F387740

General Info

Members Datasets Scaffolds Average Seq Length
286 188 572 148

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2883577096|2883580351
Length 164
Sequence TKAKAGTPPAPTIPAIPPADVLGRLAALKTTGTPDLKQQWRELFAAEPPPYNRRFLESRLAYRIQELAYGGLKPETIQRLEALGEQLDGGNPVLRRIRGDDKPITGTRLIREYQGVEHSVTVLHDGYEYQGRPYQSLSSIARAITGTRWNGWLFFGLKNRRGTA

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
3 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
97 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
98 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
99 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
102 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
107 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
108 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
109 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
110 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
111 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
112 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
113 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
114 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
115 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
116 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
117 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
118 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
119 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
120 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
121 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
122 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
126 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
127 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
131 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
132 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
133 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
146 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
151 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
152 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
153 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
159 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
160 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
164 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
165 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
166 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
167 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
168 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
169 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
170 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
171 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
172 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
173 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
174 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
175 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
176 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
177 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
178 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
179 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
180 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
181 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
182 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
183 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
184 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
185 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
186 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
187 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
188 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.1
Metatranscriptomes 0
Isolates 4.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.29
Nodule 2.8
Rhizoplane 5.59
Rhizosphere 75.17
Stem 0
Stem Tuber 0
Unclassified 1.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100418034 3300005336 Bacteria 1144
2 Ga0068868_101344054 3300005338 Bacteria 665
3 Ga0070671_100405779 3300005355 Bacteria 1166
4 Ga0070671_100442409 3300005355 Bacteria 1115
5 Ga0070671_101551011 3300005355 Bacteria 587
6 Ga0070674_100764754 3300005356 Bacteria 831
7 Ga0070673_100767002 3300005364 Bacteria 889
8 Ga0070709_10199794 3300005434 Bacteria 1415
9 Ga0070714_100717828 3300005435 Bacteria 965
10 Ga0070714_101023261 3300005435 Bacteria 804
11 Ga0070713_100006883 3300005436 Bacteria 7929
12 Ga0070713_100164074 3300005436 Bacteria 1985
13 Ga0070710_10006288 3300005437 Bacteria 5692
14 Ga0070711_100031818 3300005439 Bacteria 3505
15 Ga0070663_100785915 3300005455 Bacteria 815
16 Ga0070678_100789962 3300005456 Bacteria 861
17 Ga0070681_10005458 3300005458 Bacteria 12284
18 Ga0070706_100005750 3300005467 Bacteria 11777
19 Ga0070706_101845135 3300005467 Bacteria 549
20 Ga0070707_100590146 3300005468 Bacteria 1073
21 Ga0070698_100334947 3300005471 Bacteria 1444
22 Ga0070699_100683871 3300005518 Bacteria 937
23 Ga0070679_100017555 3300005530 Bacteria 6925
24 Ga0070679_100066265 3300005530 Bacteria 3599
25 Ga0070679_101826773 3300005530 Bacteria 556
26 Ga0070684_100271297 3300005535 Unclassified 1553
27 Ga0068853_100791420 3300005539 Bacteria 908
28 Ga0070695_100910647 3300005545 Bacteria 711
29 Ga0070696_100881753 3300005546 Bacteria 741
30 Ga0070665_100015498 3300005548 Bacteria 7658
31 Ga0070665_100557663 3300005548 Bacteria 1158
32 Ga0068855_100420710 3300005563 Bacteria 1461
33 Ga0068855_100811503 3300005563 Bacteria 994
34 Ga0070664_100294667 3300005564 Bacteria 1465
35 Ga0068856_101120460 3300005614 Bacteria 804
36 Ga0068852_101079054 3300005616 Bacteria 823
37 Ga0068859_100108795 3300005617 Bacteria 2833
38 Ga0068859_100970225 3300005617 Bacteria 933
39 Ga0068864_100962798 3300005618 Bacteria 845
40 Ga0068858_101204786 3300005842 Bacteria 744
41 Ga0068860_101450749 3300005843 Bacteria 708
42 Ga0081455_10380108 3300005937 Bacteria 987
43 Ga0070717_10015688 3300006028 Bacteria 5856
44 Ga0070717_11814758 3300006028 Bacteria 551
45 Ga0075365_10000179 3300006038 Bacteria 20618
46 Ga0075365_10007098 3300006038 Bacteria 6246
47 Ga0075365_10071117 3300006038 Bacteria 2342
48 Ga0075365_10156947 3300006038 Bacteria 1584
49 Ga0075365_10198918 3300006038 Bacteria 1404
50 Ga0075368_10096375 3300006042 Bacteria 1213
51 Ga0075363_100048733 3300006048 Bacteria 2254
52 Ga0075364_10016941 3300006051 Bacteria 4541
53 Ga0070716_100037914 3300006173 Bacteria 2666
54 Ga0070716_100405191 3300006173 Bacteria 982
55 Ga0070712_100017006 3300006175 Bacteria 4702
56 Ga0075362_10040187 3300006177 Bacteria 2059
57 Ga0075367_10000364 3300006178 Bacteria 16321
58 Ga0075367_10139412 3300006178 Bacteria 1502
59 Ga0075369_10013108 3300006186 Bacteria 3283
60 Ga0097621_102365491 3300006237 Bacteria 508
61 Ga0068871_101651245 3300006358 Bacteria 607
62 Ga0075431_100469575 3300006847 Bacteria 1252
63 Ga0075433_11908889 3300006852 Bacteria 509
64 Ga0097620_100108790 3300006931 Bacteria 2833
65 Ga0097620_100970202 3300006931 Bacteria 933
66 Ga0099794_10191457 3300007265 Bacteria 1046
67 Ga0105240_11107250 3300009093 Bacteria 842
68 Ga0105245_11073194 3300009098 Bacteria 851
69 Ga0105245_11341417 3300009098 Bacteria 765
70 Ga0105247_10452965 3300009101 Bacteria 925
71 Ga0114129_10928572 3300009147 Bacteria 1101
72 Ga0114129_12957774 3300009147 Bacteria 560
73 Ga0105243_11413200 3300009148 Unclassified 717
74 Ga0105242_11039385 3300009176 Bacteria 829
75 Ga0105248_10431908 3300009177 Bacteria 1483
76 Ga0105237_10773532 3300009545 Bacteria 967
77 Ga0105238_10143097 3300009551 Bacteria 2368
78 Ga0105238_11456946 3300009551 Bacteria 713
79 Ga0105249_11052647 3300009553 Bacteria 883
80 Ga0105239_10241863 3300010375 Bacteria 2026
81 Ga0105239_10396510 3300010375 Bacteria 1561
82 Ga0105239_11011318 3300010375 Bacteria 956
83 Ga0105239_11206862 3300010375 Bacteria 872
84 Ga0105239_12961114 3300010375 Bacteria 554
85 Ga0105246_10059721 3300011119 Bacteria 2646
86 Ga0105246_11025900 3300011119 Bacteria 748
87 Ga0157374_10013534 3300013296 Bacteria 7122
88 Ga0157378_10692058 3300013297 Bacteria 1038
89 Ga0163162_10026839 3300013306 Bacteria 5694
90 Ga0163162_10782635 3300013306 Bacteria 1072
91 Ga0157372_10016416 3300013307 Bacteria 7945
92 Ga0163163_10037428 3300014325 Bacteria 4720
93 Ga0163163_11068627 3300014325 Bacteria 870
94 Ga0157376_10927628 3300014969 Bacteria 890
95 Ga0213876_10007537 3300021384 Bacteria 5911
96 Ga0207692_10003731 3300025898 Bacteria 5983
97 Ga0207685_10040598 3300025905 Bacteria 1735
98 Ga0207699_10015112 3300025906 Bacteria 4004
99 Ga0207684_10024332 3300025910 Bacteria 5164
100 Ga0207684_10600642 3300025910 Bacteria 940
101 Ga0207707_10009518 3300025912 Bacteria 8428
102 Ga0207707_10468225 3300025912 Bacteria 1077
103 Ga0207693_10017886 3300025915 Bacteria 5651
104 Ga0207663_10022572 3300025916 Bacteria 3600
105 Ga0207660_10126786 3300025917 Bacteria 1939
106 Ga0207657_10214624 3300025919 Bacteria 1543
107 Ga0207657_10448700 3300025919 Bacteria 1012
108 Ga0207652_10015523 3300025921 Bacteria 6194
109 Ga0207652_11481612 3300025921 Bacteria 582
110 Ga0207681_10147452 3300025923 Bacteria 1760
111 Ga0207694_10158567 3300025924 Bacteria 1827
112 Ga0207687_10149569 3300025927 Bacteria 1780
113 Ga0207687_10508367 3300025927 Bacteria 1006
114 Ga0207700_10005962 3300025928 Bacteria 7333
115 Ga0207700_10012569 3300025928 Bacteria 5468
116 Ga0207664_10287333 3300025929 Bacteria 1444
117 Ga0207644_10676900 3300025931 Bacteria 860
118 Ga0207690_10609113 3300025932 Bacteria 892
119 Ga0207709_11245929 3300025935 Bacteria 614
120 Ga0207669_11717320 3300025937 Bacteria 536
121 Ga0207704_10312932 3300025938 Bacteria 1208
122 Ga0207689_10517314 3300025942 Bacteria 1001
123 Ga0207679_10512369 3300025945 Bacteria 1072
124 Ga0207667_10433876 3300025949 Bacteria 1336
125 Ga0207667_10664188 3300025949 Bacteria 1047
126 Ga0207658_10693945 3300025986 Bacteria 920
127 Ga0207708_11114163 3300026075 Bacteria 688
128 Ga0207683_10887868 3300026121 Bacteria 828
129 Ga0209813_10184789 3300027866 Bacteria 764
130 Ga0268266_10010727 3300028379 Bacteria 7984
131 Ga0268266_10501187 3300028379 Bacteria 1159
132 Ga0268266_11639357 3300028379 Bacteria 619
133 Ga0265316_10264333 3300031344 Bacteria 1261
134 Ga0307513_10139627 3300031456 Bacteria 2352
135 Ga0316576_10100665 3300031727 Bacteria 2160
136 Ga0316578_10560447 3300031728 Bacteria 671
137 Ga0307416_100666327 3300032002 Bacteria 1127
138 Ga0307414_11313689 3300032004 Unclassified 671
139 Ga0316584_0485860 3300036712 Bacteria 869
140 Ga0436365_0311586 3300039437 Bacteria 34611
141 Ga0436362_0708495 3300039453 Bacteria 646
142 Ga0451576_0073825 3300045051 Bacteria 3550
143 Ga0495617_192965 3300046452 Bacteria 638
144 Ga0495603_0138741 3300046455 Bacteria 1415
145 Ga0495590_0027495 3300046457 Bacteria 1995
146 Ga0495638_0006367 3300046460 Bacteria 8599
147 Ga0495638_0472788 3300046460 Bacteria 636
148 Ga0495584_0198780 3300046491 Bacteria 1019
149 Ga0495606_0141019 3300046507 Bacteria 1423
150 Ga0495610_0033697 3300046512 Bacteria 2645
151 Ga0495632_0212544 3300046519 Bacteria 877
152 Ga0495643_0047923 3300046522 Bacteria 2312
153 Ga0495597_0088398 3300046542 Bacteria 1318
154 Ga0495668_0026897 3300046616 Bacteria 3262
155 Ga0495649_0008555 3300046694 Bacteria 6149
156 Ga0495589_0177615 3300046794 Bacteria 1011
157 Ga0495673_0137824 3300047469 Bacteria 954
158 Ga0495686_0222939 3300047472 Bacteria 1072
159 Ga0496100_1136915 3300048903 Bacteria 616
160 Ga0496100_1689524 3300048903 Bacteria 501
161 Ga0496101_1032602 3300048904 Bacteria 646
162 Ga0496102_0022903 3300048905 Bacteria 5540
163 Ga0496104_0018636 3300048907 Bacteria 6335
164 Ga0496105_0686522 3300048908 Bacteria 787
165 Ga0496107_0108320 3300048910 Bacteria 2040
166 Ga0496107_1149284 3300048910 Bacteria 560
167 Ga0496109_0444987 3300048912 Bacteria 1224
168 Ga0496112_0009690 3300048915 Bacteria 8695
169 Ga0496112_0111551 3300048915 Bacteria 2704
170 Ga0496114_0638633 3300048917 Bacteria 937
171 Ga0496115_0028529 3300048918 Bacteria 4376
172 Ga0496115_0116222 3300048918 Bacteria 2200
173 Ga0496115_0781234 3300048918 Bacteria 745
174 Ga0496115_1249120 3300048918 Bacteria 556
175 Ga0496121_0172072 3300048924 Bacteria 1572
176 Ga0496126_0514780 3300048929 Bacteria 954
177 Ga0496126_1090474 3300048929 Bacteria 594
178 Ga0501031_0949501 3300049568 Bacteria 550
179 Ga0501032_0312291 3300049569 Bacteria 1015
180 Ga0501033_0001494 3300049570 Bacteria 20697
181 Ga0501033_0820024 3300049570 Bacteria 628
182 Ga0501034_0006416 3300049571 Bacteria 12669
183 Ga0501034_0030026 3300049571 Bacteria 5526
184 Ga0501034_0131365 3300049571 Bacteria 2487
185 Ga0501034_0159262 3300049571 Bacteria 2230
186 Ga0501034_0252008 3300049571 Bacteria 1710
187 Ga0501034_0575155 3300049571 Bacteria 1034
188 Ga0501036_0049648 3300049572 Bacteria 3553
189 Ga0501036_0348587 3300049572 Bacteria 1236
190 Ga0501036_0709933 3300049572 Bacteria 831
191 Ga0501037_0217639 3300049573 Bacteria 1345
192 Ga0501037_0936562 3300049573 Bacteria 566
193 Ga0501038_0001140 3300049574 Bacteria 24106
194 Ga0501038_0158963 3300049574 Bacteria 1838
195 Ga0501038_0375084 3300049574 Bacteria 1104
196 Ga0501039_0320892 3300049575 Bacteria 1218
197 Ga0501039_0337533 3300049575 Bacteria 1184
198 Ga0501043_0113262 3300049579 Bacteria 2130
199 Ga0501046_0000053 3300049580 Bacteria 131462
200 Ga0501046_0326397 3300049580 Bacteria 1117
201 Ga0501047_0004603 3300049581 Bacteria 12975
202 Ga0501047_0038859 3300049581 Bacteria 4603
203 Ga0501047_0038913 3300049581 Bacteria 4600
204 Ga0501047_0331334 3300049581 Bacteria 1361
205 Ga0501047_0433277 3300049581 Bacteria 1145
206 Ga0501047_1144940 3300049581 Bacteria 591
207 Ga0501048_0225564 3300049582 Bacteria 1329
208 Ga0501048_0811896 3300049582 Bacteria 672
209 Ga0501067_0006101 3300049583 Bacteria 6682
210 Ga0501067_0044472 3300049583 Bacteria 2467
211 Ga0501067_0079763 3300049583 Bacteria 1814
212 Ga0501069_0047845 3300049585 Bacteria 2374
213 Ga0501070_0064282 3300049586 Bacteria 3039
214 Ga0501071_0891369 3300049587 Bacteria 686
215 Ga0501072_0098750 3300049588 Bacteria 2321
216 Ga0501072_0659090 3300049588 Bacteria 824
217 Ga0501073_0070210 3300049589 Bacteria 2440
218 Ga0501073_0593067 3300049589 Bacteria 765
219 Ga0501074_0185524 3300049590 Bacteria 1483
220 Ga0501076_0918464 3300049592 Bacteria 722
221 Ga0501077_0026947 3300049593 Bacteria 3649
222 Ga0501077_0092167 3300049593 Bacteria 1920
223 Ga0501080_0015264 3300049742 Bacteria 7080
224 Ga0501080_0040585 3300049742 Bacteria 4340
225 Ga0501080_0109034 3300049742 Bacteria 2566
226 Ga0501080_0311645 3300049742 Bacteria 1426
227 Ga0501083_0000105 3300049744 Bacteria 56997
228 Ga0501083_0000657 3300049744 Bacteria 22406
229 Ga0501083_0010405 3300049744 Bacteria 6547
230 Ga0501083_0172200 3300049744 Bacteria 1415
231 Ga0501083_0317360 3300049744 Bacteria 1013
232 Ga0501083_0494282 3300049744 Bacteria 796
233 Ga0501035_0035089 3300049822 Bacteria 4554
234 Ga0501035_0355386 3300049822 Bacteria 1225
235 Ga0501035_0691967 3300049822 Bacteria 823
236 Ga0501044_0013303 3300049823 Bacteria 8907
237 Ga0501044_0121359 3300049823 Bacteria 2614
238 Ga0501044_0205825 3300049823 Bacteria 1924
239 Ga0501044_1620407 3300049823 Bacteria 512
240 nmdc:mga03683_124905_c1 3300050489 Bacteria 1147
241 nmdc:mga0yw44_1502_c1 3300050492 Bacteria 9308
242 nmdc:mga0yw44_165828_c1 3300050492 Bacteria 1448
243 nmdc:mga0yw44_240022_c1 3300050492 Bacteria 1204
244 nmdc:mga0yw44_373_c1 3300050492 Bacteria 15558
245 nmdc:mga0yw44_71494_c1 3300050492 Bacteria 2154
246 nmdc:mga06z11_1271_c1 3300050494 Bacteria 9345
247 nmdc:mga06z11_435251_c1 3300050494 Bacteria 791
248 nmdc:mga05p37_1475430_c1 3300050507 Bacteria 679
249 nmdc:mga06r32_486854_c1 3300050510 Bacteria 1211
250 nmdc:mga0sz30_2930_c1 3300050516 Bacteria 6115
251 Ga0500578_0268399 3300053086 Bacteria 1022
252 Ga0500566_0332262 3300053094 Bacteria 703
253 Ga0500554_264393 3300053102 Unclassified 564
254 Ga0500594_0041941 3300053118 Bacteria 1256
255 Ga0500595_157510 3300053119 Bacteria 633
256 Ga0500658_0041150 3300053134 Bacteria 1853
257 Ga0500604_0001606 3300053151 Bacteria 6345
258 Ga0500604_0048182 3300053151 Bacteria 1308
259 Ga0500616_0000046 3300053153 Bacteria 333409
260 Ga0500616_0022205 3300053153 Bacteria 3547
261 Ga0500616_0059217 3300053153 Bacteria 1989
262 Ga0500627_0003659 3300053158 Bacteria 4804
263 Ga0500627_0168182 3300053158 Bacteria 988
264 Ga0500627_0207848 3300053158 Bacteria 876
265 Ga0500633_0271443 3300053160 Bacteria 628
266 Ga0500636_0377618 3300053177 Bacteria 666
267 Ga0501084_0004790 3300054114 Bacteria 11063
268 Ga0501084_0014989 3300054114 Bacteria 6427
269 Ga0501084_0331411 3300054114 Bacteria 1285
270 Ga0501082_0011848 3300060353 Bacteria 7494
271 Ga0501082_0012362 3300060353 Bacteria 7338
272 Ga0501082_0154839 3300060353 Bacteria 1991
273 2883580351 2883577096 Bacteria 4709178
274 2643770126 2643221550 Bacteria 4619371
275 2643774158 2643221550 Bacteria 4619371
276 2874168802 2874168670 Bacteria 8062617
277 2882457518 2882456835 Bacteria 6863978
278 2935916577 2935908558 Bacteria 8568796
279 2935934060 2935926038 Bacteria 8601059
280 2935942536 2935934488 Bacteria 8602579
281 2935950978 2935942939 Bacteria 8599779
282 2935959437 2935951376 Bacteria 8602333
283 2935975506 2935967501 Bacteria 8603075
284 8019695868 8019687851 Bacteria 8712826
285 8055227139 8055225921 Bacteria 3341787
286 8055227433 8055225921 Bacteria 3341787
287 Ga0070680_100418034
288 Ga0068868_101344054
289 Ga0070671_100405779
290 Ga0070671_100442409
291 Ga0070671_101551011
292 Ga0070674_100764754
293 Ga0070673_100767002
294 Ga0070709_10199794
295 Ga0070714_100717828
296 Ga0070714_101023261
297 Ga0070713_100006883
298 Ga0070713_100164074
299 Ga0070710_10006288
300 Ga0070711_100031818
301 Ga0070663_100785915
302 Ga0070678_100789962
303 Ga0070681_10005458
304 Ga0070706_100005750
305 Ga0070706_101845135
306 Ga0070707_100590146
307 Ga0070698_100334947
308 Ga0070699_100683871
309 Ga0070679_100017555
310 Ga0070679_100066265
311 Ga0070679_101826773
312 Ga0070684_100271297
313 Ga0068853_100791420
314 Ga0070695_100910647
315 Ga0070696_100881753
316 Ga0070665_100015498
317 Ga0070665_100557663
318 Ga0068855_100420710
319 Ga0068855_100811503
320 Ga0070664_100294667
321 Ga0068856_101120460
322 Ga0068852_101079054
323 Ga0068859_100108795
324 Ga0068859_100970225
325 Ga0068864_100962798
326 Ga0068858_101204786
327 Ga0068860_101450749
328 Ga0081455_10380108
329 Ga0070717_10015688
330 Ga0070717_11814758
331 Ga0075365_10000179
332 Ga0075365_10007098
333 Ga0075365_10071117
334 Ga0075365_10156947
335 Ga0075365_10198918
336 Ga0075368_10096375
337 Ga0075363_100048733
338 Ga0075364_10016941
339 Ga0070716_100037914
340 Ga0070716_100405191
341 Ga0070712_100017006
342 Ga0075362_10040187
343 Ga0075367_10000364
344 Ga0075367_10139412
345 Ga0075369_10013108
346 Ga0097621_102365491
347 Ga0068871_101651245
348 Ga0075431_100469575
349 Ga0075433_11908889
350 Ga0097620_100108790
351 Ga0097620_100970202
352 Ga0099794_10191457
353 Ga0105240_11107250
354 Ga0105245_11073194
355 Ga0105245_11341417
356 Ga0105247_10452965
357 Ga0114129_10928572
358 Ga0114129_12957774
359 Ga0105243_11413200
360 Ga0105242_11039385
361 Ga0105248_10431908
362 Ga0105237_10773532
363 Ga0105238_10143097
364 Ga0105238_11456946
365 Ga0105249_11052647
366 Ga0105239_10241863
367 Ga0105239_10396510
368 Ga0105239_11011318
369 Ga0105239_11206862
370 Ga0105239_12961114
371 Ga0105246_10059721
372 Ga0105246_11025900
373 Ga0157374_10013534
374 Ga0157378_10692058
375 Ga0163162_10026839
376 Ga0163162_10782635
377 Ga0157372_10016416
378 Ga0163163_10037428
379 Ga0163163_11068627
380 Ga0157376_10927628
381 Ga0213876_10007537
382 Ga0207692_10003731
383 Ga0207685_10040598
384 Ga0207699_10015112
385 Ga0207684_10024332
386 Ga0207684_10600642
387 Ga0207707_10009518
388 Ga0207707_10468225
389 Ga0207693_10017886
390 Ga0207663_10022572
391 Ga0207660_10126786
392 Ga0207657_10214624
393 Ga0207657_10448700
394 Ga0207652_10015523
395 Ga0207652_11481612
396 Ga0207681_10147452
397 Ga0207694_10158567
398 Ga0207687_10149569
399 Ga0207687_10508367
400 Ga0207700_10005962
401 Ga0207700_10012569
402 Ga0207664_10287333
403 Ga0207644_10676900
404 Ga0207690_10609113
405 Ga0207709_11245929
406 Ga0207669_11717320
407 Ga0207704_10312932
408 Ga0207689_10517314
409 Ga0207679_10512369
410 Ga0207667_10433876
411 Ga0207667_10664188
412 Ga0207658_10693945
413 Ga0207708_11114163
414 Ga0207683_10887868
415 Ga0209813_10184789
416 Ga0268266_10010727
417 Ga0268266_10501187
418 Ga0268266_11639357
419 Ga0265316_10264333
420 Ga0307513_10139627
421 Ga0316576_10100665
422 Ga0316578_10560447
423 Ga0307416_100666327
424 Ga0307414_11313689
425 Ga0316584_0485860
426 Ga0436365_0311586
427 Ga0436362_0708495
428 Ga0451576_0073825
429 Ga0495617_192965
430 Ga0495603_0138741
431 Ga0495590_0027495
432 Ga0495638_0006367
433 Ga0495638_0472788
434 Ga0495584_0198780
435 Ga0495606_0141019
436 Ga0495610_0033697
437 Ga0495632_0212544
438 Ga0495643_0047923
439 Ga0495597_0088398
440 Ga0495668_0026897
441 Ga0495649_0008555
442 Ga0495589_0177615
443 Ga0495673_0137824
444 Ga0495686_0222939
445 Ga0496100_1136915
446 Ga0496100_1689524
447 Ga0496101_1032602
448 Ga0496102_0022903
449 Ga0496104_0018636
450 Ga0496105_0686522
451 Ga0496107_0108320
452 Ga0496107_1149284
453 Ga0496109_0444987
454 Ga0496112_0009690
455 Ga0496112_0111551
456 Ga0496114_0638633
457 Ga0496115_0028529
458 Ga0496115_0116222
459 Ga0496115_0781234
460 Ga0496115_1249120
461 Ga0496121_0172072
462 Ga0496126_0514780
463 Ga0496126_1090474
464 Ga0501031_0949501
465 Ga0501032_0312291
466 Ga0501033_0001494
467 Ga0501033_0820024
468 Ga0501034_0006416
469 Ga0501034_0030026
470 Ga0501034_0131365
471 Ga0501034_0159262
472 Ga0501034_0252008
473 Ga0501034_0575155
474 Ga0501036_0049648
475 Ga0501036_0348587
476 Ga0501036_0709933
477 Ga0501037_0217639
478 Ga0501037_0936562
479 Ga0501038_0001140
480 Ga0501038_0158963
481 Ga0501038_0375084
482 Ga0501039_0320892
483 Ga0501039_0337533
484 Ga0501043_0113262
485 Ga0501046_0000053
486 Ga0501046_0326397
487 Ga0501047_0004603
488 Ga0501047_0038859
489 Ga0501047_0038913
490 Ga0501047_0331334
491 Ga0501047_0433277
492 Ga0501047_1144940
493 Ga0501048_0225564
494 Ga0501048_0811896
495 Ga0501067_0006101
496 Ga0501067_0044472
497 Ga0501067_0079763
498 Ga0501069_0047845
499 Ga0501070_0064282
500 Ga0501071_0891369
501 Ga0501072_0098750
502 Ga0501072_0659090
503 Ga0501073_0070210
504 Ga0501073_0593067
505 Ga0501074_0185524
506 Ga0501076_0918464
507 Ga0501077_0026947
508 Ga0501077_0092167
509 Ga0501080_0015264
510 Ga0501080_0040585
511 Ga0501080_0109034
512 Ga0501080_0311645
513 Ga0501083_0000105
514 Ga0501083_0000657
515 Ga0501083_0010405
516 Ga0501083_0172200
517 Ga0501083_0317360
518 Ga0501083_0494282
519 Ga0501035_0035089
520 Ga0501035_0355386
521 Ga0501035_0691967
522 Ga0501044_0013303
523 Ga0501044_0121359
524 Ga0501044_0205825
525 Ga0501044_1620407
526 nmdc:mga03683_124905_c1
527 nmdc:mga0yw44_1502_c1
528 nmdc:mga0yw44_165828_c1
529 nmdc:mga0yw44_240022_c1
530 nmdc:mga0yw44_373_c1
531 nmdc:mga0yw44_71494_c1
532 nmdc:mga06z11_1271_c1
533 nmdc:mga06z11_435251_c1
534 nmdc:mga05p37_1475430_c1
535 nmdc:mga06r32_486854_c1
536 nmdc:mga0sz30_2930_c1
537 Ga0500578_0268399
538 Ga0500566_0332262
539 Ga0500554_264393
540 Ga0500594_0041941
541 Ga0500595_157510
542 Ga0500658_0041150
543 Ga0500604_0001606
544 Ga0500604_0048182
545 Ga0500616_0000046
546 Ga0500616_0022205
547 Ga0500616_0059217
548 Ga0500627_0003659
549 Ga0500627_0168182
550 Ga0500627_0207848
551 Ga0500633_0271443
552 Ga0500636_0377618
553 Ga0501084_0004790
554 Ga0501084_0014989
555 Ga0501084_0331411
556 Ga0501082_0011848
557 Ga0501082_0012362
558 Ga0501082_0154839
559 2883580351
560 2643770126
561 2643774158
562 2874168802
563 2882457518
564 2935916577
565 2935934060
566 2935942536
567 2935950978
568 2935959437
569 2935975506
570 8019695868
571 8055227139
572 8055227433

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11149

DUF2924

Protein of unknown function (DUF2924)

22

158

0.95

Map