F387709

General Info

Members Datasets Scaffolds Average Seq Length
286 222 286 238

Family's Representative Sequence

Representative Sequence 3300053135|Ga0500659_0002099|Ga0500659_0002099_11329_12150
Length 266
Sequence MATHSHDGSAPHFNAQEHGHAHEILDGPGSYIGREMPITEGRQWGTRAFTVGIGGPVGSGKTALMLALCMALRSRYNIAAVTNDIFTREDAEFLTRNRALPADRIRAIETGGCPHAAVREDISANLAALEDLHVEFNTDLLLIESGGDNLAANYSRELADYIIYVIDVSGGDKIPRKGGPGITQSDLLVVNKTDLAEAVGADLGVMERDARKMREGGPTVFAQVKKDVGVDHIVNLILSAWRASGAEEVQKSRGGPTATPGLDALK

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003556 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_09_fullP_nobac_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003558 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_10_fullP_mix1_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003560 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_13_lowP_nobac_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003561 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_01_fullP_nobac_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003564 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_05_lowP_nobac_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003565 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300023553 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
60 3300023556 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
61 3300023558 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
62 3300023560 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
63 3300023561 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
64 3300023562 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
65 3300023563 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
66 3300023564 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
67 3300023664 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
68 3300023666 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
69 3300023668 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
70 3300023680 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
71 3300023686 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
72 3300023688 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
73 3300023689 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
74 3300023690 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
103 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
104 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
105 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
106 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
107 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
108 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
109 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
110 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
111 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
112 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
113 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
114 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
115 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
116 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
117 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
118 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
119 3300031591 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
120 3300031592 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
121 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
122 3300031614 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
123 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
124 3300031632 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
125 3300031634 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
126 3300031635 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
127 3300031636 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
128 3300031664 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
129 3300031666 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
130 3300031667 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
131 3300031678 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
132 3300031686 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
135 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
136 3300031815 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
137 3300031816 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
140 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
141 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
142 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
143 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
144 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
145 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
147 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
148 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
149 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
150 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
151 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
152 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
153 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
154 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
158 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
159 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
160 3300036242 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
163 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
164 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
165 3300036535 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
169 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
170 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
171 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
172 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
173 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
174 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
175 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
178 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
179 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
180 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
181 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
185 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
186 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
187 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
188 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
189 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
190 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
191 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
192 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
193 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
194 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
195 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
196 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
197 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
198 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
206 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
207 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
210 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
211 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
212 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
213 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
214 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
215 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
216 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
217 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
218 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
219 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
220 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
221 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
222 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.52
Metatranscriptomes 17.48
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.85
Nodule 0
Rhizoplane 1.4
Rhizosphere 78.32
Stem 0
Stem Tuber 0
Unclassified 16.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10003144 3300003320 Bacteria 4984
2 Ga0006556J51387_1003553 3300003479 Eukaryota 1190
3 Ga0006557J51388_1004214 3300003556 Eukaryota 1050
4 Ga0006558J51389_1003221 3300003558 Eukaryota 1060
5 Ga0006559J51393_1004630 3300003560 Eukaryota 1120
6 Ga0006553J51392_1004328 3300003561 Eukaryota 1241
7 Ga0006555J51386_1003708 3300003564 Eukaryota 1150
8 Ga0006560J51390_1003455 3300003565 Eukaryota 1520
9 Ga0006554J51385_1003746 3300003567 Eukaryota 1072
10 Ga0068869_100031096 3300005334 Bacteria 3754
11 Ga0070666_10287107 3300005335 Bacteria 1170
12 Ga0068868_100413324 3300005338 Bacteria 1166
13 Ga0070689_100018395 3300005340 Bacteria 5146
14 Ga0070689_100074199 3300005340 Bacteria 2662
15 Ga0070689_100109844 3300005340 Bacteria 2192
16 Ga0070691_10262493 3300005341 Bacteria 930
17 Ga0070661_100039955 3300005344 Bacteria 3420
18 Ga0070675_100059686 3300005354 Bacteria 3147
19 Ga0070675_100120275 3300005354 Bacteria 2231
20 Ga0070671_100038409 3300005355 Bacteria 3974
21 Ga0070674_100158906 3300005356 Bacteria 1713
22 Ga0070673_100076345 3300005364 Bacteria 2705
23 Ga0070673_100114714 3300005364 Bacteria 2239
24 Ga0070673_100309159 3300005364 Bacteria 1394
25 Ga0070701_10003865 3300005438 Bacteria 5982
26 Ga0070711_100539058 3300005439 Bacteria 967
27 Ga0070694_100014573 3300005444 Bacteria 4922
28 Ga0070708_100001771 3300005445 Bacteria 16584
29 Ga0070708_100020473 3300005445 Bacteria 5578
30 Ga0070708_100225626 3300005445 Bacteria 1757
31 Ga0070678_100302556 3300005456 Bacteria 1359
32 Ga0070706_100112149 3300005467 Bacteria 2538
33 Ga0070707_100068082 3300005468 Bacteria 3425
34 Ga0070707_100604651 3300005468 Bacteria 1059
35 Ga0070699_100129723 3300005518 Bacteria 2222
36 Ga0070684_100184070 3300005535 Bacteria 1899
37 Ga0070697_100145884 3300005536 Bacteria 1992
38 Ga0070686_100012074 3300005544 Bacteria 4913
39 Ga0070686_100103683 3300005544 Bacteria 1925
40 Ga0070665_100006064 3300005548 Bacteria 12354
41 Ga0070665_100034155 3300005548 Bacteria 5114
42 Ga0068855_100053069 3300005563 Bacteria 4770
43 Ga0068856_100003612 3300005614 Bacteria 15553
44 Ga0068852_100375687 3300005616 Bacteria 1393
45 Ga0068859_100312061 3300005617 Bacteria 1666
46 Ga0068859_100370761 3300005617 Bacteria 1527
47 Ga0068860_100686535 3300005843 Bacteria 1033
48 Ga0070717_10036999 3300006028 Bacteria 3961
49 Ga0070717_10088552 3300006028 Bacteria 2610
50 Ga0070715_10047791 3300006163 Bacteria 1826
51 Ga0070716_100404185 3300006173 Bacteria 983
52 Ga0097621_100006536 3300006237 Bacteria 8284
53 Ga0097621_100420438 3300006237 Bacteria 1199
54 Ga0068871_100003445 3300006358 Bacteria 10873
55 Ga0075428_100540993 3300006844 Bacteria 1245
56 Ga0075431_100011781 3300006847 Bacteria 8823
57 Ga0068865_100105050 3300006881 Bacteria 2074
58 Ga0068865_100117527 3300006881 Bacteria 1971
59 Ga0097620_100312044 3300006931 Bacteria 1666
60 Ga0097620_100370804 3300006931 Bacteria 1527
61 Ga0105240_10000373 3300009093 Bacteria 84033
62 Ga0105240_10119296 3300009093 Bacteria 3178
63 Ga0105245_10011594 3300009098 Bacteria 7678
64 Ga0105245_10226572 3300009098 Bacteria 1806
65 Ga0105247_10003883 3300009101 Bacteria 9656
66 Ga0114129_10555791 3300009147 Bacteria 1492
67 Ga0105242_10060832 3300009176 Bacteria 3105
68 Ga0105242_10162484 3300009176 Bacteria 1956
69 Ga0105248_10282731 3300009177 Bacteria 1868
70 Ga0157378_10026178 3300013297 Bacteria 5142
71 Ga0163162_10144285 3300013306 Bacteria 2495
72 Ga0157372_10306831 3300013307 Bacteria 1847
73 Ga0157372_10323482 3300013307 Bacteria 1796
74 Ga0157375_10690769 3300013308 Bacteria 1175
75 Ga0157379_10239189 3300014968 Bacteria 1647
76 Ga0157376_10037219 3300014969 Bacteria 3947
77 Ga0206352_10968355 3300020078 Eukaryota 1125
78 Ga0247524_104997 3300023553 Eukaryota 1175
79 Ga0247519_106376 3300023556 Eukaryota 1141
80 Ga0247526_104433 3300023558 Eukaryota 1346
81 Ga0247514_107770 3300023560 Eukaryota 1223
82 Ga0247518_111106 3300023561 Eukaryota 917
83 Ga0247516_107874 3300023562 Eukaryota 1175
84 Ga0247530_104542 3300023563 Eukaryota 1233
85 Ga0247515_108299 3300023564 Eukaryota 1151
86 Ga0247527_104723 3300023664 Eukaryota 1140
87 Ga0247531_105065 3300023666 Eukaryota 1221
88 Ga0247525_106157 3300023668 Eukaryota 1179
89 Ga0247528_104468 3300023680 Eukaryota 1159
90 Ga0247520_105991 3300023686 Eukaryota 1191
91 Ga0247520_108329 3300023686 Eukaryota 958
92 Ga0247522_106368 3300023688 Eukaryota 1178
93 Ga0247517_106691 3300023689 Eukaryota 1185
94 Ga0247512_108133 3300023690 Eukaryota 1163
95 Ga0207710_10005830 3300025900 Bacteria 5283
96 Ga0207699_10066990 3300025906 Bacteria 2181
97 Ga0207705_10556804 3300025909 Bacteria 891
98 Ga0207684_10030523 3300025910 Bacteria 4587
99 Ga0207684_10141056 3300025910 Bacteria 2071
100 Ga0207695_10000095 3300025913 Bacteria 265435
101 Ga0207695_10137561 3300025913 Bacteria 2394
102 Ga0207695_10243318 3300025913 Bacteria 1700
103 Ga0207649_10026229 3300025920 Bacteria 3407
104 Ga0207646_10041039 3300025922 Bacteria 4161
105 Ga0207694_10289199 3300025924 Bacteria 1348
106 Ga0207687_10031889 3300025927 Bacteria 3565
107 Ga0207687_10034186 3300025927 Bacteria 3451
108 Ga0207644_10124194 3300025931 Bacteria 1968
109 Ga0207644_10129649 3300025931 Bacteria 1929
110 Ga0207686_10080621 3300025934 Bacteria 2122
111 Ga0207686_10254334 3300025934 Bacteria 1285
112 Ga0207709_10053191 3300025935 Bacteria 2491
113 Ga0207669_10458795 3300025937 Bacteria 1011
114 Ga0207704_10122624 3300025938 Bacteria 1782
115 Ga0207665_10492249 3300025939 Bacteria 946
116 Ga0207711_10110021 3300025941 Bacteria 2449
117 Ga0207711_10739997 3300025941 Bacteria 917
118 Ga0207689_10398230 3300025942 Bacteria 1147
119 Ga0207661_10322883 3300025944 Bacteria 1388
120 Ga0207667_10077254 3300025949 Bacteria 3453
121 Ga0207667_10096732 3300025949 Bacteria 3047
122 Ga0207658_10033582 3300025986 Bacteria 3661
123 Ga0207677_10150592 3300026023 Bacteria 1794
124 Ga0207702_10002632 3300026078 Bacteria 16856
125 Ga0207648_10009972 3300026089 Bacteria 9043
126 Ga0207683_10111707 3300026121 Bacteria 2447
127 Ga0207683_10308875 3300026121 Bacteria 1447
128 Ga0207698_10436923 3300026142 Bacteria 1260
129 Ga0268266_10003387 3300028379 Bacteria 15955
130 Ga0268266_10060609 3300028379 Bacteria 3262
131 Ga0268264_10905705 3300028381 Bacteria 885
132 Ga0265337_1016361 3300028556 Bacteria 2399
133 Ga0265319_1000600 3300028563 Bacteria 24070
134 Ga0265318_10000302 3300028577 Bacteria 39987
135 Ga0265318_10001820 3300028577 Bacteria 12085
136 Ga0265336_10024656 3300028666 Bacteria 1898
137 Ga0307517_10059132 3300028786 Bacteria 3677
138 Ga0265338_10028156 3300028800 Bacteria 5613
139 Ga0265338_10034813 3300028800 Bacteria 4856
140 Ga0265338_10073068 3300028800 Bacteria 2925
141 Ga0265338_10179325 3300028800 Bacteria 1617
142 Ga0265330_10000072 3300031235 Bacteria 87680
143 Ga0265332_10000194 3300031238 Bacteria 49527
144 Ga0265328_10004211 3300031239 Bacteria 6263
145 Ga0265328_10068364 3300031239 Bacteria 1305
146 Ga0265320_10000038 3300031240 Bacteria 135648
147 Ga0265320_10001277 3300031240 Bacteria 18392
148 Ga0265320_10001826 3300031240 Bacteria 15098
149 Ga0265320_10181459 3300031240 Bacteria 943
150 Ga0265325_10001826 3300031241 Bacteria 14714
151 Ga0265329_10000104 3300031242 Bacteria 40556
152 Ga0265340_10017527 3300031247 Bacteria 3705
153 Ga0265340_10084111 3300031247 Bacteria 1494
154 Ga0265339_10002870 3300031249 Bacteria 12200
155 Ga0265331_10000421 3300031250 Bacteria 42955
156 Ga0265331_10055255 3300031250 Bacteria 1888
157 Ga0265316_10000930 3300031344 Bacteria 31824
158 Ga0265316_10000951 3300031344 Bacteria 31569
159 Ga0265316_10413155 3300031344 Bacteria 971
160 Ga0307513_10438890 3300031456 Bacteria 1032
161 Ga0310116_106038 3300031591 Eukaryota 1228
162 Ga0310117_107224 3300031592 Eukaryota 1197
163 Ga0265313_10000311 3300031595 Bacteria 52824
164 Ga0265313_10003693 3300031595 Bacteria 12198
165 Ga0310103_111680 3300031614 Eukaryota 1179
166 Ga0307508_10002654 3300031616 Bacteria 18761
167 Ga0310102_102086 3300031632 Eukaryota 1183
168 Ga0310106_104006 3300031634 Eukaryota 1156
169 Ga0310115_109021 3300031635 Eukaryota 1165
170 Ga0310113_108323 3300031636 Eukaryota 1177
171 Ga0310118_104834 3300031664 Eukaryota 1155
172 Ga0310105_107067 3300031666 Eukaryota 1218
173 Ga0310111_110433 3300031667 Eukaryota 1200
174 Ga0310114_106579 3300031678 Eukaryota 1182
175 Ga0310119_108583 3300031686 Eukaryota 1246
176 Ga0265314_10000114 3300031711 Bacteria 124126
177 Ga0265314_10157330 3300031711 Eukaryota 1386
178 Ga0265342_10000268 3300031712 Bacteria 58391
179 Ga0265342_10028678 3300031712 Bacteria 3464
180 Ga0307516_10028540 3300031730 Bacteria 5646
181 Ga0316045_108708 3300031815 Eukaryota 1219
182 Ga0316042_111457 3300031816 Eukaryota 1171
183 Ga0307414_10868463 3300032004 Bacteria 826
184 Ga0373930_0000113 3300034816 Bacteria 8643
185 Ga0373928_0000122 3300035084 Bacteria 14457
186 Ga0373929_0000570 3300035085 Bacteria 7107
187 Ga0373944_0050616 3300035089 Bacteria 1308
188 Ga0373949_0001330 3300035090 Bacteria 7114
189 Ga0373951_0006768 3300035091 Bacteria 2616
190 Ga0373923_0029596 3300035111 Bacteria 2197
191 Ga0373923_0136859 3300035111 Bacteria 1105
192 Ga0373932_0000001 3300035112 Bacteria 1459067
193 Ga0373936_0041703 3300035113 Bacteria 1841
194 Ga0373954_0134381 3300035118 Bacteria 1205
195 Ga0373954_0164762 3300035118 Bacteria 1085
196 Ga0373943_0006262 3300035170 Bacteria 5347
197 Ga0373946_0077077 3300035171 Bacteria 1452
198 Ga0373955_0060112 3300035172 Bacteria 2095
199 Ga0373961_0000084 3300035241 Bacteria 50639
200 Ga0373962_0000013 3300035242 Bacteria 49373
201 Ga0373924_0002880 3300035410 Bacteria 5832
202 Ga0373931_0000002 3300035691 Bacteria 599830
203 Ga0373935_0030585 3300035692 Bacteria 3338
204 Ga0373927_0010602 3300035695 Bacteria 6142
205 Ga0373927_0092971 3300035695 Bacteria 1959
206 Ga0373933_0084018 3300035724 Bacteria 1956
207 Ga0373947_0037720 3300035725 Bacteria 2869
208 Ga0310104_04797 3300036242 Eukaryota 1163
209 Ga0373937_0298391 3300036401 Bacteria 1523
210 Ga0310112_011256 3300036458 Eukaryota 1277
211 Ga0372808_012914 3300036459 Eukaryota 1188
212 Ga0310109_011223 3300036534 Eukaryota 1208
213 Ga0310110_012968 3300036535 Eukaryota 1208
214 Ga0310110_020189 3300036535 Eukaryota 923
215 Ga0373925_0002323 3300037068 Bacteria 15297
216 Ga0373925_0060054 3300037068 Bacteria 2854
217 Ga0373925_0225811 3300037068 Bacteria 1496
218 Ga0436365_0638097 3300039437 Eukaryota 847
219 Ga0451846_28745 3300041502 Eukaryota 1115
220 Ga0451850_30012 3300041506 Eukaryota 1080
221 Ga0451854_23194 3300041510 Eukaryota 1109
222 Ga0452268_40115 3300041907 Eukaryota 1108
223 Ga0439458_0028305 3300042157 Unclassified 1326
224 Ga0451577_0008024 3300042876 Bacteria 10304
225 Ga0451577_0348050 3300042876 Bacteria 1344
226 Ga0451576_0001909 3300045051 Bacteria 33390
227 Ga0451576_0160924 3300045051 Bacteria 2343
228 Ga0495592_0304898 3300046454 Bacteria 1034
229 Ga0495629_0096375 3300046459 Bacteria 2064
230 Ga0495653_0057393 3300046463 Bacteria 2963
231 Ga0495582_0062699 3300046473 Bacteria 2054
232 Ga0495639_0047608 3300046475 Bacteria 1943
233 Ga0495639_0063580 3300046475 Bacteria 1694
234 Ga0495639_0316953 3300046475 Bacteria 779
235 Ga0495594_0149419 3300046499 Bacteria 1326
236 Ga0495608_0005521 3300046511 Eukaryota 9031
237 Ga0495608_0198332 3300046511 Bacteria 1265
238 Ga0495628_0088350 3300046516 Bacteria 2402
239 Ga0495630_0000173 3300046517 Bacteria 50167
240 Ga0495666_0048219 3300046526 Bacteria 2052
241 Ga0495665_0120149 3300046531 Bacteria 1376
242 Ga0495587_0298368 3300046536 Bacteria 901
243 Ga0495645_0006871 3300046543 Bacteria 7914
244 Ga0495645_0315652 3300046543 Bacteria 1016
245 Ga0495667_0007614 3300046559 Bacteria 7347
246 Ga0495599_0142619 3300046678 Bacteria 1486
247 Ga0495647_0099471 3300046681 Bacteria 1203
248 Ga0495658_0063757 3300046683 Bacteria 2121
249 Ga0495669_0243876 3300046684 Bacteria 862
250 Ga0495613_0014299 3300046689 Bacteria 5889
251 Ga0495613_0168820 3300046689 Bacteria 1554
252 Ga0495624_0010793 3300046690 Bacteria 6297
253 Ga0495581_0010360 3300047315 Bacteria 5394
254 Ga0495581_0040766 3300047315 Bacteria 2686
255 Ga0495604_0459826 3300047317 Bacteria 830
256 Ga0495674_0018207 3300047319 Bacteria 6540
257 Ga0495674_0089189 3300047319 Bacteria 2636
258 Ga0495684_0014894 3300047471 Bacteria 5988
259 Ga0495684_0129844 3300047471 Bacteria 1893
260 Ga0496101_0499698 3300048904 Bacteria 961
261 Ga0496105_0285066 3300048908 Bacteria 1331
262 Ga0496114_0087073 3300048917 Bacteria 2648
263 Ga0496115_0012627 3300048918 Bacteria 6364
264 Ga0495682_0114156 3300049460 Bacteria 968
265 Ga0501034_0250429 3300049571 Bacteria 1716
266 Ga0501034_0643196 3300049571 Bacteria 963
267 Ga0501075_0022913 3300049591 Bacteria 4567
268 Ga0501076_0022677 3300049592 Bacteria 4827
269 Ga0501081_0045436 3300049743 Bacteria 3016
270 Ga0501045_0180398 3300049824 Bacteria 1573
271 Ga0495601_0004998 3300053077 Bacteria 7694
272 Ga0495601_0146185 3300053077 Bacteria 1543
273 Ga0500635_0006597 3300053080 Bacteria 3106
274 Ga0495595_0035342 3300053084 Bacteria 2264
275 Ga0500647_0119374 3300053091 Bacteria 1249
276 Ga0500566_0000338 3300053094 Bacteria 25497
277 Ga0500566_0035944 3300053094 Bacteria 2876
278 Ga0500595_001241 3300053119 Bacteria 14046
279 Ga0500614_001236 3300053123 Bacteria 6220
280 Ga0500659_0002099 3300053135 Eukaryota 12184
281 Ga0500564_042387 3300053138 Bacteria 2093
282 Ga0500568_0033638 3300053139 Bacteria 2102
283 Ga0500603_077500 3300053150 Bacteria 957
284 Ga0500601_008073 3300053737 Bacteria 1169
285 Ga0501084_0325864 3300054114 Bacteria 1297
286 Ga0530510_0029189 3300061734 Bacteria 3958

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046511 Ga0495608_0005521 Ga0495608_0005521_497_1216 199
2 3300005340 Ga0070689_100109844 Ga0070689_1001098443 209
3 3300025913 Ga0207695_10243318 Ga0207695_102433181 210
4 3300035118 Ga0373954_0164762 Ga0373954_0164762_73_978 213
5 3300046454 Ga0495592_0304898 Ga0495592_0304898_355_1002 213
6 3300013308 Ga0157375_10690769 Ga0157375_106907692 214
7 3300035241 Ga0373961_0000084 Ga0373961_0000084_35459_36235 214
8 3300035089 Ga0373944_0050616 Ga0373944_0050616_20_715 217
9 3300005355 Ga0070671_100038409 Ga0070671_1000384094 218
10 3300006028 Ga0070717_10088552 Ga0070717_100885523 218
11 3300025931 Ga0207644_10124194 Ga0207644_101241943 218
12 3300006844 Ga0075428_100540993 Ga0075428_1005409932 219
13 3300025924 Ga0207694_10289199 Ga0207694_102891993 219
14 3300053139 Ga0500568_0033638 Ga0500568_0033638_95_814 219
15 3300005616 Ga0068852_100375687 Ga0068852_1003756872 220
16 3300009093 Ga0105240_10000373 Ga0105240_1000037321 220
17 3300013307 Ga0157372_10323482 Ga0157372_103234822 220
18 3300020078 Ga0206352_10968355 Ga0206352_109683551 220
19 3300025913 Ga0207695_10000095 Ga0207695_10000095144 220
20 3300026142 Ga0207698_10436923 Ga0207698_104369232 220
21 3300028786 Ga0307517_10059132 Ga0307517_100591321 220
22 3300028800 Ga0265338_10034813 Ga0265338_100348133 220
23 3300031616 Ga0307508_10002654 Ga0307508_100026544 220
24 3300049571 Ga0501034_0643196 Ga0501034_0643196_132_854 220
25 3300005445 Ga0070708_100020473 Ga0070708_1000204732 221
26 3300013307 Ga0157372_10306831 Ga0157372_103068312 221
27 3300028800 Ga0265338_10028156 Ga0265338_100281565 221
28 3300031240 Ga0265320_10181459 Ga0265320_101814592 221
29 3300031344 Ga0265316_10413155 Ga0265316_104131551 221
30 3300035695 Ga0373927_0092971 Ga0373927_0092971_434_1186 221
31 3300035724 Ga0373933_0084018 Ga0373933_0084018_710_1399 221
32 3300048904 Ga0496101_0499698 Ga0496101_0499698_72_833 221
33 3300053077 Ga0495601_0146185 Ga0495601_0146185_822_1511 221
34 3300053094 Ga0500566_0000338 Ga0500566_0000338_20532_21284 221
35 3300053119 Ga0500595_001241 Ga0500595_001241_7846_8598 221
36 3300053123 Ga0500614_001236 Ga0500614_001236_196_948 221
37 3300053138 Ga0500564_042387 Ga0500564_042387_282_1034 221
38 3300053737 Ga0500601_008073 Ga0500601_008073_119_871 221
39 3300013297 Ga0157378_10026178 Ga0157378_100261784 222
40 3300028577 Ga0265318_10000302 Ga0265318_1000030213 222
41 3300028577 Ga0265318_10001820 Ga0265318_100018205 222
42 3300028800 Ga0265338_10073068 Ga0265338_100730683 222
43 3300031235 Ga0265330_10000072 Ga0265330_1000007228 222
44 3300031238 Ga0265332_10000194 Ga0265332_1000019413 222
45 3300031239 Ga0265328_10004211 Ga0265328_100042112 222
46 3300031240 Ga0265320_10000038 Ga0265320_1000003872 222
47 3300031241 Ga0265325_10001826 Ga0265325_100018268 222
48 3300031242 Ga0265329_10000104 Ga0265329_1000010412 222
49 3300031247 Ga0265340_10017527 Ga0265340_100175273 222
50 3300031247 Ga0265340_10084111 Ga0265340_100841112 222
51 3300031249 Ga0265339_10002870 Ga0265339_1000287010 222
52 3300031250 Ga0265331_10000421 Ga0265331_100004219 222
53 3300031250 Ga0265331_10055255 Ga0265331_100552552 222
54 3300031344 Ga0265316_10000930 Ga0265316_1000093013 222
55 3300031344 Ga0265316_10000951 Ga0265316_100009513 222
56 3300031595 Ga0265313_10000311 Ga0265313_1000031121 222
57 3300031595 Ga0265313_10003693 Ga0265313_100036935 222
58 3300031711 Ga0265314_10000114 Ga0265314_1000011472 222
59 3300031711 Ga0265314_10157330 Ga0265314_101573302 222
60 3300031712 Ga0265342_10000268 Ga0265342_1000026813 222
61 3300031712 Ga0265342_10028678 Ga0265342_100286782 222
62 3300053080 Ga0500635_0006597 Ga0500635_0006597_2242_3000 222
63 3300053091 Ga0500647_0119374 Ga0500647_0119374_85_843 222
64 3300053150 Ga0500603_077500 Ga0500603_077500_118_876 222
65 3300005354 Ga0070675_100120275 Ga0070675_1001202752 223
66 3300005364 Ga0070673_100114714 Ga0070673_1001147142 223
67 3300005843 Ga0068860_100686535 Ga0068860_1006865351 223
68 3300009101 Ga0105247_10003883 Ga0105247_100038833 223
69 3300025900 Ga0207710_10005830 Ga0207710_100058302 223
70 3300028381 Ga0268264_10905705 Ga0268264_109057051 223
71 3300036401 Ga0373937_0298391 Ga0373937_0298391_352_1050 223
72 3300042157 Ga0439458_0028305 Ga0439458_0028305_303_1034 223
73 3300045051 Ga0451576_0001909 Ga0451576_0001909_11324_12064 223
74 3300049460 Ga0495682_0114156 Ga0495682_0114156_191_919 223
75 3300003479 Ga0006556J51387_1003553 Ga0006556J51387_10035532 224
76 3300003556 Ga0006557J51388_1004214 Ga0006557J51388_10042141 224
77 3300003558 Ga0006558J51389_1003221 Ga0006558J51389_10032211 224
78 3300003560 Ga0006559J51393_1004630 Ga0006559J51393_10046301 224
79 3300003561 Ga0006553J51392_1004328 Ga0006553J51392_10043281 224
80 3300003564 Ga0006555J51386_1003708 Ga0006555J51386_10037081 224
81 3300003565 Ga0006560J51390_1003455 Ga0006560J51390_10034551 224
82 3300003567 Ga0006554J51385_1003746 Ga0006554J51385_10037461 224
83 3300005354 Ga0070675_100059686 Ga0070675_1000596862 224
84 3300005364 Ga0070673_100076345 Ga0070673_1000763453 224
85 3300005456 Ga0070678_100302556 Ga0070678_1003025562 224
86 3300005535 Ga0070684_100184070 Ga0070684_1001840702 224
87 3300005548 Ga0070665_100006064 Ga0070665_1000060649 224
88 3300006163 Ga0070715_10047791 Ga0070715_100477912 224
89 3300009098 Ga0105245_10011594 Ga0105245_100115944 224
90 3300009147 Ga0114129_10555791 Ga0114129_105557912 224
91 3300023553 Ga0247524_104997 Ga0247524_1049971 224
92 3300023556 Ga0247519_106376 Ga0247519_1063761 224
93 3300023558 Ga0247526_104433 Ga0247526_1044331 224
94 3300023560 Ga0247514_107770 Ga0247514_1077701 224
95 3300023561 Ga0247518_111106 Ga0247518_1111061 224
96 3300023562 Ga0247516_107874 Ga0247516_1078741 224
97 3300023563 Ga0247530_104542 Ga0247530_1045421 224
98 3300023564 Ga0247515_108299 Ga0247515_1082991 224
99 3300023664 Ga0247527_104723 Ga0247527_1047231 224
100 3300023666 Ga0247531_105065 Ga0247531_1050651 224
101 3300023668 Ga0247525_106157 Ga0247525_1061571 224
102 3300023680 Ga0247528_104468 Ga0247528_1044681 224
103 3300023686 Ga0247520_105991 Ga0247520_1059911 224
104 3300023688 Ga0247522_106368 Ga0247522_1063681 224
105 3300023689 Ga0247517_106691 Ga0247517_1066911 224
106 3300023690 Ga0247512_108133 Ga0247512_1081331 224
107 3300025909 Ga0207705_10556804 Ga0207705_105568041 224
108 3300025927 Ga0207687_10034186 Ga0207687_100341862 224
109 3300025931 Ga0207644_10129649 Ga0207644_101296492 224
110 3300025944 Ga0207661_10322883 Ga0207661_103228832 224
111 3300026121 Ga0207683_10308875 Ga0207683_103088751 224
112 3300028379 Ga0268266_10003387 Ga0268266_1000338715 224
113 3300031456 Ga0307513_10438890 Ga0307513_104388902 224
114 3300031591 Ga0310116_106038 Ga0310116_1060381 224
115 3300031592 Ga0310117_107224 Ga0310117_1072241 224
116 3300031614 Ga0310103_111680 Ga0310103_1116801 224
117 3300031632 Ga0310102_102086 Ga0310102_1020861 224
118 3300031634 Ga0310106_104006 Ga0310106_1040061 224
119 3300031635 Ga0310115_109021 Ga0310115_1090211 224
120 3300031636 Ga0310113_108323 Ga0310113_1083231 224
121 3300031664 Ga0310118_104834 Ga0310118_1048341 224
122 3300031666 Ga0310105_107067 Ga0310105_1070671 224
123 3300031667 Ga0310111_110433 Ga0310111_1104331 224
124 3300031678 Ga0310114_106579 Ga0310114_1065792 224
125 3300031686 Ga0310119_108583 Ga0310119_1085831 224
126 3300031730 Ga0307516_10028540 Ga0307516_100285404 224
127 3300031815 Ga0316045_108708 Ga0316045_1087081 224
128 3300031816 Ga0316042_111457 Ga0316042_1114571 224
129 3300036242 Ga0310104_04797 Ga0310104_04797_10_870 224
130 3300036458 Ga0310112_011256 Ga0310112_011256_339_1205 224
131 3300036459 Ga0372808_012914 Ga0372808_012914_259_1119 224
132 3300036534 Ga0310109_011223 Ga0310109_011223_81_941 224
133 3300036535 Ga0310110_012968 Ga0310110_012968_78_938 224
134 3300041506 Ga0451850_30012 Ga0451850_30012_38_850 224
135 3300053135 Ga0500659_0002099 Ga0500659_0002099_11329_12150 224
136 3300005340 Ga0070689_100018395 Ga0070689_1000183954 225
137 3300005341 Ga0070691_10262493 Ga0070691_102624932 225
138 3300005445 Ga0070708_100001771 Ga0070708_10000177111 225
139 3300005518 Ga0070699_100129723 Ga0070699_1001297233 225
140 3300005536 Ga0070697_100145884 Ga0070697_1001458843 225
141 3300006028 Ga0070717_10036999 Ga0070717_100369992 225
142 3300006173 Ga0070716_100404185 Ga0070716_1004041851 225
143 3300006237 Ga0097621_100006536 Ga0097621_1000065368 225
144 3300006358 Ga0068871_100003445 Ga0068871_1000034452 225
145 3300023686 Ga0247520_108329 Ga0247520_1083292 225
146 3300025906 Ga0207699_10066990 Ga0207699_100669903 225
147 3300025910 Ga0207684_10141056 Ga0207684_101410562 225
148 3300025939 Ga0207665_10492249 Ga0207665_104922491 225
149 3300035111 Ga0373923_0136859 Ga0373923_0136859_191_916 225
150 3300036535 Ga0310110_020189 Ga0310110_020189_37_780 225
151 3300041502 Ga0451846_28745 Ga0451846_28745_63_884 225
152 3300041510 Ga0451854_23194 Ga0451854_23194_211_1032 225
153 3300041907 Ga0452268_40115 Ga0452268_40115_21_821 225
154 3300042876 Ga0451577_0348050 Ga0451577_0348050_211_963 225
155 3300046459 Ga0495629_0096375 Ga0495629_0096375_499_1224 225
156 3300046475 Ga0495639_0047608 Ga0495639_0047608_465_1202 225
157 3300046475 Ga0495639_0316953 Ga0495639_0316953_11_736 225
158 3300046511 Ga0495608_0198332 Ga0495608_0198332_451_1176 225
159 3300046536 Ga0495587_0298368 Ga0495587_0298368_109_834 225
160 3300046543 Ga0495645_0006871 Ga0495645_0006871_232_957 225
161 3300046543 Ga0495645_0315652 Ga0495645_0315652_21_746 225
162 3300046559 Ga0495667_0007614 Ga0495667_0007614_1886_2611 225
163 3300046683 Ga0495658_0063757 Ga0495658_0063757_35_760 225
164 3300046684 Ga0495669_0243876 Ga0495669_0243876_49_765 225
165 3300046689 Ga0495613_0014299 Ga0495613_0014299_2644_3369 225
166 3300047315 Ga0495581_0040766 Ga0495581_0040766_1532_2260 225
167 3300047317 Ga0495604_0459826 Ga0495604_0459826_39_764 225
168 3300047319 Ga0495674_0018207 Ga0495674_0018207_5235_5960 225
169 3300047471 Ga0495684_0014894 Ga0495684_0014894_1895_2620 225
170 3300049571 Ga0501034_0250429 Ga0501034_0250429_389_1123 225
171 3300049591 Ga0501075_0022913 Ga0501075_0022913_1903_2631 225
172 3300049592 Ga0501076_0022677 Ga0501076_0022677_3945_4673 225
173 3300049743 Ga0501081_0045436 Ga0501081_0045436_2179_2907 225
174 3300049824 Ga0501045_0180398 Ga0501045_0180398_517_1245 225
175 3300053077 Ga0495601_0004998 Ga0495601_0004998_2732_3457 225
176 3300053084 Ga0495595_0035342 Ga0495595_0035342_535_1260 225
177 3300053094 Ga0500566_0035944 Ga0500566_0035944_105_902 225
178 3300054114 Ga0501084_0325864 Ga0501084_0325864_56_784 225
179 3300061734 Ga0530510_0029189 Ga0530510_0029189_241_969 225
180 3300005335 Ga0070666_10287107 Ga0070666_102871071 226
181 3300005344 Ga0070661_100039955 Ga0070661_1000399553 226
182 3300005617 Ga0068859_100312061 Ga0068859_1003120611 226
183 3300006931 Ga0097620_100312044 Ga0097620_1003120441 226
184 3300014968 Ga0157379_10239189 Ga0157379_102391893 226
185 3300025920 Ga0207649_10026229 Ga0207649_100262292 226
186 3300025986 Ga0207658_10033582 Ga0207658_100335822 226
187 3300028563 Ga0265319_1000600 Ga0265319_10006003 226
188 3300028800 Ga0265338_10179325 Ga0265338_101793252 226
189 3300031240 Ga0265320_10001826 Ga0265320_1000182611 226
190 3300048908 Ga0496105_0285066 Ga0496105_0285066_594_1301 226
191 3300048917 Ga0496114_0087073 Ga0496114_0087073_1343_2092 226
192 3300005356 Ga0070674_100158906 Ga0070674_1001589062 227
193 3300005439 Ga0070711_100539058 Ga0070711_1005390582 227
194 3300025941 Ga0207711_10739997 Ga0207711_107399971 227
195 3300031239 Ga0265328_10068364 Ga0265328_100683642 227
196 3300032004 Ga0307414_10868463 Ga0307414_108684631 227
197 3300034816 Ga0373930_0000113 Ga0373930_0000113_4715_5467 227
198 3300035084 Ga0373928_0000122 Ga0373928_0000122_13657_14409 227
199 3300035085 Ga0373929_0000570 Ga0373929_0000570_5202_5954 227
200 3300035090 Ga0373949_0001330 Ga0373949_0001330_1373_2125 227
201 3300035091 Ga0373951_0006768 Ga0373951_0006768_1842_2594 227
202 3300035111 Ga0373923_0029596 Ga0373923_0029596_453_1172 227
203 3300035112 Ga0373932_0000001 Ga0373932_0000001_1268631_1269383 227
204 3300035113 Ga0373936_0041703 Ga0373936_0041703_344_1063 227
205 3300035118 Ga0373954_0134381 Ga0373954_0134381_346_1065 227
206 3300035170 Ga0373943_0006262 Ga0373943_0006262_4229_4948 227
207 3300035171 Ga0373946_0077077 Ga0373946_0077077_609_1328 227
208 3300035172 Ga0373955_0060112 Ga0373955_0060112_746_1465 227
209 3300035242 Ga0373962_0000013 Ga0373962_0000013_2605_3357 227
210 3300035410 Ga0373924_0002880 Ga0373924_0002880_1163_1882 227
211 3300035691 Ga0373931_0000002 Ga0373931_0000002_226015_226767 227
212 3300035692 Ga0373935_0030585 Ga0373935_0030585_2438_3157 227
213 3300035695 Ga0373927_0010602 Ga0373927_0010602_1748_2500 227
214 3300035725 Ga0373947_0037720 Ga0373947_0037720_1369_2088 227
215 3300037068 Ga0373925_0002323 Ga0373925_0002323_5786_6538 227
216 3300037068 Ga0373925_0060054 Ga0373925_0060054_1858_2577 227
217 3300037068 Ga0373925_0225811 Ga0373925_0225811_681_1397 227
218 3300039437 Ga0436365_0638097 Ga0436365_0638097_88_834 227
219 3300046463 Ga0495653_0057393 Ga0495653_0057393_672_1391 227
220 3300046475 Ga0495639_0063580 Ga0495639_0063580_671_1390 227
221 3300046516 Ga0495628_0088350 Ga0495628_0088350_1573_2292 227
222 3300046517 Ga0495630_0000173 Ga0495630_0000173_2058_2777 227
223 3300046526 Ga0495666_0048219 Ga0495666_0048219_484_1203 227
224 3300046531 Ga0495665_0120149 Ga0495665_0120149_43_762 227
225 3300046678 Ga0495599_0142619 Ga0495599_0142619_34_753 227
226 3300046689 Ga0495613_0168820 Ga0495613_0168820_695_1414 227
227 3300046690 Ga0495624_0010793 Ga0495624_0010793_248_967 227
228 3300047315 Ga0495581_0010360 Ga0495581_0010360_1028_1747 227
229 3300047319 Ga0495674_0089189 Ga0495674_0089189_1381_2100 227
230 3300047471 Ga0495684_0129844 Ga0495684_0129844_684_1403 227
231 3300003320 rootH2_10003144 rootH2_100031445 228
232 3300005334 Ga0068869_100031096 Ga0068869_1000310962 228
233 3300005338 Ga0068868_100413324 Ga0068868_1004133242 228
234 3300005340 Ga0070689_100074199 Ga0070689_1000741992 228
235 3300005364 Ga0070673_100309159 Ga0070673_1003091592 228
236 3300005438 Ga0070701_10003865 Ga0070701_100038654 228
237 3300005444 Ga0070694_100014573 Ga0070694_1000145734 228
238 3300005445 Ga0070708_100225626 Ga0070708_1002256262 228
239 3300005467 Ga0070706_100112149 Ga0070706_1001121492 228
240 3300005468 Ga0070707_100068082 Ga0070707_1000680823 228
241 3300005468 Ga0070707_100604651 Ga0070707_1006046511 228
242 3300005544 Ga0070686_100012074 Ga0070686_1000120743 228
243 3300005544 Ga0070686_100103683 Ga0070686_1001036832 228
244 3300005548 Ga0070665_100034155 Ga0070665_1000341552 228
245 3300005563 Ga0068855_100053069 Ga0068855_1000530692 228
246 3300005614 Ga0068856_100003612 Ga0068856_1000036124 228
247 3300005617 Ga0068859_100370761 Ga0068859_1003707612 228
248 3300006237 Ga0097621_100420438 Ga0097621_1004204382 228
249 3300006847 Ga0075431_100011781 Ga0075431_1000117813 228
250 3300006881 Ga0068865_100105050 Ga0068865_1001050502 228
251 3300006881 Ga0068865_100117527 Ga0068865_1001175273 228
252 3300006931 Ga0097620_100370804 Ga0097620_1003708041 228
253 3300009093 Ga0105240_10119296 Ga0105240_101192964 228
254 3300009098 Ga0105245_10226572 Ga0105245_102265723 228
255 3300009176 Ga0105242_10060832 Ga0105242_100608322 228
256 3300009176 Ga0105242_10162484 Ga0105242_101624842 228
257 3300009177 Ga0105248_10282731 Ga0105248_102827313 228
258 3300013306 Ga0163162_10144285 Ga0163162_101442852 228
259 3300014969 Ga0157376_10037219 Ga0157376_100372192 228
260 3300025910 Ga0207684_10030523 Ga0207684_100305232 228
261 3300025913 Ga0207695_10137561 Ga0207695_101375614 228
262 3300025922 Ga0207646_10041039 Ga0207646_100410392 228
263 3300025927 Ga0207687_10031889 Ga0207687_100318892 228
264 3300025934 Ga0207686_10080621 Ga0207686_100806212 228
265 3300025934 Ga0207686_10254334 Ga0207686_102543342 228
266 3300025935 Ga0207709_10053191 Ga0207709_100531912 228
267 3300025937 Ga0207669_10458795 Ga0207669_104587952 228
268 3300025938 Ga0207704_10122624 Ga0207704_101226242 228
269 3300025941 Ga0207711_10110021 Ga0207711_101100212 228
270 3300025942 Ga0207689_10398230 Ga0207689_103982301 228
271 3300025949 Ga0207667_10077254 Ga0207667_100772542 228
272 3300025949 Ga0207667_10096732 Ga0207667_100967324 228
273 3300026023 Ga0207677_10150592 Ga0207677_101505922 228
274 3300026078 Ga0207702_10002632 Ga0207702_100026326 228
275 3300026089 Ga0207648_10009972 Ga0207648_100099722 228
276 3300026121 Ga0207683_10111707 Ga0207683_101117072 228
277 3300028379 Ga0268266_10060609 Ga0268266_100606092 228
278 3300028556 Ga0265337_1016361 Ga0265337_10163615 228
279 3300028666 Ga0265336_10024656 Ga0265336_100246564 228
280 3300031240 Ga0265320_10001277 Ga0265320_100012776 228
281 3300042876 Ga0451577_0008024 Ga0451577_0008024_6399_7109 228
282 3300045051 Ga0451576_0160924 Ga0451576_0160924_236_946 228
283 3300046473 Ga0495582_0062699 Ga0495582_0062699_707_1426 228
284 3300046499 Ga0495594_0149419 Ga0495594_0149419_180_929 228
285 3300046681 Ga0495647_0099471 Ga0495647_0099471_382_1101 228
286 3300048918 Ga0496115_0012627 Ga0496115_0012627_4684_5427 228

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02492

cobW

CobW/HypB/UreG, nucleotide-binding domain

49

221

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xkt-assembly1.cif.gz_B klebsiella pneumoniae ureg in complex with gmppnp and nickel 0.9401 24 214
4hi0-assembly1.cif.gz_F crystal structure of helicobacter pylori urease accessory protein uref/h/g complex 0.9281 26 215
5xkt-assembly1.cif.gz_B klebsiella pneumoniae ureg in complex with gmppnp and nickel 0.8991 24 214
4hi0-assembly1.cif.gz_F crystal structure of helicobacter pylori urease accessory protein uref/h/g complex 0.8965 26 215
2hf9-assembly1.cif.gz_A crystal structure of hypb from methanocaldococcus jannaschii in the triphosphate form 0.8947 22 219
ID Description Score Start End Superfamily
af_O64700_71_266_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9464 24 218 3.40.50.300
af_O64700_71_266_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9371 24 218 3.40.50.300
2wsmA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8396 22 218 3.40.50.300
af_Q57584_1_187_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8111 26 215 3.40.50.300
af_P0AAN3_68_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7922 22 218 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A6N6PVS4-F1-model_v4 Urease accessory protein UreG 0.9542 6 228 GO:0003924
GO:0005525
GO:0005737
GO:0016151
GO:0043419
AF-Q095M1-F1-model_v4 Urease accessory protein UreG 0.9539 6 225 GO:0003924
GO:0005525
GO:0016151
GO:0043419
AF-A0A3B8L059-F1-model_v4 Urease accessory protein UreG 0.9513 18 223 GO:0003924
GO:0005525
GO:0016151
GO:0043419
AF-A0A5B1BG10-F1-model_v4 Urease accessory protein UreG 0.9501 7 228 GO:0003924
GO:0005525
GO:0005737
GO:0016151
GO:0043419
AF-A0A803MDI2-F1-model_v4 CobW/HypB/UreG nucleotide-binding domain-containing protein 0.9486 4 223 GO:0003924
GO:0005525
GO:0016151
GO:0043419

Feature Viewer

pLDDT pTM Quality
84.21 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map