3300019188 Bacteria 678
113 Ga0184600_111286 3300019190 Bacteria 768
114 Ga0184600_144023 3300019190 Bacteria 631
115 Ga0184603_109381 3300019192 Unclassified 612
116 Ga0197907_10172798 3300020069 Unclassified 673
117 Ga0197907_10419000 3300020069 Unclassified 597
118 Ga0197907_10975632 3300020069 Bacteria 682
119 Ga0197907_11133747 3300020069 Unclassified 1130
120 Ga0206356_11581747 3300020070 Unclassified 1100
121 Ga0206349_1254382 3300020075 Bacteria 694
122 Ga0206355_1106575 3300020076 Unclassified 1139
123 Ga0206355_1230145 3300020076 Bacteria 584
124 Ga0206355_1270959 3300020076 Bacteria 806
125 Ga0206352_10481773 3300020078 Bacteria 562
126 Ga0206352_11263504 3300020078 Unclassified 594
127 Ga0206352_11323239 3300020078 Unclassified 1081
128 Ga0206350_11440540 3300020080 Bacteria 798
129 Ga0206350_11518808 3300020080 Unclassified 866
130 Ga0206354_11466452 3300020081 Bacteria 758
131 Ga0206354_11546799 3300020081 Unclassified 944
132 Ga0206353_10066420 3300020082 Unclassified 685
133 Ga0206353_10126556 3300020082 Unclassified 1009
134 Ga0213874_10442657 3300021377 Unclassified 512
135 Ga0224712_10175360 3300022467 Unclassified 963
136 Ga0224712_10280939 3300022467 Bacteria 775
137 Ga0247554_103044 3300023547 Bacteria 646
138 Ga0247551_102362 3300023552 Unclassified 687
139 Ga0247550_101955 3300023660 Bacteria 685
140 Ga0247553_104149 3300023672 Unclassified 727
141 Ga0207710_10580745 3300025900 Bacteria 585
142 Ga0207705_10142069 3300025909 Bacteria 1793
143 Ga0207707_10099568 3300025912 Bacteria 2540
144 Ga0207707_10289006 3300025912 Bacteria 1419
145 Ga0207671_11196428 3300025914 Unclassified 595
146 Ga0207663_10221031 3300025916 Bacteria 1378
147 Ga0207660_10004984 3300025917 Bacteria 8658
148 Ga0207660_11089740 3300025917 Unclassified 651
149 Ga0207660_11136420 3300025917 Bacteria 636
150 Ga0207657_10288461 3300025919 Bacteria 1302
151 Ga0207652_10247228 3300025921 Bacteria 1608
152 Ga0207652_11138902 3300025921 Bacteria 681
153 Ga0207687_10804910 3300025927 Unclassified 802
154 Ga0207687_10879659 3300025927 Bacteria 766
155 Ga0207700_10003661 3300025928 Bacteria 8960
156 Ga0207700_10478889 3300025928 Bacteria 1100
157 Ga0207664_10402602 3300025929 Unclassified 1217
158 Ga0207686_10660139 3300025934 Bacteria 828
159 Ga0207665_10900731 3300025939 Bacteria 702
160 Ga0207711_10324697 3300025941 Bacteria 1423
161 Ga0207689_11723116 3300025942 Unclassified 519
162 Ga0207661_10000043 3300025944 Bacteria 119208
163 Ga0207661_11140078 3300025944 Unclassified 718
164 Ga0207661_11558432 3300025944 Unclassified 605
165 Ga0207667_10013813 3300025949 Bacteria 9224
166 Ga0207667_10134693 3300025949 Bacteria 2544
167 Ga0207712_10796882 3300025961 Unclassified 830
168 Ga0207640_11419518 3300025981 Bacteria 622
169 Ga0207658_11781579 3300025986 Bacteria 562
170 Ga0207703_11252158 3300026035 Bacteria 713
171 Ga0207702_10174530 3300026078 Bacteria 1974
172 Ga0207702_10463128 3300026078 Unclassified 1232
173 Ga0207702_11226468 3300026078 Bacteria 744
174 Ga0207702_11391318 3300026078 Bacteria 695
175 Ga0207675_101148596 3300026118 Bacteria 797
176 Ga0207698_10006073 3300026142 Bacteria 7514
177 Ga0207698_10179721 3300026142 Bacteria 1873
178 Ga0268264_10830993 3300028381 Bacteria 924
179 Ga0265323_10004038 3300028653 Bacteria 6360
180 Ga0265338_10243404 3300028800 Bacteria 1331
181 Ga0265762_1053323 3300030760 Unclassified 817
182 Ga0265775_110877 3300030762 Unclassified 577
183 Ga0265767_111857 3300030836 Unclassified 596
184 Ga0265766_1015721 3300030863 Bacteria 587
185 Ga0265766_1018465 3300030863 Unclassified 560
186 Ga0265766_1025530 3300030863 Unclassified 506
187 Ga0265777_109274 3300030877 Bacteria 709
188 Ga0265777_110295 3300030877 Unclassified 683
189 Ga0265777_112082 3300030877 Unclassified 648
190 Ga0265777_112917 3300030877 Unclassified 633
191 Ga0265777_119257 3300030877 Bacteria 555
192 Ga0265776_103629 3300030880 Unclassified 759
193 Ga0265772_103830 3300030886 Bacteria 633
194 Ga0265769_114238 3300030888 Bacteria 581
195 Ga0265761_103824 3300030889 Unclassified 752
196 Ga0265761_104527 3300030889 Unclassified 708
197 Ga0265761_108568 3300030889 Unclassified 575
198 Ga0265761_111227 3300030889 Unclassified 526
199 Ga0265773_1022112 3300031018 Unclassified 634
200 Ga0265760_10061120 3300031090 Bacteria 1145
201 Ga0265760_10171829 3300031090 Bacteria 720
202 Ga0265760_10296314 3300031090 Unclassified 572
203 Ga0265760_10337890 3300031090 Unclassified 538
204 Ga0265330_10265144 3300031235 Bacteria 724
205 Ga0265325_10075702 3300031241 Bacteria 1681
206 Ga0265329_10222645 3300031242 Unclassified 625
207 Ga0265331_10047116 3300031250 Bacteria 2075
208 Ga0265327_10199817 3300031251 Bacteria 906
209 Ga0265316_10267722 3300031344 Bacteria 1251
210 Ga0316053_105201 3300032120 Bacteria 821
211 Ga0316053_108963 3300032120 Bacteria 682
212 Ga0316053_115163 3300032120 Bacteria 571
213 Ga0373926_0036061 3300035083 Bacteria 1756
214 Ga0373951_0184425 3300035091 Bacteria 601
215 Ga0373945_0050833 3300035116 Bacteria 1524
216 Ga0373954_0430194 3300035118 Bacteria 653
217 Ga0373956_0612554 3300035119 Bacteria 520
218 Ga0373946_0265033 3300035171 Bacteria 841
219 Ga0373931_0955523 3300035691 Bacteria 578
220 Ga0373935_0007133 3300035692 Bacteria 6672
221 Ga0373935_1018211 3300035692 Bacteria 615
222 Ga0373927_0003105 3300035695 Bacteria 12025
223 Ga0373927_0086129 3300035695 Bacteria 2039
224 Ga0373927_0361063 3300035695 Bacteria 957
225 Ga0373927_1060725 3300035695 Bacteria 534
226 Ga0373947_0007988 3300035725 Bacteria 6102
227 Ga0373947_0118697 3300035725 Bacteria 1679
228 Ga0373947_0834959 3300035725 Bacteria 629
229 Ga0373937_0366300 3300036401 Bacteria 1366
230 Ga0373937_0936943 3300036401 Bacteria 815
231 Ga0265778_024007 3300036457 Bacteria 765
232 Ga0265778_028231 3300036457 Bacteria 718
233 Ga0265778_039879 3300036457 Unclassified 624
234 Ga0265778_041991 3300036457 Unclassified 611
235 Ga0265778_047731 3300036457 Unclassified 581
236 Ga0265778_048480 3300036457 Unclassified 578
237 Ga0265778_055021 3300036457 Unclassified 550
238 Ga0373925_0000269 3300037068 Bacteria 54259
239 Ga0373925_0114287 3300037068 Bacteria 2089
240 Ga0373925_0546932 3300037068 Bacteria 952
241 Ga0373925_0682375 3300037068 Bacteria 847
242 Ga0373925_1703037 3300037068 Unclassified 515
243 Ga0395900_0236404 3300037418 Bacteria 1835
244 Ga0395898_0163135 3300037466 Bacteria 2132
245 Ga0436364_0408985 3300037853 Unclassified 901
246 Ga0436364_1376990 3300037853 Bacteria 617
247 Ga0436365_0123301 3300039437 Bacteria 708
248 Ga0436365_0487049 3300039437 Unclassified 576
249 Ga0436360_0504598 3300039438 Bacteria 521
250 Ga0436360_0897557 3300039438 Unclassified 993
251 Ga0436363_0177624 3300039450 Bacteria 544
252 Ga0436363_1263240 3300039450 Unclassified 512
253 Ga0436362_1215607 3300039453 Bacteria 539
254 Ga0466961_0241678 3300044693 Unclassified 1110
255 Ga0466971_0143394 3300044719 Unclassified 1113
256 Ga0466959_0138836 3300045049 Bacteria 1719
257 Ga0451576_1001624 3300045051 Bacteria 876
258 Ga0466967_0135019 3300045976 Bacteria 2294
259 Ga0466967_0139968 3300045976 Bacteria 2253
260 Ga0495580_0150023 3300046472 Bacteria 1615
261 Ga0495580_0346505 3300046472 Bacteria 1007
262 Ga0495580_0579060 3300046472 Unclassified 743
263 Ga0495580_0590048 3300046472 Bacteria 735
264 Ga0495662_0532844 3300046476 Bacteria 575
265 Ga0495652_0809515 3300046529 Bacteria 623
266 Ga0495586_0324499 3300046535 Bacteria 883
267 Ga0495599_0736938 3300046678 Unclassified 566
268 Ga0495675_0758104 3300047444 Bacteria 540
269 Ga0496109_0464241 3300048912 Bacteria 1196
270 Ga0501047_0320618 3300049581 Bacteria 1390
271 Ga0501080_1410515 3300049742 Bacteria 594
272 Ga0501035_1006687 3300049822 Bacteria 655
273 nmdc:mga05p37_320968_c1 3300050507 Bacteria 1833
274 nmdc:mga0n895_912327_c1 3300050512 Unclassified 863
275 nmdc:mga0a205_596812_c1 3300050515 Bacteria 957
276 Ga0495612_0318210 3300053078 Bacteria 700
277 Ga0587070_190823 3300059491 Unclassified 539
278 Ga0587080_139578 3300059503 Bacteria 553
279 Ga0587086_081498 3300059507 Unclassified 571
280 Ga0587088_053026 3300059508 Unclassified 800
281 Ga0587091_096801 3300059511 Unclassified 686
282 Ga0587092_117101 3300059512 Bacteria 565
283 Ga0587101_105128 3300059623 Bacteria 566
284 Ga0587076_050401 3300059645 Bacteria 809
285 Ga0587076_179220 3300059645 Bacteria 533
286 Ga0587107_104165 3300059652 Unclassified 565
287 Ga0466962_0538575 3300061719 Unclassified 593
288 Ga0207705_10311385
289 Ga0058859_11489889
290 Ga0058863_11345949
291 Ga0058863_11477529
292 Ga0058863_11904543
293 Ga0058861_11300492
294 Ga0058861_11692285
295 Ga0058861_11692662
296 Ga0058861_12000499
297 Ga0058861_12059768
298 Ga0058860_11795563
299 Ga0058860_12026196
300 Ga0058862_11833396
301 Ga0065707_10290159
302 Ga0070658_10007012
303 Ga0070676_10951168
304 Ga0070683_100000039
305 Ga0070683_100313420
306 Ga0068869_100440661
307 Ga0070680_100000412
308 Ga0070680_100157635
309 Ga0070680_100817086
310 Ga0070660_100316722
311 Ga0070671_100341623
312 Ga0070709_10503948
313 Ga0070714_100062984
314 Ga0070713_100002563
315 Ga0070713_100863940
316 Ga0070713_100994063
317 Ga0070711_100093375
318 Ga0070705_101290068
319 Ga0070694_100133128
320 Ga0070681_10046047
321 Ga0070681_10077579
322 Ga0070706_100074757
323 Ga0070699_100034470
324 Ga0070679_100188670
325 Ga0070679_100600458
326 Ga0070679_100814971
327 Ga0070679_101554645
328 Ga0070684_100000027
329 Ga0070684_100558043
330 Ga0070684_101562824
331 Ga0070697_100398080
332 Ga0070697_101566521
333 Ga0068853_100238490
334 Ga0070686_100161408
335 Ga0070686_101064220
336 Ga0070695_101515564
337 Ga0070696_100010976
338 Ga0070693_100859312
339 Ga0070665_100851240
340 Ga0068855_100005042
341 Ga0068855_100061767
342 Ga0068855_100099004
343 Ga0068856_100373309
344 Ga0068856_100525062
345 Ga0068852_100007781
346 Ga0068859_101277051
347 Ga0068851_11095020
348 Ga0070717_10014748
349 Ga0070717_10692437
350 Ga0070716_101041059
351 Ga0097621_100485636
352 Ga0075431_100876619
353 Ga0075433_11347550
354 Ga0075434_101306482
355 Ga0068865_100838082
356 Ga0075436_100270260
357 Ga0097620_101277332
358 Ga0075435_101629789
359 Ga0105240_10678541
360 Ga0105240_10709444
361 Ga0111539_12567296
362 Ga0105245_10383186
363 Ga0105245_10568900
364 Ga0105247_10875829
365 Ga0114129_10449258
366 Ga0105243_11274799
367 Ga0105243_11530174
368 Ga0105241_10827694
369 Ga0105241_11816831
370 Ga0105242_10337807
371 Ga0105242_12734701
372 Ga0105248_13000162
373 Ga0105237_11905419
374 Ga0105249_10636802
375 Ga0105239_10089340
376 Ga0105246_11659842
377 Ga0157371_11206483
378 Ga0157370_10000765
379 Ga0157369_10001703
380 Ga0157369_11362055
381 Ga0157378_10338544
382 Ga0163162_10632059
383 Ga0163162_10883996
384 Ga0157372_10096570
385 Ga0157372_10229059
386 Ga0163163_10854975
387 Ga0157380_12502140
388 Ga0157380_13025865
389 Ga0157379_10535176
390 Ga0157379_10545377
391 Ga0157376_12488305
392 Ga0157376_12639353
393 Ga0184602_120723
394 Ga0184597_115016
395 Ga0184595_112482
396 Ga0184596_127687
397 Ga0184594_117863
398 Ga0184601_130211
399 Ga0184599_121524
400 Ga0184600_111286
401 Ga0184600_144023
402 Ga0184603_109381
403 Ga0197907_10172798
404 Ga0197907_10419000
405 Ga0197907_10975632
406 Ga0197907_11133747
407 Ga0206356_11581747
408 Ga0206349_1254382
409 Ga0206355_1106575
410 Ga0206355_1230145
411 Ga0206355_1270959
412 Ga0206352_10481773
413 Ga0206352_11263504
414 Ga0206352_11323239
415 Ga0206350_11440540
416 Ga0206350_11518808
417 Ga0206354_11466452
418 Ga0206354_11546799
419 Ga0206353_10066420
420 Ga0206353_10126556
421 Ga0213874_10442657
422 Ga0224712_10175360
423 Ga0224712_10280939
424 Ga0247554_103044
425 Ga0247551_102362
426 Ga0247550_101955
427 Ga0247553_104149
428 Ga0207710_10580745
429 Ga0207705_10142069
430 Ga0207707_10099568
431 Ga0207707_10289006
432 Ga0207671_11196428
433 Ga0207663_10221031
434 Ga0207660_10004984
435 Ga0207660_11089740
436 Ga0207660_11136420
437 Ga0207657_10288461
438 Ga0207652_10247228
439 Ga0207652_11138902
440 Ga0207687_10804910
441 Ga0207687_10879659
442 Ga0207700_10003661
443 Ga0207700_10478889
444 Ga0207664_10402602
445 Ga0207686_10660139
446 Ga0207665_10900731
447 Ga0207711_10324697
448 Ga0207689_11723116
449 Ga0207661_10000043
450 Ga0207661_11140078
451 Ga0207661_11558432
452 Ga0207667_10013813
453 Ga0207667_10134693
454 Ga0207712_10796882
455 Ga0207640_11419518
456 Ga0207658_11781579
457 Ga0207703_11252158
458 Ga0207702_10174530
459 Ga0207702_10463128
460 Ga0207702_11226468
461 Ga0207702_11391318
462 Ga0207675_101148596
463 Ga0207698_10006073
464 Ga0207698_10179721
465 Ga0268264_10830993
466 Ga0265323_10004038
467 Ga0265338_10243404
468 Ga0265762_1053323
469 Ga0265775_110877
470 Ga0265767_111857
471 Ga0265766_1015721
472 Ga0265766_1018465
473 Ga0265766_1025530
474 Ga0265777_109274
475 Ga0265777_110295
476 Ga0265777_112082
477 Ga0265777_112917
478 Ga0265777_119257
479 Ga0265776_103629
480 Ga0265772_103830
481 Ga0265769_114238
482 Ga0265761_103824
483 Ga0265761_104527
484 Ga0265761_108568
485 Ga0265761_111227
486 Ga0265773_1022112
487 Ga0265760_10061120
488 Ga0265760_10171829
489 Ga0265760_10296314
490 Ga0265760_10337890
491 Ga0265330_10265144
492 Ga0265325_10075702
493 Ga0265329_10222645
494 Ga0265331_10047116
495 Ga0265327_10199817
496 Ga0265316_10267722
497 Ga0316053_105201
498 Ga0316053_108963
499 Ga0316053_115163
500 Ga0373926_0036061
501 Ga0373951_0184425
502 Ga0373945_0050833
503 Ga0373954_0430194
504 Ga0373956_0612554
505 Ga0373946_0265033
506 Ga0373931_0955523
507 Ga0373935_0007133
508 Ga0373935_1018211
509 Ga0373927_0003105
510 Ga0373927_0086129
511 Ga0373927_0361063
512 Ga0373927_1060725
513 Ga0373947_0007988
514 Ga0373947_0118697
515 Ga0373947_0834959
516 Ga0373937_0366300
517 Ga0373937_0936943
518 Ga0265778_024007
519 Ga0265778_028231
520 Ga0265778_039879
521 Ga0265778_041991
522 Ga0265778_047731
523 Ga0265778_048480
524 Ga0265778_055021
525 Ga0373925_0000269
526 Ga0373925_0114287
527 Ga0373925_0546932
528 Ga0373925_0682375
529 Ga0373925_1703037
530 Ga0395900_0236404
531 Ga0395898_0163135
532 Ga0436364_0408985
533 Ga0436364_1376990
534 Ga0436365_0123301
535 Ga0436365_0487049
536 Ga0436360_0504598
537 Ga0436360_0897557
538 Ga0436363_0177624
539 Ga0436363_1263240
540 Ga0436362_1215607
541 Ga0466961_0241678
542 Ga0466971_0143394
543 Ga0466959_0138836
544 Ga0451576_1001624
545 Ga0466967_0135019
546 Ga0466967_0139968
547 Ga0495580_0150023
548 Ga0495580_0346505
549 Ga0495580_0579060
550 Ga0495580_0590048
551 Ga0495662_0532844
552 Ga0495652_0809515
553 Ga0495586_0324499
554 Ga0495599_0736938
555 Ga0495675_0758104
556 Ga0496109_0464241
557 Ga0501047_0320618
558 Ga0501080_1410515
559 Ga0501035_1006687
560 nmdc:mga05p37_320968_c1
561 nmdc:mga0n895_912327_c1
562 nmdc:mga0a205_596812_c1
563 Ga0495612_0318210
564 Ga0587070_190823
565 Ga0587080_139578
566 Ga0587086_081498
567 Ga0587088_053026
568 Ga0587091_096801
569 Ga0587092_117101
570 Ga0587101_105128
571 Ga0587076_050401
572 Ga0587076_179220
573 Ga0587107_104165
574 Ga0466962_0538575

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01192

RNA_pol_Rpb6

RNA polymerase Rpb6

22

71

0.87

Map