F387898

General Info

Members Datasets Scaffolds Average Seq Length
287 189 574 238

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100056970|Ga0070697_1000569702
Length 266
Sequence VNRRMAALSGDPPIAHRGPGRSSADATGPRFRSFIDLHCHTRFSFDSLASPRSIVRAAAARGLTHLAITDHDRIEGALEARDEAPEGLVVIVGEEIRTADGDLIAAFIERAIEPGMSATETIAAVREQGGLVGIPHPFDRFRGSLLRDTRMASLAPLVDWVEAYNARLLGGGNQQAADFAAANGLPGIAVSDAHSVLEVGVAYTALPGDPSTPAGLLAALSGIELIPGRASVVVRVLTPVAKVIQRARGNGRVARPRDAAGSAGAR

Samples

Sample ID Description Type Environment
1 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
100 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
101 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
102 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
103 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
104 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
105 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
108 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
109 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
110 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
111 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
114 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
115 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
116 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
117 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
118 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
119 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
120 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
121 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
124 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
125 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
126 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
127 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
128 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
129 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
130 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
131 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
132 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
133 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
136 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
137 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
138 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
161 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
162 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
163 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
164 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
165 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
166 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
167 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
168 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
169 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
170 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
173 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
181 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
182 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
183 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
184 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
185 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
186 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
187 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
189 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.92
Rhizosphere 93.38
Stem 0
Stem Tuber 0
Unclassified 10.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070697_100056970 3300005536 Bacteria 3180
2 rootH2_10061950 3300003320 Bacteria 2242
3 Ga0070676_10110070 3300005328 Bacteria 1714
4 Ga0070690_100006052 3300005330 Bacteria 6844
5 Ga0070680_100591821 3300005336 Bacteria 952
6 Ga0070682_100046655 3300005337 Bacteria 2690
7 Ga0070689_100020872 3300005340 Bacteria 4868
8 Ga0070689_100306585 3300005340 Bacteria 1323
9 Ga0070687_100001130 3300005343 Bacteria 9213
10 Ga0070692_10037949 3300005345 Bacteria 2452
11 Ga0070668_100184587 3300005347 Bacteria 1705
12 Ga0070669_100022555 3300005353 Bacteria 4502
13 Ga0070671_100188215 3300005355 Bacteria 1749
14 Ga0070674_100002242 3300005356 Bacteria 10645
15 Ga0070674_100537147 3300005356 Unclassified 979
16 Ga0070673_100018924 3300005364 Bacteria 4936
17 Ga0070688_100005033 3300005365 Bacteria 6921
18 Ga0070688_100196421 3300005365 Bacteria 1409
19 Ga0070659_100015046 3300005366 Bacteria 5787
20 Ga0070710_10378846 3300005437 Bacteria 943
21 Ga0070701_10002027 3300005438 Bacteria 7679
22 Ga0070705_100266070 3300005440 Bacteria 1212
23 Ga0070705_100360520 3300005440 Bacteria 1063
24 Ga0070700_100021560 3300005441 Bacteria 3746
25 Ga0070700_100064088 3300005441 Bacteria 2327
26 Ga0070694_100060415 3300005444 Bacteria 2585
27 Ga0070708_100301500 3300005445 Bacteria 1509
28 Ga0070678_100009562 3300005456 Bacteria 5882
29 Ga0070662_100073606 3300005457 Bacteria 2525
30 Ga0068867_100003110 3300005459 Bacteria 11701
31 Ga0070685_10003033 3300005466 Bacteria 8563
32 Ga0070707_100026008 3300005468 Bacteria 5554
33 Ga0070698_100027748 3300005471 Bacteria 5884
34 Ga0070698_100033599 3300005471 Bacteria 5313
35 Ga0070698_100294079 3300005471 Bacteria 1555
36 Ga0070699_100070802 3300005518 Bacteria 3032
37 Ga0070697_100155585 3300005536 Bacteria 1929
38 Ga0068853_100187857 3300005539 Bacteria 1876
39 Ga0070672_100171960 3300005543 Bacteria 1802
40 Ga0070686_100190181 3300005544 Bacteria 1464
41 Ga0070686_100329405 3300005544 Unclassified 1141
42 Ga0070695_100029684 3300005545 Bacteria 3399
43 Ga0070696_100046303 3300005546 Bacteria 3016
44 Ga0070696_100396448 3300005546 Bacteria 1079
45 Ga0070693_100049012 3300005547 Bacteria 2408
46 Ga0070704_100103186 3300005549 Bacteria 2154
47 Ga0068855_100389549 3300005563 Bacteria 1529
48 Ga0068855_100422956 3300005563 Bacteria 1457
49 Ga0070664_100007312 3300005564 Bacteria 8903
50 Ga0070702_100000577 3300005615 Bacteria 13406
51 Ga0070702_100092782 3300005615 Bacteria 1834
52 Ga0068852_100019907 3300005616 Bacteria 5325
53 Ga0068859_100014014 3300005617 Bacteria 8039
54 Ga0068864_100551429 3300005618 Bacteria 1114
55 Ga0068861_100076008 3300005719 Unclassified 2616
56 Ga0068861_100275361 3300005719 Bacteria 1447
57 Ga0068861_100309115 3300005719 Bacteria 1372
58 Ga0068870_10449205 3300005840 Bacteria 849
59 Ga0068863_100037025 3300005841 Unclassified 4646
60 Ga0068858_100053431 3300005842 Bacteria 3737
61 Ga0068858_100502192 3300005842 Unclassified 1172
62 Ga0068862_100103867 3300005844 Bacteria 2489
63 Ga0068862_100402811 3300005844 Bacteria 1280
64 Ga0081455_10109549 3300005937 Bacteria 2197
65 Ga0075431_100081378 3300006847 Bacteria 3344
66 Ga0075434_100058875 3300006871 Bacteria 3818
67 Ga0075434_100315534 3300006871 Bacteria 1584
68 Ga0075434_100380344 3300006871 Bacteria 1433
69 Ga0068865_100038498 3300006881 Bacteria 3237
70 Ga0097620_100014013 3300006931 Bacteria 8039
71 Ga0105251_10042630 3300009011 Bacteria 2201
72 Ga0111539_10016989 3300009094 Bacteria 9006
73 Ga0105245_10017203 3300009098 Bacteria 6308
74 Ga0105245_10049291 3300009098 Bacteria 3771
75 Ga0105247_10076873 3300009101 Bacteria 2097
76 Ga0114129_10094044 3300009147 Bacteria 4152
77 Ga0114129_10206662 3300009147 Bacteria 2656
78 Ga0114129_11239231 3300009147 Bacteria 927
79 Ga0105243_10015619 3300009148 Bacteria 5740
80 Ga0105242_10041148 3300009176 Bacteria 3726
81 Ga0105248_10053794 3300009177 Unclassified 4516
82 Ga0105249_10017826 3300009553 Bacteria 6309
83 Ga0105239_10143530 3300010375 Unclassified 2661
84 Ga0157378_10050946 3300013297 Bacteria 3684
85 Ga0157378_10157473 3300013297 Bacteria 2121
86 Ga0163162_10146604 3300013306 Bacteria 2477
87 Ga0157375_10011240 3300013308 Bacteria 7899
88 Ga0157375_10862859 3300013308 Unclassified 1051
89 Ga0163163_10012043 3300014325 Bacteria 7871
90 Ga0163163_10427368 3300014325 Bacteria 1384
91 Ga0163163_10522654 3300014325 Bacteria 1249
92 Ga0157380_10007654 3300014326 Bacteria 7682
93 Ga0157380_10038215 3300014326 Bacteria 3726
94 Ga0157380_10379831 3300014326 Bacteria 1333
95 Ga0157379_10408595 3300014968 Bacteria 1249
96 Ga0207688_10260197 3300025901 Bacteria 1053
97 Ga0207643_10000609 3300025908 Bacteria 22613
98 Ga0207681_10361389 3300025923 Bacteria 1164
99 Ga0207694_10441112 3300025924 Bacteria 1086
100 Ga0207650_10045644 3300025925 Bacteria 3224
101 Ga0207644_10160502 3300025931 Bacteria 1747
102 Ga0207706_10024419 3300025933 Bacteria 5419
103 Ga0207706_10031776 3300025933 Bacteria 4702
104 Ga0207686_10021910 3300025934 Bacteria 3674
105 Ga0207670_10024961 3300025936 Bacteria 3744
106 Ga0207669_10091626 3300025937 Bacteria 1980
107 Ga0207704_10075772 3300025938 Bacteria 2153
108 Ga0207691_10015057 3300025940 Bacteria 7360
109 Ga0207711_10157841 3300025941 Bacteria 2051
110 Ga0207689_10362573 3300025942 Bacteria 1205
111 Ga0207661_10119294 3300025944 Bacteria 2243
112 Ga0207679_10020884 3300025945 Bacteria 4429
113 Ga0207667_10344180 3300025949 Bacteria 1521
114 Ga0207651_10467996 3300025960 Bacteria 1084
115 Ga0207712_10126826 3300025961 Bacteria 1939
116 Ga0207703_10040260 3300026035 Bacteria 3739
117 Ga0207678_10012791 3300026067 Bacteria 7369
118 Ga0207708_10002055 3300026075 Bacteria 14820
119 Ga0207708_10041808 3300026075 Bacteria 3494
120 Ga0207641_10415642 3300026088 Bacteria 1294
121 Ga0207641_10587044 3300026088 Unclassified 1090
122 Ga0207648_10016811 3300026089 Bacteria 6671
123 Ga0207676_10062376 3300026095 Bacteria 2956
124 Ga0207674_10029403 3300026116 Bacteria 5785
125 Ga0207675_100152485 3300026118 Bacteria 2200
126 Ga0207675_100264071 3300026118 Bacteria 1669
127 Ga0207675_100339446 3300026118 Bacteria 1470
128 Ga0207683_10029482 3300026121 Bacteria 4751
129 Ga0209974_10009824 3300027876 Unclassified 3239
130 Ga0209974_10146105 3300027876 Bacteria 851
131 Ga0207428_10110637 3300027907 Bacteria 2115
132 Ga0265337_1007197 3300028556 Bacteria 4190
133 Ga0265326_10006042 3300028558 Bacteria 3786
134 Ga0265326_10011374 3300028558 Bacteria 2624
135 Ga0265326_10033801 3300028558 Bacteria 1455
136 Ga0265319_1002383 3300028563 Bacteria 10319
137 Ga0265334_10001910 3300028573 Bacteria 9883
138 Ga0265334_10027949 3300028573 Bacteria 2269
139 Ga0265318_10059962 3300028577 Bacteria 1418
140 Ga0265322_10003252 3300028654 Bacteria 4929
141 Ga0265336_10024237 3300028666 Bacteria 1919
142 Ga0265338_10136842 3300028800 Bacteria 1924
143 Ga0265338_10462750 3300028800 Unclassified 897
144 Ga0265330_10040880 3300031235 Bacteria 2058
145 Ga0265320_10008548 3300031240 Bacteria 6258
146 Ga0265320_10105050 3300031240 Unclassified 1298
147 Ga0265325_10005387 3300031241 Bacteria 7905
148 Ga0265340_10004715 3300031247 Bacteria 7584
149 Ga0265339_10185131 3300031249 Bacteria 1035
150 Ga0265316_10012660 3300031344 Bacteria 7551
151 Ga0265316_10012967 3300031344 Bacteria 7437
152 Ga0265314_10093392 3300031711 Bacteria 1953
153 Ga0265342_10009248 3300031712 Bacteria 6967
154 Ga0316576_10061520 3300031727 Bacteria 2752
155 Ga0316576_10223173 3300031727 Bacteria 1417
156 Ga0316577_10002794 3300031733 Bacteria 8709
157 Ga0307413_10497739 3300031824 Bacteria 978
158 Ga0307410_10116206 3300031852 Bacteria 1944
159 Ga0373948_0057037 3300034817 Unclassified 851
160 Ga0373942_0079118 3300035207 Bacteria 973
161 Ga0316574_0396521 3300035398 Bacteria 869
162 Ga0373937_0400979 3300036401 Unclassified 1301
163 Ga0373937_1109797 3300036401 Unclassified 740
164 Ga0316582_0027944 3300036647 Bacteria 3413
165 Ga0316584_0018810 3300036712 Bacteria 4987
166 Ga0451855_1260441 3300041511 Unclassified 1134
167 Ga0451577_0435583 3300042876 Unclassified 1190
168 Ga0495651_0076930 3300046462 Bacteria 2527
169 Ga0495651_0081000 3300046462 Unclassified 2451
170 Ga0495653_0213716 3300046463 Unclassified 1301
171 Ga0495582_0344078 3300046473 Bacteria 859
172 Ga0495630_0151260 3300046517 Bacteria 1766
173 Ga0495658_0263255 3300046683 Bacteria 1086
174 Ga0495589_0237794 3300046794 Bacteria 853
175 Ga0495600_0060483 3300046809 Bacteria 2474
176 Ga0495674_0039976 3300047319 Bacteria 4199
177 Ga0495674_0274945 3300047319 Unclassified 1381
178 Ga0495680_0086589 3300047322 Bacteria 2357
179 Ga0495684_0077838 3300047471 Unclassified 2517
180 Ga0495602_0094035 3300048088 Bacteria 2479
181 Ga0495602_0376656 3300048088 Unclassified 1018
182 Ga0496101_0154795 3300048904 Bacteria 1755
183 Ga0496104_0061814 3300048907 Bacteria 3551
184 Ga0496105_0047617 3300048908 Bacteria 3538
185 Ga0496105_0084264 3300048908 Bacteria 2626
186 Ga0496106_0022372 3300048909 Bacteria 4695
187 Ga0496106_0831177 3300048909 Bacteria 732
188 Ga0496108_0044174 3300048911 Bacteria 3720
189 Ga0496108_0173968 3300048911 Bacteria 1863
190 Ga0496109_0051970 3300048912 Bacteria 3733
191 Ga0496109_0554186 3300048912 Bacteria 1084
192 Ga0496110_0136056 3300048913 Bacteria 2220
193 Ga0496111_0263564 3300048914 Bacteria 1279
194 Ga0496112_0013312 3300048915 Bacteria 7594
195 Ga0496112_0193921 3300048915 Bacteria 1993
196 Ga0496112_0534550 3300048915 Unclassified 1107
197 Ga0496112_0553873 3300048915 Unclassified 1084
198 Ga0496114_0074267 3300048917 Bacteria 2862
199 Ga0501031_0487876 3300049568 Unclassified 795
200 Ga0501032_0383163 3300049569 Bacteria 904
201 Ga0501033_0123475 3300049570 Bacteria 1878
202 Ga0501033_0186514 3300049570 Bacteria 1486
203 Ga0501036_0099867 3300049572 Bacteria 2455
204 Ga0501036_0140563 3300049572 Bacteria 2038
205 Ga0501036_0246805 3300049572 Bacteria 1496
206 Ga0501036_0663091 3300049572 Bacteria 863
207 Ga0501038_0068204 3300049574 Bacteria 3024
208 Ga0501038_0157887 3300049574 Bacteria 1845
209 Ga0501039_0038752 3300049575 Bacteria 3680
210 Ga0501039_0072626 3300049575 Bacteria 2673
211 Ga0501039_0167981 3300049575 Bacteria 1725
212 Ga0501040_0027341 3300049576 Bacteria 3840
213 Ga0501040_0050576 3300049576 Bacteria 2843
214 Ga0501040_0140645 3300049576 Unclassified 1700
215 Ga0501041_0020067 3300049577 Bacteria 3992
216 Ga0501041_0078386 3300049577 Bacteria 2033
217 Ga0501041_0092445 3300049577 Bacteria 1868
218 Ga0501041_0174642 3300049577 Bacteria 1344
219 Ga0501042_0369729 3300049578 Bacteria 1037
220 Ga0501043_0181844 3300049579 Bacteria 1638
221 Ga0501046_0057152 3300049580 Bacteria 3061
222 Ga0501046_0150514 3300049580 Bacteria 1756
223 Ga0501048_0091373 3300049582 Bacteria 2147
224 Ga0501048_0602492 3300049582 Unclassified 789
225 Ga0501067_0008193 3300049583 Bacteria 5802
226 Ga0501068_0092319 3300049584 Bacteria 1869
227 Ga0501069_0038915 3300049585 Bacteria 2626
228 Ga0501069_0051110 3300049585 Bacteria 2300
229 Ga0501069_0229460 3300049585 Bacteria 1080
230 Ga0501071_0064082 3300049587 Bacteria 2666
231 Ga0501072_0076143 3300049588 Bacteria 2654
232 Ga0501072_0102467 3300049588 Bacteria 2275
233 Ga0501072_0175137 3300049588 Bacteria 1711
234 Ga0501072_0190037 3300049588 Bacteria 1638
235 Ga0501072_0655804 3300049588 Archaea 826
236 Ga0501073_0138705 3300049589 Bacteria 1685
237 Ga0501074_0039717 3300049590 Bacteria 3408
238 Ga0501074_0054810 3300049590 Bacteria 2875
239 Ga0501074_0223432 3300049590 Bacteria 1340
240 Ga0501075_0034261 3300049591 Bacteria 3781
241 Ga0501075_0040303 3300049591 Bacteria 3497
242 Ga0501075_0067657 3300049591 Bacteria 2697
243 Ga0501075_0239397 3300049591 Bacteria 1383
244 Ga0501075_0472654 3300049591 Archaea 956
245 Ga0501076_0050637 3300049592 Bacteria 3286
246 Ga0501076_0066027 3300049592 Bacteria 2887
247 Ga0501076_0175870 3300049592 Bacteria 1744
248 Ga0501076_0318648 3300049592 Bacteria 1275
249 Ga0501076_0433311 3300049592 Archaea 1082
250 Ga0501077_0020307 3300049593 Bacteria 4204
251 Ga0501077_0191117 3300049593 Bacteria 1301
252 Ga0501079_0026822 3300049741 Bacteria 4417
253 Ga0501079_0145239 3300049741 Bacteria 1849
254 Ga0501079_0163245 3300049741 Bacteria 1737
255 Ga0501080_0289436 3300049742 Bacteria 1488
256 Ga0501080_0462282 3300049742 Unclassified 1137
257 Ga0501080_0537824 3300049742 Bacteria 1042
258 Ga0501081_0021495 3300049743 Bacteria 4307
259 Ga0501081_0159962 3300049743 Bacteria 1622
260 Ga0501083_0096160 3300049744 Bacteria 1954
261 Ga0501035_0582689 3300049822 Bacteria 913
262 Ga0501044_0888993 3300049823 Bacteria 766
263 Ga0501045_0069144 3300049824 Bacteria 2595
264 Ga0501045_0175031 3300049824 Bacteria 1599
265 nmdc:mga05p37_119261_c1 3300050507 Bacteria 3241
266 nmdc:mga06r32_38969_c1 3300050510 Bacteria 4505
267 nmdc:mga08y16_531568_c1 3300050511 Bacteria 1192
268 nmdc:mga0n895_228747_c1 3300050512 Bacteria 1888
269 nmdc:mga0rr50_312956_c1 3300050513 Bacteria 1315
270 nmdc:mga0rr50_579380_c1 3300050513 Bacteria 956
271 Ga0495601_0054537 3300053077 Bacteria 2529
272 Ga0495601_0244141 3300053077 Unclassified 1172
273 Ga0495619_0004454 3300053085 Bacteria 8939
274 Ga0501084_0065537 3300054114 Bacteria 3039
275 Ga0501084_0166932 3300054114 Bacteria 1858
276 Ga0501084_0270177 3300054114 Bacteria 1435
277 Ga0501084_0441031 3300054114 Bacteria 1101
278 Ga0501084_0659198 3300054114 Unclassified 883
279 Ga0590071_008067 3300059421 Bacteria 2487
280 Ga0590074_006854 3300059423 Bacteria 1892
281 Ga0590077_003444 3300059426 Unclassified 3276
282 Ga0501082_0149102 3300060353 Bacteria 2031
283 Ga0501082_0159427 3300060353 Bacteria 1960
284 Ga0530510_0080619 3300061734 Bacteria 2369
285 Ga0530510_0113183 3300061734 Bacteria 1989
286 Ga0530510_0113738 3300061734 Bacteria 1983
287 Ga0530510_0238712 3300061734 Bacteria 1353
288 Ga0070697_100056970
289 rootH2_10061950
290 Ga0070676_10110070
291 Ga0070690_100006052
292 Ga0070680_100591821
293 Ga0070682_100046655
294 Ga0070689_100020872
295 Ga0070689_100306585
296 Ga0070687_100001130
297 Ga0070692_10037949
298 Ga0070668_100184587
299 Ga0070669_100022555
300 Ga0070671_100188215
301 Ga0070674_100002242
302 Ga0070674_100537147
303 Ga0070673_100018924
304 Ga0070688_100005033
305 Ga0070688_100196421
306 Ga0070659_100015046
307 Ga0070710_10378846
308 Ga0070701_10002027
309 Ga0070705_100266070
310 Ga0070705_100360520
311 Ga0070700_100021560
312 Ga0070700_100064088
313 Ga0070694_100060415
314 Ga0070708_100301500
315 Ga0070678_100009562
316 Ga0070662_100073606
317 Ga0068867_100003110
318 Ga0070685_10003033
319 Ga0070707_100026008
320 Ga0070698_100027748
321 Ga0070698_100033599
322 Ga0070698_100294079
323 Ga0070699_100070802
324 Ga0070697_100155585
325 Ga0068853_100187857
326 Ga0070672_100171960
327 Ga0070686_100190181
328 Ga0070686_100329405
329 Ga0070695_100029684
330 Ga0070696_100046303
331 Ga0070696_100396448
332 Ga0070693_100049012
333 Ga0070704_100103186
334 Ga0068855_100389549
335 Ga0068855_100422956
336 Ga0070664_100007312
337 Ga0070702_100000577
338 Ga0070702_100092782
339 Ga0068852_100019907
340 Ga0068859_100014014
341 Ga0068864_100551429
342 Ga0068861_100076008
343 Ga0068861_100275361
344 Ga0068861_100309115
345 Ga0068870_10449205
346 Ga0068863_100037025
347 Ga0068858_100053431
348 Ga0068858_100502192
349 Ga0068862_100103867
350 Ga0068862_100402811
351 Ga0081455_10109549
352 Ga0075431_100081378
353 Ga0075434_100058875
354 Ga0075434_100315534
355 Ga0075434_100380344
356 Ga0068865_100038498
357 Ga0097620_100014013
358 Ga0105251_10042630
359 Ga0111539_10016989
360 Ga0105245_10017203
361 Ga0105245_10049291
362 Ga0105247_10076873
363 Ga0114129_10094044
364 Ga0114129_10206662
365 Ga0114129_11239231
366 Ga0105243_10015619
367 Ga0105242_10041148
368 Ga0105248_10053794
369 Ga0105249_10017826
370 Ga0105239_10143530
371 Ga0157378_10050946
372 Ga0157378_10157473
373 Ga0163162_10146604
374 Ga0157375_10011240
375 Ga0157375_10862859
376 Ga0163163_10012043
377 Ga0163163_10427368
378 Ga0163163_10522654
379 Ga0157380_10007654
380 Ga0157380_10038215
381 Ga0157380_10379831
382 Ga0157379_10408595
383 Ga0207688_10260197
384 Ga0207643_10000609
385 Ga0207681_10361389
386 Ga0207694_10441112
387 Ga0207650_10045644
388 Ga0207644_10160502
389 Ga0207706_10024419
390 Ga0207706_10031776
391 Ga0207686_10021910
392 Ga0207670_10024961
393 Ga0207669_10091626
394 Ga0207704_10075772
395 Ga0207691_10015057
396 Ga0207711_10157841
397 Ga0207689_10362573
398 Ga0207661_10119294
399 Ga0207679_10020884
400 Ga0207667_10344180
401 Ga0207651_10467996
402 Ga0207712_10126826
403 Ga0207703_10040260
404 Ga0207678_10012791
405 Ga0207708_10002055
406 Ga0207708_10041808
407 Ga0207641_10415642
408 Ga0207641_10587044
409 Ga0207648_10016811
410 Ga0207676_10062376
411 Ga0207674_10029403
412 Ga0207675_100152485
413 Ga0207675_100264071
414 Ga0207675_100339446
415 Ga0207683_10029482
416 Ga0209974_10009824
417 Ga0209974_10146105
418 Ga0207428_10110637
419 Ga0265337_1007197
420 Ga0265326_10006042
421 Ga0265326_10011374
422 Ga0265326_10033801
423 Ga0265319_1002383
424 Ga0265334_10001910
425 Ga0265334_10027949
426 Ga0265318_10059962
427 Ga0265322_10003252
428 Ga0265336_10024237
429 Ga0265338_10136842
430 Ga0265338_10462750
431 Ga0265330_10040880
432 Ga0265320_10008548
433 Ga0265320_10105050
434 Ga0265325_10005387
435 Ga0265340_10004715
436 Ga0265339_10185131
437 Ga0265316_10012660
438 Ga0265316_10012967
439 Ga0265314_10093392
440 Ga0265342_10009248
441 Ga0316576_10061520
442 Ga0316576_10223173
443 Ga0316577_10002794
444 Ga0307413_10497739
445 Ga0307410_10116206
446 Ga0373948_0057037
447 Ga0373942_0079118
448 Ga0316574_0396521
449 Ga0373937_0400979
450 Ga0373937_1109797
451 Ga0316582_0027944
452 Ga0316584_0018810
453 Ga0451855_1260441
454 Ga0451577_0435583
455 Ga0495651_0076930
456 Ga0495651_0081000
457 Ga0495653_0213716
458 Ga0495582_0344078
459 Ga0495630_0151260
460 Ga0495658_0263255
461 Ga0495589_0237794
462 Ga0495600_0060483
463 Ga0495674_0039976
464 Ga0495674_0274945
465 Ga0495680_0086589
466 Ga0495684_0077838
467 Ga0495602_0094035
468 Ga0495602_0376656
469 Ga0496101_0154795
470 Ga0496104_0061814
471 Ga0496105_0047617
472 Ga0496105_0084264
473 Ga0496106_0022372
474 Ga0496106_0831177
475 Ga0496108_0044174
476 Ga0496108_0173968
477 Ga0496109_0051970
478 Ga0496109_0554186
479 Ga0496110_0136056
480 Ga0496111_0263564
481 Ga0496112_0013312
482 Ga0496112_0193921
483 Ga0496112_0534550
484 Ga0496112_0553873
485 Ga0496114_0074267
486 Ga0501031_0487876
487 Ga0501032_0383163
488 Ga0501033_0123475
489 Ga0501033_0186514
490 Ga0501036_0099867
491 Ga0501036_0140563
492 Ga0501036_0246805
493 Ga0501036_0663091
494 Ga0501038_0068204
495 Ga0501038_0157887
496 Ga0501039_0038752
497 Ga0501039_0072626
498 Ga0501039_0167981
499 Ga0501040_0027341
500 Ga0501040_0050576
501 Ga0501040_0140645
502 Ga0501041_0020067
503 Ga0501041_0078386
504 Ga0501041_0092445
505 Ga0501041_0174642
506 Ga0501042_0369729
507 Ga0501043_0181844
508 Ga0501046_0057152
509 Ga0501046_0150514
510 Ga0501048_0091373
511 Ga0501048_0602492
512 Ga0501067_0008193
513 Ga0501068_0092319
514 Ga0501069_0038915
515 Ga0501069_0051110
516 Ga0501069_0229460
517 Ga0501071_0064082
518 Ga0501072_0076143
519 Ga0501072_0102467
520 Ga0501072_0175137
521 Ga0501072_0190037
522 Ga0501072_0655804
523 Ga0501073_0138705
524 Ga0501074_0039717
525 Ga0501074_0054810
526 Ga0501074_0223432
527 Ga0501075_0034261
528 Ga0501075_0040303
529 Ga0501075_0067657
530 Ga0501075_0239397
531 Ga0501075_0472654
532 Ga0501076_0050637
533 Ga0501076_0066027
534 Ga0501076_0175870
535 Ga0501076_0318648
536 Ga0501076_0433311
537 Ga0501077_0020307
538 Ga0501077_0191117
539 Ga0501079_0026822
540 Ga0501079_0145239
541 Ga0501079_0163245
542 Ga0501080_0289436
543 Ga0501080_0462282
544 Ga0501080_0537824
545 Ga0501081_0021495
546 Ga0501081_0159962
547 Ga0501083_0096160
548 Ga0501035_0582689
549 Ga0501044_0888993
550 Ga0501045_0069144
551 Ga0501045_0175031
552 nmdc:mga05p37_119261_c1
553 nmdc:mga06r32_38969_c1
554 nmdc:mga08y16_531568_c1
555 nmdc:mga0n895_228747_c1
556 nmdc:mga0rr50_312956_c1
557 nmdc:mga0rr50_579380_c1
558 Ga0495601_0054537
559 Ga0495601_0244141
560 Ga0495619_0004454
561 Ga0501084_0065537
562 Ga0501084_0166932
563 Ga0501084_0270177
564 Ga0501084_0441031
565 Ga0501084_0659198
566 Ga0590071_008067
567 Ga0590074_006854
568 Ga0590077_003444
569 Ga0501082_0149102
570 Ga0501082_0159427
571 Ga0530510_0080619
572 Ga0530510_0113183
573 Ga0530510_0113738
574 Ga0530510_0238712

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13263

PHP_C

PHP-associated

170

222

0.96

PF02811

PHP

PHP domain

36

131

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2anu-assembly1.cif.gz_A crystal structure of predicted metal-dependent phosphoesterase (php family) (tm0559) from thermotoga maritima at 2.40 a resolution 0.7749 6 212
3bic-assembly1.cif.gz_A crystal structure of human methylmalonyl-coa mutase 0.7709 23 64
2anu-assembly2.cif.gz_F crystal structure of predicted metal-dependent phosphoesterase (php family) (tm0559) from thermotoga maritima at 2.40 a resolution 0.7632 6 212
2anu-assembly1.cif.gz_C crystal structure of predicted metal-dependent phosphoesterase (php family) (tm0559) from thermotoga maritima at 2.40 a resolution 0.7581 6 212
3e38-assembly1.cif.gz_B crystal structure of a two-domain protein containing predicted php-like metal-dependent phosphoesterase (bvu_3505) from bacteroides vulgatus atcc 8482 at 2.20 a resolution 0.747 3 211
ID Description Score Start End Superfamily
af_Q57860_1_200_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7927 8 229 3.20.20.140
af_Q57860_1_200_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7815 8 229 3.20.20.140
af_Q54IG4_130_328_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7785 1 177 3.20.20.140
af_Q58982_1_166_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7777 9 165 3.20.20.140
3e0fA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7698 9 177 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A536BX07-F1-model_v4 PHP domain-containing protein 0.9854 5 87 GO:0004534
GO:0035312
AF-O27522-F1-model_v4 Conserved protein 0.9578 7 119 GO:0004534
GO:0035312
AF-A0A2I0QHE6-F1-model_v4 Polymerase/histidinol phosphatase N-terminal domain-containing protein 0.9534 7 112 GO:0004534
GO:0035312
AF-A0A534KXS9-F1-model_v4 PHP domain-containing protein 0.9526 7 99 GO:0004534
GO:0035312
AF-A0A536BX07-F1-model_v4 PHP domain-containing protein 0.9515 5 87 GO:0004534
GO:0035312

Map