F387730

General Info

Members Datasets Scaffolds Average Seq Length
286 166 572 245

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2675903058|2676475417
Length 290
Sequence RRVVVRRDSGLYAYERALVRGGLTPVAGVDEAGRGACAGPLVSAAVILPEGSRGEIRGLADSKLLTAAARERCYAEIVRRAVAWSVVVVPPAECDRLGMHRVNIEALRRALFALDTRPAYVLTDGFPVDGLGAPGLAVWKGDRVIACIAAASVIAKVTRDRLMCELAEHYPAYDFATHKGYCTADHQAALDRYGPCPEHRLRYINVRRAAGAARSGPVPASPDEWEAGDETDGSAPAGSVPGGSSVMGQNGAGTASVPGGDRPADDQPTDCEDLVSVTTGNRARGGERAR

Samples

Sample ID Description Type Environment
1 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
78 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
81 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
82 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
83 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
84 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
85 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
88 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
89 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
90 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
93 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
96 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
97 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
98 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
99 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
100 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
101 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
102 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
103 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
104 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
105 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
106 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
107 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
108 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
109 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
110 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
111 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
112 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
113 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
114 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
115 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
116 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
119 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
122 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
125 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
126 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
127 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
128 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
139 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
140 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
141 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
142 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
143 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
144 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
145 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
146 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
147 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
148 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
149 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
151 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
152 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
153 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
154 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
155 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
156 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
157 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
158 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
159 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
160 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
161 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
162 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
163 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
164 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
165 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
166 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.6
Metatranscriptomes 0
Isolates 1.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.43
Nodule 0
Rhizoplane 5.94
Rhizosphere 76.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10004251 3300002075 Bacteria 3528
2 Ga0070658_10001365 3300005327 Bacteria 20878
3 Ga0070658_10038597 3300005327 Bacteria 3850
4 Ga0070658_10313411 3300005327 Bacteria 1339
5 Ga0070683_100022675 3300005329 Bacteria 5614
6 Ga0068869_100355642 3300005334 Bacteria 1195
7 Ga0070660_100067394 3300005339 Bacteria 2789
8 Ga0070660_100210973 3300005339 Bacteria 1577
9 Ga0070691_10087009 3300005341 Bacteria 1536
10 Ga0070675_100402812 3300005354 Bacteria 1221
11 Ga0070674_100007258 3300005356 Bacteria 6527
12 Ga0070659_100017813 3300005366 Bacteria 5351
13 Ga0070659_100386509 3300005366 Bacteria 1179
14 Ga0070667_100068488 3300005367 Bacteria 3020
15 Ga0070701_10010709 3300005438 Bacteria 4069
16 Ga0070700_100022961 3300005441 Bacteria 3646
17 Ga0070700_100233625 3300005441 Bacteria 1310
18 Ga0070663_100614373 3300005455 Bacteria 916
19 Ga0070678_100219238 3300005456 Bacteria 1580
20 Ga0070681_10370861 3300005458 Bacteria 1342
21 Ga0068867_100004587 3300005459 Bacteria 9715
22 Ga0070685_10205887 3300005466 Bacteria 1281
23 Ga0070699_100459875 3300005518 Bacteria 1154
24 Ga0070679_100008576 3300005530 Bacteria 9632
25 Ga0070679_100061670 3300005530 Bacteria 3738
26 Ga0070684_100022554 3300005535 Bacteria 5253
27 Ga0070684_100381323 3300005535 Bacteria 1298
28 Ga0070672_100003797 3300005543 Bacteria 9828
29 Ga0070686_100031224 3300005544 Bacteria 3255
30 Ga0070664_100157809 3300005564 Bacteria 2005
31 Ga0070664_100254968 3300005564 Bacteria 1578
32 Ga0068854_100149832 3300005578 Bacteria 1798
33 Ga0070702_100421467 3300005615 Bacteria 961
34 Ga0068852_100001902 3300005616 Bacteria 14205
35 Ga0068852_100215327 3300005616 Bacteria 1824
36 Ga0068861_100029008 3300005719 Bacteria 4042
37 Ga0068851_10136395 3300005834 Bacteria 1331
38 Ga0068870_10005008 3300005840 Bacteria 5754
39 Ga0068860_100000403 3300005843 Bacteria 56312
40 Ga0068860_100380175 3300005843 Bacteria 1394
41 Ga0075365_10000963 3300006038 Bacteria 12225
42 Ga0075365_10012475 3300006038 Bacteria 5050
43 Ga0075365_10013116 3300006038 Bacteria 4942
44 Ga0075365_10025669 3300006038 Bacteria 3732
45 Ga0075365_10034367 3300006038 Bacteria 3273
46 Ga0075365_10045309 3300006038 Bacteria 2885
47 Ga0075365_10133152 3300006038 Bacteria 1721
48 Ga0075365_10136539 3300006038 Bacteria 1700
49 Ga0075365_10141752 3300006038 Bacteria 1668
50 Ga0075365_10141803 3300006038 Bacteria 1668
51 Ga0075368_10001419 3300006042 Bacteria 7662
52 Ga0075368_10017676 3300006042 Bacteria 2672
53 Ga0075363_100051485 3300006048 Bacteria 2196
54 Ga0075364_10014508 3300006051 Bacteria 4870
55 Ga0075364_10016680 3300006051 Bacteria 4573
56 Ga0075364_10063556 3300006051 Bacteria 2423
57 Ga0075364_10076891 3300006051 Bacteria 2203
58 Ga0075364_10260100 3300006051 Bacteria 1180
59 Ga0075362_10002212 3300006177 Bacteria 6459
60 Ga0075367_10012670 3300006178 Bacteria 4508
61 Ga0075367_10039036 3300006178 Bacteria 2767
62 Ga0075367_10132833 3300006178 Bacteria 1539
63 Ga0075370_10016012 3300006353 Bacteria 4028
64 Ga0075370_10063871 3300006353 Bacteria 2099
65 Ga0075370_10083967 3300006353 Bacteria 1833
66 Ga0068865_100018139 3300006881 Bacteria 4537
67 Ga0111539_10538174 3300009094 Bacteria 1361
68 Ga0111539_10804874 3300009094 Bacteria 1094
69 Ga0105245_10026548 3300009098 Bacteria 5098
70 Ga0105245_10601507 3300009098 Bacteria 1126
71 Ga0105243_10418131 3300009148 Bacteria 1249
72 Ga0105242_10749891 3300009176 Bacteria 961
73 Ga0105248_10121334 3300009177 Bacteria 2949
74 Ga0105248_10304432 3300009177 Bacteria 1795
75 Ga0105239_10165808 3300010375 Bacteria 2470
76 Ga0157369_10985064 3300013105 Bacteria 863
77 Ga0157372_10074230 3300013307 Bacteria 3835
78 Ga0157375_10472880 3300013308 Bacteria 1418
79 Ga0163163_10041995 3300014325 Bacteria 4476
80 Ga0163163_10097330 3300014325 Bacteria 2963
81 Ga0157380_10008416 3300014326 Bacteria 7363
82 Ga0163161_10223097 3300017792 Bacteria 1460
83 Ga0207688_10004616 3300025901 Bacteria 7504
84 Ga0207647_10062781 3300025904 Bacteria 2262
85 Ga0207643_10001516 3300025908 Bacteria 13265
86 Ga0207643_10087435 3300025908 Bacteria 1812
87 Ga0207705_10011780 3300025909 Bacteria 6320
88 Ga0207705_10149617 3300025909 Bacteria 1749
89 Ga0207707_10212473 3300025912 Bacteria 1685
90 Ga0207660_10273130 3300025917 Bacteria 1339
91 Ga0207657_10040086 3300025919 Bacteria 4153
92 Ga0207687_10391409 3300025927 Bacteria 1141
93 Ga0207664_10019345 3300025929 Bacteria 5031
94 Ga0207690_10293717 3300025932 Bacteria 1269
95 Ga0207690_10550839 3300025932 Bacteria 938
96 Ga0207669_10351944 3300025937 Bacteria 1138
97 Ga0207704_10014287 3300025938 Bacteria 4006
98 Ga0207691_10001940 3300025940 Bacteria 20185
99 Ga0207711_10087043 3300025941 Bacteria 2740
100 Ga0207689_10099834 3300025942 Bacteria 2385
101 Ga0207661_10110852 3300025944 Bacteria 2321
102 Ga0207679_10179350 3300025945 Bacteria 1751
103 Ga0207679_10204950 3300025945 Bacteria 1650
104 Ga0207651_10026952 3300025960 Bacteria 3601
105 Ga0207668_10232684 3300025972 Bacteria 1487
106 Ga0207640_10026124 3300025981 Bacteria 3542
107 Ga0207658_10052020 3300025986 Bacteria 3021
108 Ga0207678_10124874 3300026067 Bacteria 2196
109 Ga0207678_10563837 3300026067 Bacteria 997
110 Ga0207708_10002864 3300026075 Bacteria 12703
111 Ga0207708_10282797 3300026075 Bacteria 1345
112 Ga0207648_10003390 3300026089 Bacteria 16733
113 Ga0207675_100014187 3300026118 Bacteria 7430
114 Ga0207698_10184420 3300026142 Bacteria 1852
115 Ga0207698_10462351 3300026142 Bacteria 1227
116 Ga0209813_10015198 3300027866 Bacteria 2082
117 Ga0207428_10016921 3300027907 Bacteria 6266
118 Ga0268264_10000355 3300028381 Bacteria 68889
119 Ga0307408_100499996 3300031548 Bacteria 1064
120 Ga0307413_10074578 3300031824 Bacteria 2149
121 Ga0307410_10618653 3300031852 Bacteria 905
122 Ga0307406_10025773 3300031901 Bacteria 3523
123 Ga0307407_10016944 3300031903 Bacteria 3642
124 Ga0307412_10045625 3300031911 Bacteria 2866
125 Ga0307416_100300213 3300032002 Bacteria 1596
126 Ga0307414_10014987 3300032004 Bacteria 4668
127 Ga0307411_10015597 3300032005 Bacteria 4274
128 Ga0307415_100062865 3300032126 Bacteria 2577
129 Ga0395899_0009778 3300037312 Bacteria 7360
130 Ga0395900_0031818 3300037418 Bacteria 5423
131 Ga0395898_0004699 3300037466 Bacteria 14867
132 Ga0395898_0140956 3300037466 Bacteria 2308
133 Ga0395898_0973916 3300037466 Bacteria 785
134 Ga0395905_0191990 3300037471 Bacteria 1916
135 Ga0395901_0080152 3300038443 Bacteria 3408
136 Ga0395901_0095772 3300038443 Bacteria 3110
137 Ga0395901_0421894 3300038443 Bacteria 1368
138 Ga0439438_068005 3300041405 Bacteria 885
139 Ga0439447_036492 3300041407 Bacteria 1214
140 Ga0439461_0008702 3300041410 Bacteria 1826
141 Ga0451791_1643046 3300041451 Bacteria 1260
142 Ga0451843_0445274 3300041509 Bacteria 1435
143 Ga0439431_0021851 3300041997 Bacteria 1538
144 Ga0439442_023779 3300042002 Bacteria 1274
145 Ga0439434_0031747 3300042435 Bacteria 1606
146 Ga0466969_0083614 3300044656 Bacteria 1520
147 Ga0466972_0104105 3300044658 Bacteria 1342
148 Ga0466965_0027298 3300044683 Bacteria 2771
149 Ga0466965_0082047 3300044683 Bacteria 1630
150 Ga0466966_0022359 3300044684 Bacteria 4150
151 Ga0466966_0356694 3300044684 Bacteria 879
152 Ga0466961_0005780 3300044693 Bacteria 7829
153 Ga0466961_0044881 3300044693 Bacteria 2828
154 Ga0466961_0118830 3300044693 Bacteria 1660
155 Ga0466963_0024331 3300044694 Bacteria 3854
156 Ga0466963_0036649 3300044694 Bacteria 3199
157 Ga0466963_0098004 3300044694 Bacteria 2004
158 Ga0466964_0026909 3300044706 Bacteria 2254
159 Ga0466964_0078662 3300044706 Bacteria 1410
160 Ga0466964_0129639 3300044706 Bacteria 1147
161 Ga0466971_0002276 3300044719 Bacteria 8137
162 Ga0466971_0005422 3300044719 Bacteria 5533
163 Ga0466971_0063406 3300044719 Bacteria 1673
164 Ga0466971_0145252 3300044719 Bacteria 1106
165 Ga0466968_0131269 3300044735 Bacteria 1140
166 Ga0466970_0044032 3300044765 Bacteria 2376
167 Ga0466970_0044194 3300044765 Bacteria 2372
168 Ga0466970_0086458 3300044765 Bacteria 1699
169 Ga0466970_0112581 3300044765 Bacteria 1487
170 Ga0466957_0004970 3300044842 Bacteria 7438
171 Ga0466957_0027312 3300044842 Bacteria 3392
172 Ga0466957_0093149 3300044842 Bacteria 1890
173 Ga0466957_0119699 3300044842 Bacteria 1677
174 Ga0466957_0211510 3300044842 Bacteria 1277
175 Ga0466960_0002736 3300044901 Bacteria 6667
176 Ga0466960_0010469 3300044901 Bacteria 3853
177 Ga0466960_0013461 3300044901 Bacteria 3477
178 Ga0466960_0050682 3300044901 Bacteria 2002
179 Ga0466960_0069442 3300044901 Bacteria 1750
180 Ga0466959_0079297 3300045049 Bacteria 2368
181 Ga0466959_0415916 3300045049 Bacteria 913
182 Ga0466958_0019143 3300045836 Bacteria 3982
183 Ga0466958_0126257 3300045836 Bacteria 1604
184 Ga0466958_0158827 3300045836 Bacteria 1427
185 Ga0466967_0014912 3300045976 Bacteria 6075
186 Ga0466967_0069332 3300045976 Bacteria 3151
187 Ga0466967_0072426 3300045976 Bacteria 3088
188 Ga0466967_0454797 3300045976 Bacteria 1252
189 Ga0466967_0510451 3300045976 Bacteria 1180
190 Ga0466967_0540217 3300045976 Bacteria 1147
191 Ga0466967_0724441 3300045976 Bacteria 986
192 Ga0495587_0212676 3300046536 Bacteria 1092
193 Ga0496101_0038438 3300048904 Bacteria 3399
194 Ga0496102_0064025 3300048905 Bacteria 3367
195 Ga0496105_0120495 3300048908 Bacteria 2164
196 Ga0496106_0181606 3300048909 Bacteria 1670
197 Ga0496108_0057719 3300048911 Bacteria 3261
198 Ga0496108_0247980 3300048911 Bacteria 1549
199 Ga0496108_0452303 3300048911 Bacteria 1122
200 Ga0496109_0149764 3300048912 Bacteria 2184
201 Ga0496109_0212485 3300048912 Bacteria 1819
202 Ga0496110_0089486 3300048913 Bacteria 2751
203 Ga0496110_0207401 3300048913 Bacteria 1781
204 Ga0496111_0029427 3300048914 Bacteria 3901
205 Ga0496114_0173331 3300048917 Bacteria 1881
206 Ga0496114_0188597 3300048917 Bacteria 1803
207 Ga0496114_0274991 3300048917 Bacteria 1484
208 Ga0496114_0558043 3300048917 Bacteria 1011
209 Ga0501031_0296028 3300049568 Bacteria 1049
210 Ga0501032_0344206 3300049569 Bacteria 961
211 Ga0501033_0285820 3300049570 Bacteria 1164
212 Ga0501036_0255242 3300049572 Bacteria 1469
213 Ga0501039_0101643 3300049575 Bacteria 2244
214 Ga0501040_0109483 3300049576 Bacteria 1931
215 Ga0501040_0191094 3300049576 Bacteria 1453
216 Ga0501040_0404507 3300049576 Bacteria 980
217 Ga0501041_0011204 3300049577 Bacteria 5296
218 Ga0501042_0001973 3300049578 Bacteria 12360
219 Ga0501042_0222010 3300049578 Bacteria 1363
220 Ga0501042_0243477 3300049578 Bacteria 1298
221 Ga0501042_0300533 3300049578 Bacteria 1160
222 Ga0501042_0417160 3300049578 Bacteria 973
223 Ga0501046_0547035 3300049580 Bacteria 826
224 Ga0501048_0016527 3300049582 Bacteria 5441
225 Ga0501048_0185668 3300049582 Bacteria 1474
226 Ga0501048_0502220 3300049582 Bacteria 870
227 Ga0501067_0001520 3300049583 Bacteria 12629
228 Ga0501067_0235749 3300049583 Bacteria 1018
229 Ga0501068_0144149 3300049584 Bacteria 1494
230 Ga0501069_0018735 3300049585 Bacteria 3739
231 Ga0501069_0041368 3300049585 Bacteria 2547
232 Ga0501069_0204023 3300049585 Bacteria 1146
233 Ga0501070_0022496 3300049586 Bacteria 5280
234 Ga0501070_0040584 3300049586 Bacteria 3881
235 Ga0501070_0160774 3300049586 Bacteria 1852
236 Ga0501071_0018290 3300049587 Bacteria 4850
237 Ga0501071_0167858 3300049587 Bacteria 1643
238 Ga0501071_0231859 3300049587 Bacteria 1391
239 Ga0501071_0385605 3300049587 Bacteria 1069
240 Ga0501072_0002970 3300049588 Bacteria 12784
241 Ga0501072_0096579 3300049588 Bacteria 2348
242 Ga0501072_0285282 3300049588 Bacteria 1313
243 Ga0501074_0047678 3300049590 Bacteria 3096
244 Ga0501074_0420598 3300049590 Bacteria 948
245 Ga0501075_0554884 3300049591 Bacteria 877
246 Ga0501076_0020088 3300049592 Bacteria 5110
247 Ga0501076_0753066 3300049592 Bacteria 804
248 Ga0501077_0051114 3300049593 Bacteria 2627
249 Ga0501077_0333660 3300049593 Bacteria 967
250 Ga0501079_0406362 3300049741 Bacteria 1068
251 Ga0501035_0409697 3300049822 Bacteria 1127
252 Ga0501045_0179226 3300049824 Bacteria 1579
253 Ga0501045_0222224 3300049824 Bacteria 1406
254 Ga0501045_0431111 3300049824 Bacteria 980
255 nmdc:mga03n38_25518_c1 3300050490 Bacteria 2429
256 nmdc:mga00v17_228639_c1 3300050491 Bacteria 1205
257 nmdc:mga00v17_385568_c1 3300050491 Bacteria 911
258 nmdc:mga00v17_3882_c2 3300050491 Bacteria 5554
259 nmdc:mga00v17_6689_c1 3300050491 Bacteria 6124
260 nmdc:mga0yw44_125406_c1 3300050492 Bacteria 1658
261 nmdc:mga0yw44_12658_c2 3300050492 Bacteria 3582
262 nmdc:mga0yw44_18014_c1 3300050492 Bacteria 3859
263 nmdc:mga0yw44_1946_c1 3300050492 Bacteria 8553
264 nmdc:mga0yw44_25598_c1 3300050492 Bacteria 3358
265 nmdc:mga0yw44_318663_c1 3300050492 Bacteria 1044
266 nmdc:mga0yw44_36537_c1 3300050492 Bacteria 2895
267 nmdc:mga0yw44_5949_c1 3300050492 Bacteria 5836
268 nmdc:mga0yw44_7853_c1 3300050492 Bacteria 5282
269 nmdc:mga06z11_2328_c1 3300050494 Bacteria 7231
270 nmdc:mga06z11_26418_c1 3300050494 Bacteria 2763
271 nmdc:mga06z11_322229_c1 3300050494 Bacteria 922
272 nmdc:mga06z11_41800_c1 3300050494 Bacteria 2296
273 nmdc:mga04h51_30597_c1 3300050495 Bacteria 1695
274 nmdc:mga07m45_47428_c1 3300050496 Bacteria 2415
275 nmdc:mga07m45_7598_c1 3300050496 Bacteria 5545
276 nmdc:mga0n895_685555_c1 3300050512 Bacteria 1021
277 Ga0495601_0021431 3300053077 Bacteria 3958
278 Ga0501084_0167990 3300054114 Bacteria 1852
279 Ga0501082_0149327 3300060353 Bacteria 2030
280 Ga0466962_0007728 3300061719 Bacteria 5152
281 Ga0466962_0155472 3300061719 Bacteria 1110
282 Ga0530510_0059743 3300061734 Bacteria 2758
283 2676475417 2675903058 Bacteria 6822861
284 2515855834 2515154155 Bacteria 7985436
285 2827629653 2827628540 Bacteria 6858585
286 2868093844 2868088558 Bacteria 7609351
287 JGI24738J21930_10004251
288 Ga0070658_10001365
289 Ga0070658_10038597
290 Ga0070658_10313411
291 Ga0070683_100022675
292 Ga0068869_100355642
293 Ga0070660_100067394
294 Ga0070660_100210973
295 Ga0070691_10087009
296 Ga0070675_100402812
297 Ga0070674_100007258
298 Ga0070659_100017813
299 Ga0070659_100386509
300 Ga0070667_100068488
301 Ga0070701_10010709
302 Ga0070700_100022961
303 Ga0070700_100233625
304 Ga0070663_100614373
305 Ga0070678_100219238
306 Ga0070681_10370861
307 Ga0068867_100004587
308 Ga0070685_10205887
309 Ga0070699_100459875
310 Ga0070679_100008576
311 Ga0070679_100061670
312 Ga0070684_100022554
313 Ga0070684_100381323
314 Ga0070672_100003797
315 Ga0070686_100031224
316 Ga0070664_100157809
317 Ga0070664_100254968
318 Ga0068854_100149832
319 Ga0070702_100421467
320 Ga0068852_100001902
321 Ga0068852_100215327
322 Ga0068861_100029008
323 Ga0068851_10136395
324 Ga0068870_10005008
325 Ga0068860_100000403
326 Ga0068860_100380175
327 Ga0075365_10000963
328 Ga0075365_10012475
329 Ga0075365_10013116
330 Ga0075365_10025669
331 Ga0075365_10034367
332 Ga0075365_10045309
333 Ga0075365_10133152
334 Ga0075365_10136539
335 Ga0075365_10141752
336 Ga0075365_10141803
337 Ga0075368_10001419
338 Ga0075368_10017676
339 Ga0075363_100051485
340 Ga0075364_10014508
341 Ga0075364_10016680
342 Ga0075364_10063556
343 Ga0075364_10076891
344 Ga0075364_10260100
345 Ga0075362_10002212
346 Ga0075367_10012670
347 Ga0075367_10039036
348 Ga0075367_10132833
349 Ga0075370_10016012
350 Ga0075370_10063871
351 Ga0075370_10083967
352 Ga0068865_100018139
353 Ga0111539_10538174
354 Ga0111539_10804874
355 Ga0105245_10026548
356 Ga0105245_10601507
357 Ga0105243_10418131
358 Ga0105242_10749891
359 Ga0105248_10121334
360 Ga0105248_10304432
361 Ga0105239_10165808
362 Ga0157369_10985064
363 Ga0157372_10074230
364 Ga0157375_10472880
365 Ga0163163_10041995
366 Ga0163163_10097330
367 Ga0157380_10008416
368 Ga0163161_10223097
369 Ga0207688_10004616
370 Ga0207647_10062781
371 Ga0207643_10001516
372 Ga0207643_10087435
373 Ga0207705_10011780
374 Ga0207705_10149617
375 Ga0207707_10212473
376 Ga0207660_10273130
377 Ga0207657_10040086
378 Ga0207687_10391409
379 Ga0207664_10019345
380 Ga0207690_10293717
381 Ga0207690_10550839
382 Ga0207669_10351944
383 Ga0207704_10014287
384 Ga0207691_10001940
385 Ga0207711_10087043
386 Ga0207689_10099834
387 Ga0207661_10110852
388 Ga0207679_10179350
389 Ga0207679_10204950
390 Ga0207651_10026952
391 Ga0207668_10232684
392 Ga0207640_10026124
393 Ga0207658_10052020
394 Ga0207678_10124874
395 Ga0207678_10563837
396 Ga0207708_10002864
397 Ga0207708_10282797
398 Ga0207648_10003390
399 Ga0207675_100014187
400 Ga0207698_10184420
401 Ga0207698_10462351
402 Ga0209813_10015198
403 Ga0207428_10016921
404 Ga0268264_10000355
405 Ga0307408_100499996
406 Ga0307413_10074578
407 Ga0307410_10618653
408 Ga0307406_10025773
409 Ga0307407_10016944
410 Ga0307412_10045625
411 Ga0307416_100300213
412 Ga0307414_10014987
413 Ga0307411_10015597
414 Ga0307415_100062865
415 Ga0395899_0009778
416 Ga0395900_0031818
417 Ga0395898_0004699
418 Ga0395898_0140956
419 Ga0395898_0973916
420 Ga0395905_0191990
421 Ga0395901_0080152
422 Ga0395901_0095772
423 Ga0395901_0421894
424 Ga0439438_068005
425 Ga0439447_036492
426 Ga0439461_0008702
427 Ga0451791_1643046
428 Ga0451843_0445274
429 Ga0439431_0021851
430 Ga0439442_023779
431 Ga0439434_0031747
432 Ga0466969_0083614
433 Ga0466972_0104105
434 Ga0466965_0027298
435 Ga0466965_0082047
436 Ga0466966_0022359
437 Ga0466966_0356694
438 Ga0466961_0005780
439 Ga0466961_0044881
440 Ga0466961_0118830
441 Ga0466963_0024331
442 Ga0466963_0036649
443 Ga0466963_0098004
444 Ga0466964_0026909
445 Ga0466964_0078662
446 Ga0466964_0129639
447 Ga0466971_0002276
448 Ga0466971_0005422
449 Ga0466971_0063406
450 Ga0466971_0145252
451 Ga0466968_0131269
452 Ga0466970_0044032
453 Ga0466970_0044194
454 Ga0466970_0086458
455 Ga0466970_0112581
456 Ga0466957_0004970
457 Ga0466957_0027312
458 Ga0466957_0093149
459 Ga0466957_0119699
460 Ga0466957_0211510
461 Ga0466960_0002736
462 Ga0466960_0010469
463 Ga0466960_0013461
464 Ga0466960_0050682
465 Ga0466960_0069442
466 Ga0466959_0079297
467 Ga0466959_0415916
468 Ga0466958_0019143
469 Ga0466958_0126257
470 Ga0466958_0158827
471 Ga0466967_0014912
472 Ga0466967_0069332
473 Ga0466967_0072426
474 Ga0466967_0454797
475 Ga0466967_0510451
476 Ga0466967_0540217
477 Ga0466967_0724441
478 Ga0495587_0212676
479 Ga0496101_0038438
480 Ga0496102_0064025
481 Ga0496105_0120495
482 Ga0496106_0181606
483 Ga0496108_0057719
484 Ga0496108_0247980
485 Ga0496108_0452303
486 Ga0496109_0149764
487 Ga0496109_0212485
488 Ga0496110_0089486
489 Ga0496110_0207401
490 Ga0496111_0029427
491 Ga0496114_0173331
492 Ga0496114_0188597
493 Ga0496114_0274991
494 Ga0496114_0558043
495 Ga0501031_0296028
496 Ga0501032_0344206
497 Ga0501033_0285820
498 Ga0501036_0255242
499 Ga0501039_0101643
500 Ga0501040_0109483
501 Ga0501040_0191094
502 Ga0501040_0404507
503 Ga0501041_0011204
504 Ga0501042_0001973
505 Ga0501042_0222010
506 Ga0501042_0243477
507 Ga0501042_0300533
508 Ga0501042_0417160
509 Ga0501046_0547035
510 Ga0501048_0016527
511 Ga0501048_0185668
512 Ga0501048_0502220
513 Ga0501067_0001520
514 Ga0501067_0235749
515 Ga0501068_0144149
516 Ga0501069_0018735
517 Ga0501069_0041368
518 Ga0501069_0204023
519 Ga0501070_0022496
520 Ga0501070_0040584
521 Ga0501070_0160774
522 Ga0501071_0018290
523 Ga0501071_0167858
524 Ga0501071_0231859
525 Ga0501071_0385605
526 Ga0501072_0002970
527 Ga0501072_0096579
528 Ga0501072_0285282
529 Ga0501074_0047678
530 Ga0501074_0420598
531 Ga0501075_0554884
532 Ga0501076_0020088
533 Ga0501076_0753066
534 Ga0501077_0051114
535 Ga0501077_0333660
536 Ga0501079_0406362
537 Ga0501035_0409697
538 Ga0501045_0179226
539 Ga0501045_0222224
540 Ga0501045_0431111
541 nmdc:mga03n38_25518_c1
542 nmdc:mga00v17_228639_c1
543 nmdc:mga00v17_385568_c1
544 nmdc:mga00v17_3882_c2
545 nmdc:mga00v17_6689_c1
546 nmdc:mga0yw44_125406_c1
547 nmdc:mga0yw44_12658_c2
548 nmdc:mga0yw44_18014_c1
549 nmdc:mga0yw44_1946_c1
550 nmdc:mga0yw44_25598_c1
551 nmdc:mga0yw44_318663_c1
552 nmdc:mga0yw44_36537_c1
553 nmdc:mga0yw44_5949_c1
554 nmdc:mga0yw44_7853_c1
555 nmdc:mga06z11_2328_c1
556 nmdc:mga06z11_26418_c1
557 nmdc:mga06z11_322229_c1
558 nmdc:mga06z11_41800_c1
559 nmdc:mga04h51_30597_c1
560 nmdc:mga07m45_47428_c1
561 nmdc:mga07m45_7598_c1
562 nmdc:mga0n895_685555_c1
563 Ga0495601_0021431
564 Ga0501084_0167990
565 Ga0501082_0149327
566 Ga0466962_0007728
567 Ga0466962_0155472
568 Ga0530510_0059743
569 2676475417
570 2515855834
571 2827629653
572 2868093844

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01351

RNase_HII

Ribonuclease HII

27

206

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7uwe-assembly1.cif.gz_C cryoem structure of e. coli transcription-coupled ribonucleotide excision repair (tc-rer) complex 0.9299 28 214
7uwh-assembly1.cif.gz_C cryoem structure of e. coli transcription-coupled ribonucleotide excision repair (tc-rer) complex bound to ribonucleotide substrate 0.9198 29 219
7uwh-assembly1.cif.gz_C cryoem structure of e. coli transcription-coupled ribonucleotide excision repair (tc-rer) complex bound to ribonucleotide substrate 0.9106 29 219
7uwe-assembly1.cif.gz_C cryoem structure of e. coli transcription-coupled ribonucleotide excision repair (tc-rer) complex 0.9062 28 214
3o3h-assembly1.cif.gz_A t. maritima rnase h2 d107n in complex with nucleic acid substrate and manganese ions 0.8957 21 213
ID Description Score Start End Superfamily
af_P10442_2_197_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9295 28 218 3.30.420.10
af_Q2FZ38_49_255_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9064 17 213 3.30.420.10
af_P10442_2_197_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8931 28 218 3.30.420.10
af_P9WH01_18_234_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8862 19 228 3.30.420.10
2etjA00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8631 21 214 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A1H0I473-F1-model_v4 Ribonuclease HII (RNase HII) (EC 3.1.26.4) 0.95 20 216 GO:0003723
GO:0004523
GO:0005737
GO:0006298
GO:0030145
GO:0032299
GO:0043137
AF-A0A1I4KXF6-F1-model_v4 Ribonuclease HII (RNase HII) (EC 3.1.26.4) 0.9457 20 216 GO:0003723
GO:0004523
GO:0005737
GO:0006298
GO:0030145
GO:0032299
GO:0043137
AF-A0A356CIR4-F1-model_v4 Ribonuclease HII (RNase HII) (EC 3.1.26.4) 0.944 29 215 GO:0003723
GO:0004523
GO:0005737
GO:0006298
GO:0030145
GO:0032299
GO:0043137
AF-A0A2Z4LM94-F1-model_v4 Ribonuclease (EC 3.1.26.4) 0.9432 30 213 GO:0003723
GO:0004523
GO:0006284
GO:0006401
GO:0008725
GO:0046872
AF-A0A6P1I2Q7-F1-model_v4 Ribonuclease HII (RNase HII) (EC 3.1.26.4) 0.9428 35 216 GO:0003723
GO:0004523
GO:0005737
GO:0006298
GO:0030145
GO:0032299
GO:0043137

Map