F387709
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 286 | 222 | 286 | 238 |
Family's Representative Sequence
| Representative Sequence | 3300053135|Ga0500659_0002099|Ga0500659_0002099_11329_12150 |
| Length | 266 |
| Sequence | MATHSHDGSAPHFNAQEHGHAHEILDGPGSYIGREMPITEGRQWGTRAFTVGIGGPVGSGKTALMLALCMALRSRYNIAAVTNDIFTREDAEFLTRNRALPADRIRAIETGGCPHAAVREDISANLAALEDLHVEFNTDLLLIESGGDNLAANYSRELADYIIYVIDVSGGDKIPRKGGPGITQSDLLVVNKTDLAEAVGADLGVMERDARKMREGGPTVFAQVKKDVGVDHIVNLILSAWRASGAEEVQKSRGGPTATPGLDALK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 3300003479 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 3 | 3300003556 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_09_fullP_nobac_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 4 | 3300003558 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_10_fullP_mix1_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 5 | 3300003560 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_13_lowP_nobac_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 6 | 3300003561 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_01_fullP_nobac_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300003564 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_05_lowP_nobac_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003565 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300003567 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 36 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 37 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 42 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 43 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 44 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 45 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 59 | 3300023553 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 60 | 3300023556 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 61 | 3300023558 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 62 | 3300023560 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 63 | 3300023561 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 64 | 3300023562 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 65 | 3300023563 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 66 | 3300023564 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 67 | 3300023664 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 68 | 3300023666 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 69 | 3300023668 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 70 | 3300023680 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 71 | 3300023686 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 72 | 3300023688 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 73 | 3300023689 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 74 | 3300023690 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 75 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 103 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 104 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 105 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 106 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 107 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 108 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 109 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 110 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 111 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 112 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 113 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 114 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 115 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 116 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 117 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 118 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 119 | 3300031591 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 120 | 3300031592 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 121 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 122 | 3300031614 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 123 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 124 | 3300031632 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 125 | 3300031634 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 126 | 3300031635 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 127 | 3300031636 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 128 | 3300031664 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 129 | 3300031666 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 130 | 3300031667 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 131 | 3300031678 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 132 | 3300031686 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 133 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 134 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 135 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 136 | 3300031815 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 137 | 3300031816 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 138 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 139 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 140 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 141 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 142 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 143 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 144 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 145 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 146 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 147 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 148 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 149 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 150 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 151 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 152 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 153 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 154 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 155 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 156 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 157 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 158 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 159 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 160 | 3300036242 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 161 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 162 | 3300036458 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 163 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 164 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 165 | 3300036535 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 166 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 167 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 168 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 169 | 3300041506 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT | Metatranscriptome | Unclassified |
| 170 | 3300041510 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT | Metatranscriptome | Unclassified |
| 171 | 3300041907 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run | Metatranscriptome | Unclassified |
| 172 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 173 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 174 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 175 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 201 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 202 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 203 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 211 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 213 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 214 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 215 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 216 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 217 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 218 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 219 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 220 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 221 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.52 |
| Metatranscriptomes | 17.48 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.85 |
| Nodule | 0 |
| Rhizoplane | 1.4 |
| Rhizosphere | 78.32 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10003144 | 3300003320 | Bacteria | 4984 |
| 2 | Ga0006556J51387_1003553 | 3300003479 | Eukaryota | 1190 |
| 3 | Ga0006557J51388_1004214 | 3300003556 | Eukaryota | 1050 |
| 4 | Ga0006558J51389_1003221 | 3300003558 | Eukaryota | 1060 |
| 5 | Ga0006559J51393_1004630 | 3300003560 | Eukaryota | 1120 |
| 6 | Ga0006553J51392_1004328 | 3300003561 | Eukaryota | 1241 |
| 7 | Ga0006555J51386_1003708 | 3300003564 | Eukaryota | 1150 |
| 8 | Ga0006560J51390_1003455 | 3300003565 | Eukaryota | 1520 |
| 9 | Ga0006554J51385_1003746 | 3300003567 | Eukaryota | 1072 |
| 10 | Ga0068869_100031096 | 3300005334 | Bacteria | 3754 |
| 11 | Ga0070666_10287107 | 3300005335 | Bacteria | 1170 |
| 12 | Ga0068868_100413324 | 3300005338 | Bacteria | 1166 |
| 13 | Ga0070689_100018395 | 3300005340 | Bacteria | 5146 |
| 14 | Ga0070689_100074199 | 3300005340 | Bacteria | 2662 |
| 15 | Ga0070689_100109844 | 3300005340 | Bacteria | 2192 |
| 16 | Ga0070691_10262493 | 3300005341 | Bacteria | 930 |
| 17 | Ga0070661_100039955 | 3300005344 | Bacteria | 3420 |
| 18 | Ga0070675_100059686 | 3300005354 | Bacteria | 3147 |
| 19 | Ga0070675_100120275 | 3300005354 | Bacteria | 2231 |
| 20 | Ga0070671_100038409 | 3300005355 | Bacteria | 3974 |
| 21 | Ga0070674_100158906 | 3300005356 | Bacteria | 1713 |
| 22 | Ga0070673_100076345 | 3300005364 | Bacteria | 2705 |
| 23 | Ga0070673_100114714 | 3300005364 | Bacteria | 2239 |
| 24 | Ga0070673_100309159 | 3300005364 | Bacteria | 1394 |
| 25 | Ga0070701_10003865 | 3300005438 | Bacteria | 5982 |
| 26 | Ga0070711_100539058 | 3300005439 | Bacteria | 967 |
| 27 | Ga0070694_100014573 | 3300005444 | Bacteria | 4922 |
| 28 | Ga0070708_100001771 | 3300005445 | Bacteria | 16584 |
| 29 | Ga0070708_100020473 | 3300005445 | Bacteria | 5578 |
| 30 | Ga0070708_100225626 | 3300005445 | Bacteria | 1757 |
| 31 | Ga0070678_100302556 | 3300005456 | Bacteria | 1359 |
| 32 | Ga0070706_100112149 | 3300005467 | Bacteria | 2538 |
| 33 | Ga0070707_100068082 | 3300005468 | Bacteria | 3425 |
| 34 | Ga0070707_100604651 | 3300005468 | Bacteria | 1059 |
| 35 | Ga0070699_100129723 | 3300005518 | Bacteria | 2222 |
| 36 | Ga0070684_100184070 | 3300005535 | Bacteria | 1899 |
| 37 | Ga0070697_100145884 | 3300005536 | Bacteria | 1992 |
| 38 | Ga0070686_100012074 | 3300005544 | Bacteria | 4913 |
| 39 | Ga0070686_100103683 | 3300005544 | Bacteria | 1925 |
| 40 | Ga0070665_100006064 | 3300005548 | Bacteria | 12354 |
| 41 | Ga0070665_100034155 | 3300005548 | Bacteria | 5114 |
| 42 | Ga0068855_100053069 | 3300005563 | Bacteria | 4770 |
| 43 | Ga0068856_100003612 | 3300005614 | Bacteria | 15553 |
| 44 | Ga0068852_100375687 | 3300005616 | Bacteria | 1393 |
| 45 | Ga0068859_100312061 | 3300005617 | Bacteria | 1666 |
| 46 | Ga0068859_100370761 | 3300005617 | Bacteria | 1527 |
| 47 | Ga0068860_100686535 | 3300005843 | Bacteria | 1033 |
| 48 | Ga0070717_10036999 | 3300006028 | Bacteria | 3961 |
| 49 | Ga0070717_10088552 | 3300006028 | Bacteria | 2610 |
| 50 | Ga0070715_10047791 | 3300006163 | Bacteria | 1826 |
| 51 | Ga0070716_100404185 | 3300006173 | Bacteria | 983 |
| 52 | Ga0097621_100006536 | 3300006237 | Bacteria | 8284 |
| 53 | Ga0097621_100420438 | 3300006237 | Bacteria | 1199 |
| 54 | Ga0068871_100003445 | 3300006358 | Bacteria | 10873 |
| 55 | Ga0075428_100540993 | 3300006844 | Bacteria | 1245 |
| 56 | Ga0075431_100011781 | 3300006847 | Bacteria | 8823 |
| 57 | Ga0068865_100105050 | 3300006881 | Bacteria | 2074 |
| 58 | Ga0068865_100117527 | 3300006881 | Bacteria | 1971 |
| 59 | Ga0097620_100312044 | 3300006931 | Bacteria | 1666 |
| 60 | Ga0097620_100370804 | 3300006931 | Bacteria | 1527 |
| 61 | Ga0105240_10000373 | 3300009093 | Bacteria | 84033 |
| 62 | Ga0105240_10119296 | 3300009093 | Bacteria | 3178 |
| 63 | Ga0105245_10011594 | 3300009098 | Bacteria | 7678 |
| 64 | Ga0105245_10226572 | 3300009098 | Bacteria | 1806 |
| 65 | Ga0105247_10003883 | 3300009101 | Bacteria | 9656 |
| 66 | Ga0114129_10555791 | 3300009147 | Bacteria | 1492 |
| 67 | Ga0105242_10060832 | 3300009176 | Bacteria | 3105 |
| 68 | Ga0105242_10162484 | 3300009176 | Bacteria | 1956 |
| 69 | Ga0105248_10282731 | 3300009177 | Bacteria | 1868 |
| 70 | Ga0157378_10026178 | 3300013297 | Bacteria | 5142 |
| 71 | Ga0163162_10144285 | 3300013306 | Bacteria | 2495 |
| 72 | Ga0157372_10306831 | 3300013307 | Bacteria | 1847 |
| 73 | Ga0157372_10323482 | 3300013307 | Bacteria | 1796 |
| 74 | Ga0157375_10690769 | 3300013308 | Bacteria | 1175 |
| 75 | Ga0157379_10239189 | 3300014968 | Bacteria | 1647 |
| 76 | Ga0157376_10037219 | 3300014969 | Bacteria | 3947 |
| 77 | Ga0206352_10968355 | 3300020078 | Eukaryota | 1125 |
| 78 | Ga0247524_104997 | 3300023553 | Eukaryota | 1175 |
| 79 | Ga0247519_106376 | 3300023556 | Eukaryota | 1141 |
| 80 | Ga0247526_104433 | 3300023558 | Eukaryota | 1346 |
| 81 | Ga0247514_107770 | 3300023560 | Eukaryota | 1223 |
| 82 | Ga0247518_111106 | 3300023561 | Eukaryota | 917 |
| 83 | Ga0247516_107874 | 3300023562 | Eukaryota | 1175 |
| 84 | Ga0247530_104542 | 3300023563 | Eukaryota | 1233 |
| 85 | Ga0247515_108299 | 3300023564 | Eukaryota | 1151 |
| 86 | Ga0247527_104723 | 3300023664 | Eukaryota | 1140 |
| 87 | Ga0247531_105065 | 3300023666 | Eukaryota | 1221 |
| 88 | Ga0247525_106157 | 3300023668 | Eukaryota | 1179 |
| 89 | Ga0247528_104468 | 3300023680 | Eukaryota | 1159 |
| 90 | Ga0247520_105991 | 3300023686 | Eukaryota | 1191 |
| 91 | Ga0247520_108329 | 3300023686 | Eukaryota | 958 |
| 92 | Ga0247522_106368 | 3300023688 | Eukaryota | 1178 |
| 93 | Ga0247517_106691 | 3300023689 | Eukaryota | 1185 |
| 94 | Ga0247512_108133 | 3300023690 | Eukaryota | 1163 |
| 95 | Ga0207710_10005830 | 3300025900 | Bacteria | 5283 |
| 96 | Ga0207699_10066990 | 3300025906 | Bacteria | 2181 |
| 97 | Ga0207705_10556804 | 3300025909 | Bacteria | 891 |
| 98 | Ga0207684_10030523 | 3300025910 | Bacteria | 4587 |
| 99 | Ga0207684_10141056 | 3300025910 | Bacteria | 2071 |
| 100 | Ga0207695_10000095 | 3300025913 | Bacteria | 265435 |
| 101 | Ga0207695_10137561 | 3300025913 | Bacteria | 2394 |
| 102 | Ga0207695_10243318 | 3300025913 | Bacteria | 1700 |
| 103 | Ga0207649_10026229 | 3300025920 | Bacteria | 3407 |
| 104 | Ga0207646_10041039 | 3300025922 | Bacteria | 4161 |
| 105 | Ga0207694_10289199 | 3300025924 | Bacteria | 1348 |
| 106 | Ga0207687_10031889 | 3300025927 | Bacteria | 3565 |
| 107 | Ga0207687_10034186 | 3300025927 | Bacteria | 3451 |
| 108 | Ga0207644_10124194 | 3300025931 | Bacteria | 1968 |
| 109 | Ga0207644_10129649 | 3300025931 | Bacteria | 1929 |
| 110 | Ga0207686_10080621 | 3300025934 | Bacteria | 2122 |
| 111 | Ga0207686_10254334 | 3300025934 | Bacteria | 1285 |
| 112 | Ga0207709_10053191 | 3300025935 | Bacteria | 2491 |
| 113 | Ga0207669_10458795 | 3300025937 | Bacteria | 1011 |
| 114 | Ga0207704_10122624 | 3300025938 | Bacteria | 1782 |
| 115 | Ga0207665_10492249 | 3300025939 | Bacteria | 946 |
| 116 | Ga0207711_10110021 | 3300025941 | Bacteria | 2449 |
| 117 | Ga0207711_10739997 | 3300025941 | Bacteria | 917 |
| 118 | Ga0207689_10398230 | 3300025942 | Bacteria | 1147 |
| 119 | Ga0207661_10322883 | 3300025944 | Bacteria | 1388 |
| 120 | Ga0207667_10077254 | 3300025949 | Bacteria | 3453 |
| 121 | Ga0207667_10096732 | 3300025949 | Bacteria | 3047 |
| 122 | Ga0207658_10033582 | 3300025986 | Bacteria | 3661 |
| 123 | Ga0207677_10150592 | 3300026023 | Bacteria | 1794 |
| 124 | Ga0207702_10002632 | 3300026078 | Bacteria | 16856 |
| 125 | Ga0207648_10009972 | 3300026089 | Bacteria | 9043 |
| 126 | Ga0207683_10111707 | 3300026121 | Bacteria | 2447 |
| 127 | Ga0207683_10308875 | 3300026121 | Bacteria | 1447 |
| 128 | Ga0207698_10436923 | 3300026142 | Bacteria | 1260 |
| 129 | Ga0268266_10003387 | 3300028379 | Bacteria | 15955 |
| 130 | Ga0268266_10060609 | 3300028379 | Bacteria | 3262 |
| 131 | Ga0268264_10905705 | 3300028381 | Bacteria | 885 |
| 132 | Ga0265337_1016361 | 3300028556 | Bacteria | 2399 |
| 133 | Ga0265319_1000600 | 3300028563 | Bacteria | 24070 |
| 134 | Ga0265318_10000302 | 3300028577 | Bacteria | 39987 |
| 135 | Ga0265318_10001820 | 3300028577 | Bacteria | 12085 |
| 136 | Ga0265336_10024656 | 3300028666 | Bacteria | 1898 |
| 137 | Ga0307517_10059132 | 3300028786 | Bacteria | 3677 |
| 138 | Ga0265338_10028156 | 3300028800 | Bacteria | 5613 |
| 139 | Ga0265338_10034813 | 3300028800 | Bacteria | 4856 |
| 140 | Ga0265338_10073068 | 3300028800 | Bacteria | 2925 |
| 141 | Ga0265338_10179325 | 3300028800 | Bacteria | 1617 |
| 142 | Ga0265330_10000072 | 3300031235 | Bacteria | 87680 |
| 143 | Ga0265332_10000194 | 3300031238 | Bacteria | 49527 |
| 144 | Ga0265328_10004211 | 3300031239 | Bacteria | 6263 |
| 145 | Ga0265328_10068364 | 3300031239 | Bacteria | 1305 |
| 146 | Ga0265320_10000038 | 3300031240 | Bacteria | 135648 |
| 147 | Ga0265320_10001277 | 3300031240 | Bacteria | 18392 |
| 148 | Ga0265320_10001826 | 3300031240 | Bacteria | 15098 |
| 149 | Ga0265320_10181459 | 3300031240 | Bacteria | 943 |
| 150 | Ga0265325_10001826 | 3300031241 | Bacteria | 14714 |
| 151 | Ga0265329_10000104 | 3300031242 | Bacteria | 40556 |
| 152 | Ga0265340_10017527 | 3300031247 | Bacteria | 3705 |
| 153 | Ga0265340_10084111 | 3300031247 | Bacteria | 1494 |
| 154 | Ga0265339_10002870 | 3300031249 | Bacteria | 12200 |
| 155 | Ga0265331_10000421 | 3300031250 | Bacteria | 42955 |
| 156 | Ga0265331_10055255 | 3300031250 | Bacteria | 1888 |
| 157 | Ga0265316_10000930 | 3300031344 | Bacteria | 31824 |
| 158 | Ga0265316_10000951 | 3300031344 | Bacteria | 31569 |
| 159 | Ga0265316_10413155 | 3300031344 | Bacteria | 971 |
| 160 | Ga0307513_10438890 | 3300031456 | Bacteria | 1032 |
| 161 | Ga0310116_106038 | 3300031591 | Eukaryota | 1228 |
| 162 | Ga0310117_107224 | 3300031592 | Eukaryota | 1197 |
| 163 | Ga0265313_10000311 | 3300031595 | Bacteria | 52824 |
| 164 | Ga0265313_10003693 | 3300031595 | Bacteria | 12198 |
| 165 | Ga0310103_111680 | 3300031614 | Eukaryota | 1179 |
| 166 | Ga0307508_10002654 | 3300031616 | Bacteria | 18761 |
| 167 | Ga0310102_102086 | 3300031632 | Eukaryota | 1183 |
| 168 | Ga0310106_104006 | 3300031634 | Eukaryota | 1156 |
| 169 | Ga0310115_109021 | 3300031635 | Eukaryota | 1165 |
| 170 | Ga0310113_108323 | 3300031636 | Eukaryota | 1177 |
| 171 | Ga0310118_104834 | 3300031664 | Eukaryota | 1155 |
| 172 | Ga0310105_107067 | 3300031666 | Eukaryota | 1218 |
| 173 | Ga0310111_110433 | 3300031667 | Eukaryota | 1200 |
| 174 | Ga0310114_106579 | 3300031678 | Eukaryota | 1182 |
| 175 | Ga0310119_108583 | 3300031686 | Eukaryota | 1246 |
| 176 | Ga0265314_10000114 | 3300031711 | Bacteria | 124126 |
| 177 | Ga0265314_10157330 | 3300031711 | Eukaryota | 1386 |
| 178 | Ga0265342_10000268 | 3300031712 | Bacteria | 58391 |
| 179 | Ga0265342_10028678 | 3300031712 | Bacteria | 3464 |
| 180 | Ga0307516_10028540 | 3300031730 | Bacteria | 5646 |
| 181 | Ga0316045_108708 | 3300031815 | Eukaryota | 1219 |
| 182 | Ga0316042_111457 | 3300031816 | Eukaryota | 1171 |
| 183 | Ga0307414_10868463 | 3300032004 | Bacteria | 826 |
| 184 | Ga0373930_0000113 | 3300034816 | Bacteria | 8643 |
| 185 | Ga0373928_0000122 | 3300035084 | Bacteria | 14457 |
| 186 | Ga0373929_0000570 | 3300035085 | Bacteria | 7107 |
| 187 | Ga0373944_0050616 | 3300035089 | Bacteria | 1308 |
| 188 | Ga0373949_0001330 | 3300035090 | Bacteria | 7114 |
| 189 | Ga0373951_0006768 | 3300035091 | Bacteria | 2616 |
| 190 | Ga0373923_0029596 | 3300035111 | Bacteria | 2197 |
| 191 | Ga0373923_0136859 | 3300035111 | Bacteria | 1105 |
| 192 | Ga0373932_0000001 | 3300035112 | Bacteria | 1459067 |
| 193 | Ga0373936_0041703 | 3300035113 | Bacteria | 1841 |
| 194 | Ga0373954_0134381 | 3300035118 | Bacteria | 1205 |
| 195 | Ga0373954_0164762 | 3300035118 | Bacteria | 1085 |
| 196 | Ga0373943_0006262 | 3300035170 | Bacteria | 5347 |
| 197 | Ga0373946_0077077 | 3300035171 | Bacteria | 1452 |
| 198 | Ga0373955_0060112 | 3300035172 | Bacteria | 2095 |
| 199 | Ga0373961_0000084 | 3300035241 | Bacteria | 50639 |
| 200 | Ga0373962_0000013 | 3300035242 | Bacteria | 49373 |
| 201 | Ga0373924_0002880 | 3300035410 | Bacteria | 5832 |
| 202 | Ga0373931_0000002 | 3300035691 | Bacteria | 599830 |
| 203 | Ga0373935_0030585 | 3300035692 | Bacteria | 3338 |
| 204 | Ga0373927_0010602 | 3300035695 | Bacteria | 6142 |
| 205 | Ga0373927_0092971 | 3300035695 | Bacteria | 1959 |
| 206 | Ga0373933_0084018 | 3300035724 | Bacteria | 1956 |
| 207 | Ga0373947_0037720 | 3300035725 | Bacteria | 2869 |
| 208 | Ga0310104_04797 | 3300036242 | Eukaryota | 1163 |
| 209 | Ga0373937_0298391 | 3300036401 | Bacteria | 1523 |
| 210 | Ga0310112_011256 | 3300036458 | Eukaryota | 1277 |
| 211 | Ga0372808_012914 | 3300036459 | Eukaryota | 1188 |
| 212 | Ga0310109_011223 | 3300036534 | Eukaryota | 1208 |
| 213 | Ga0310110_012968 | 3300036535 | Eukaryota | 1208 |
| 214 | Ga0310110_020189 | 3300036535 | Eukaryota | 923 |
| 215 | Ga0373925_0002323 | 3300037068 | Bacteria | 15297 |
| 216 | Ga0373925_0060054 | 3300037068 | Bacteria | 2854 |
| 217 | Ga0373925_0225811 | 3300037068 | Bacteria | 1496 |
| 218 | Ga0436365_0638097 | 3300039437 | Eukaryota | 847 |
| 219 | Ga0451846_28745 | 3300041502 | Eukaryota | 1115 |
| 220 | Ga0451850_30012 | 3300041506 | Eukaryota | 1080 |
| 221 | Ga0451854_23194 | 3300041510 | Eukaryota | 1109 |
| 222 | Ga0452268_40115 | 3300041907 | Eukaryota | 1108 |
| 223 | Ga0439458_0028305 | 3300042157 | Unclassified | 1326 |
| 224 | Ga0451577_0008024 | 3300042876 | Bacteria | 10304 |
| 225 | Ga0451577_0348050 | 3300042876 | Bacteria | 1344 |
| 226 | Ga0451576_0001909 | 3300045051 | Bacteria | 33390 |
| 227 | Ga0451576_0160924 | 3300045051 | Bacteria | 2343 |
| 228 | Ga0495592_0304898 | 3300046454 | Bacteria | 1034 |
| 229 | Ga0495629_0096375 | 3300046459 | Bacteria | 2064 |
| 230 | Ga0495653_0057393 | 3300046463 | Bacteria | 2963 |
| 231 | Ga0495582_0062699 | 3300046473 | Bacteria | 2054 |
| 232 | Ga0495639_0047608 | 3300046475 | Bacteria | 1943 |
| 233 | Ga0495639_0063580 | 3300046475 | Bacteria | 1694 |
| 234 | Ga0495639_0316953 | 3300046475 | Bacteria | 779 |
| 235 | Ga0495594_0149419 | 3300046499 | Bacteria | 1326 |
| 236 | Ga0495608_0005521 | 3300046511 | Eukaryota | 9031 |
| 237 | Ga0495608_0198332 | 3300046511 | Bacteria | 1265 |
| 238 | Ga0495628_0088350 | 3300046516 | Bacteria | 2402 |
| 239 | Ga0495630_0000173 | 3300046517 | Bacteria | 50167 |
| 240 | Ga0495666_0048219 | 3300046526 | Bacteria | 2052 |
| 241 | Ga0495665_0120149 | 3300046531 | Bacteria | 1376 |
| 242 | Ga0495587_0298368 | 3300046536 | Bacteria | 901 |
| 243 | Ga0495645_0006871 | 3300046543 | Bacteria | 7914 |
| 244 | Ga0495645_0315652 | 3300046543 | Bacteria | 1016 |
| 245 | Ga0495667_0007614 | 3300046559 | Bacteria | 7347 |
| 246 | Ga0495599_0142619 | 3300046678 | Bacteria | 1486 |
| 247 | Ga0495647_0099471 | 3300046681 | Bacteria | 1203 |
| 248 | Ga0495658_0063757 | 3300046683 | Bacteria | 2121 |
| 249 | Ga0495669_0243876 | 3300046684 | Bacteria | 862 |
| 250 | Ga0495613_0014299 | 3300046689 | Bacteria | 5889 |
| 251 | Ga0495613_0168820 | 3300046689 | Bacteria | 1554 |
| 252 | Ga0495624_0010793 | 3300046690 | Bacteria | 6297 |
| 253 | Ga0495581_0010360 | 3300047315 | Bacteria | 5394 |
| 254 | Ga0495581_0040766 | 3300047315 | Bacteria | 2686 |
| 255 | Ga0495604_0459826 | 3300047317 | Bacteria | 830 |
| 256 | Ga0495674_0018207 | 3300047319 | Bacteria | 6540 |
| 257 | Ga0495674_0089189 | 3300047319 | Bacteria | 2636 |
| 258 | Ga0495684_0014894 | 3300047471 | Bacteria | 5988 |
| 259 | Ga0495684_0129844 | 3300047471 | Bacteria | 1893 |
| 260 | Ga0496101_0499698 | 3300048904 | Bacteria | 961 |
| 261 | Ga0496105_0285066 | 3300048908 | Bacteria | 1331 |
| 262 | Ga0496114_0087073 | 3300048917 | Bacteria | 2648 |
| 263 | Ga0496115_0012627 | 3300048918 | Bacteria | 6364 |
| 264 | Ga0495682_0114156 | 3300049460 | Bacteria | 968 |
| 265 | Ga0501034_0250429 | 3300049571 | Bacteria | 1716 |
| 266 | Ga0501034_0643196 | 3300049571 | Bacteria | 963 |
| 267 | Ga0501075_0022913 | 3300049591 | Bacteria | 4567 |
| 268 | Ga0501076_0022677 | 3300049592 | Bacteria | 4827 |
| 269 | Ga0501081_0045436 | 3300049743 | Bacteria | 3016 |
| 270 | Ga0501045_0180398 | 3300049824 | Bacteria | 1573 |
| 271 | Ga0495601_0004998 | 3300053077 | Bacteria | 7694 |
| 272 | Ga0495601_0146185 | 3300053077 | Bacteria | 1543 |
| 273 | Ga0500635_0006597 | 3300053080 | Bacteria | 3106 |
| 274 | Ga0495595_0035342 | 3300053084 | Bacteria | 2264 |
| 275 | Ga0500647_0119374 | 3300053091 | Bacteria | 1249 |
| 276 | Ga0500566_0000338 | 3300053094 | Bacteria | 25497 |
| 277 | Ga0500566_0035944 | 3300053094 | Bacteria | 2876 |
| 278 | Ga0500595_001241 | 3300053119 | Bacteria | 14046 |
| 279 | Ga0500614_001236 | 3300053123 | Bacteria | 6220 |
| 280 | Ga0500659_0002099 | 3300053135 | Eukaryota | 12184 |
| 281 | Ga0500564_042387 | 3300053138 | Bacteria | 2093 |
| 282 | Ga0500568_0033638 | 3300053139 | Bacteria | 2102 |
| 283 | Ga0500603_077500 | 3300053150 | Bacteria | 957 |
| 284 | Ga0500601_008073 | 3300053737 | Bacteria | 1169 |
| 285 | Ga0501084_0325864 | 3300054114 | Bacteria | 1297 |
| 286 | Ga0530510_0029189 | 3300061734 | Bacteria | 3958 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046511 | Ga0495608_0005521 | Ga0495608_0005521_497_1216 | 199 |
| 2 | 3300005340 | Ga0070689_100109844 | Ga0070689_1001098443 | 209 |
| 3 | 3300025913 | Ga0207695_10243318 | Ga0207695_102433181 | 210 |
| 4 | 3300035118 | Ga0373954_0164762 | Ga0373954_0164762_73_978 | 213 |
| 5 | 3300046454 | Ga0495592_0304898 | Ga0495592_0304898_355_1002 | 213 |
| 6 | 3300013308 | Ga0157375_10690769 | Ga0157375_106907692 | 214 |
| 7 | 3300035241 | Ga0373961_0000084 | Ga0373961_0000084_35459_36235 | 214 |
| 8 | 3300035089 | Ga0373944_0050616 | Ga0373944_0050616_20_715 | 217 |
| 9 | 3300005355 | Ga0070671_100038409 | Ga0070671_1000384094 | 218 |
| 10 | 3300006028 | Ga0070717_10088552 | Ga0070717_100885523 | 218 |
| 11 | 3300025931 | Ga0207644_10124194 | Ga0207644_101241943 | 218 |
| 12 | 3300006844 | Ga0075428_100540993 | Ga0075428_1005409932 | 219 |
| 13 | 3300025924 | Ga0207694_10289199 | Ga0207694_102891993 | 219 |
| 14 | 3300053139 | Ga0500568_0033638 | Ga0500568_0033638_95_814 | 219 |
| 15 | 3300005616 | Ga0068852_100375687 | Ga0068852_1003756872 | 220 |
| 16 | 3300009093 | Ga0105240_10000373 | Ga0105240_1000037321 | 220 |
| 17 | 3300013307 | Ga0157372_10323482 | Ga0157372_103234822 | 220 |
| 18 | 3300020078 | Ga0206352_10968355 | Ga0206352_109683551 | 220 |
| 19 | 3300025913 | Ga0207695_10000095 | Ga0207695_10000095144 | 220 |
| 20 | 3300026142 | Ga0207698_10436923 | Ga0207698_104369232 | 220 |
| 21 | 3300028786 | Ga0307517_10059132 | Ga0307517_100591321 | 220 |
| 22 | 3300028800 | Ga0265338_10034813 | Ga0265338_100348133 | 220 |
| 23 | 3300031616 | Ga0307508_10002654 | Ga0307508_100026544 | 220 |
| 24 | 3300049571 | Ga0501034_0643196 | Ga0501034_0643196_132_854 | 220 |
| 25 | 3300005445 | Ga0070708_100020473 | Ga0070708_1000204732 | 221 |
| 26 | 3300013307 | Ga0157372_10306831 | Ga0157372_103068312 | 221 |
| 27 | 3300028800 | Ga0265338_10028156 | Ga0265338_100281565 | 221 |
| 28 | 3300031240 | Ga0265320_10181459 | Ga0265320_101814592 | 221 |
| 29 | 3300031344 | Ga0265316_10413155 | Ga0265316_104131551 | 221 |
| 30 | 3300035695 | Ga0373927_0092971 | Ga0373927_0092971_434_1186 | 221 |
| 31 | 3300035724 | Ga0373933_0084018 | Ga0373933_0084018_710_1399 | 221 |
| 32 | 3300048904 | Ga0496101_0499698 | Ga0496101_0499698_72_833 | 221 |
| 33 | 3300053077 | Ga0495601_0146185 | Ga0495601_0146185_822_1511 | 221 |
| 34 | 3300053094 | Ga0500566_0000338 | Ga0500566_0000338_20532_21284 | 221 |
| 35 | 3300053119 | Ga0500595_001241 | Ga0500595_001241_7846_8598 | 221 |
| 36 | 3300053123 | Ga0500614_001236 | Ga0500614_001236_196_948 | 221 |
| 37 | 3300053138 | Ga0500564_042387 | Ga0500564_042387_282_1034 | 221 |
| 38 | 3300053737 | Ga0500601_008073 | Ga0500601_008073_119_871 | 221 |
| 39 | 3300013297 | Ga0157378_10026178 | Ga0157378_100261784 | 222 |
| 40 | 3300028577 | Ga0265318_10000302 | Ga0265318_1000030213 | 222 |
| 41 | 3300028577 | Ga0265318_10001820 | Ga0265318_100018205 | 222 |
| 42 | 3300028800 | Ga0265338_10073068 | Ga0265338_100730683 | 222 |
| 43 | 3300031235 | Ga0265330_10000072 | Ga0265330_1000007228 | 222 |
| 44 | 3300031238 | Ga0265332_10000194 | Ga0265332_1000019413 | 222 |
| 45 | 3300031239 | Ga0265328_10004211 | Ga0265328_100042112 | 222 |
| 46 | 3300031240 | Ga0265320_10000038 | Ga0265320_1000003872 | 222 |
| 47 | 3300031241 | Ga0265325_10001826 | Ga0265325_100018268 | 222 |
| 48 | 3300031242 | Ga0265329_10000104 | Ga0265329_1000010412 | 222 |
| 49 | 3300031247 | Ga0265340_10017527 | Ga0265340_100175273 | 222 |
| 50 | 3300031247 | Ga0265340_10084111 | Ga0265340_100841112 | 222 |
| 51 | 3300031249 | Ga0265339_10002870 | Ga0265339_1000287010 | 222 |
| 52 | 3300031250 | Ga0265331_10000421 | Ga0265331_100004219 | 222 |
| 53 | 3300031250 | Ga0265331_10055255 | Ga0265331_100552552 | 222 |
| 54 | 3300031344 | Ga0265316_10000930 | Ga0265316_1000093013 | 222 |
| 55 | 3300031344 | Ga0265316_10000951 | Ga0265316_100009513 | 222 |
| 56 | 3300031595 | Ga0265313_10000311 | Ga0265313_1000031121 | 222 |
| 57 | 3300031595 | Ga0265313_10003693 | Ga0265313_100036935 | 222 |
| 58 | 3300031711 | Ga0265314_10000114 | Ga0265314_1000011472 | 222 |
| 59 | 3300031711 | Ga0265314_10157330 | Ga0265314_101573302 | 222 |
| 60 | 3300031712 | Ga0265342_10000268 | Ga0265342_1000026813 | 222 |
| 61 | 3300031712 | Ga0265342_10028678 | Ga0265342_100286782 | 222 |
| 62 | 3300053080 | Ga0500635_0006597 | Ga0500635_0006597_2242_3000 | 222 |
| 63 | 3300053091 | Ga0500647_0119374 | Ga0500647_0119374_85_843 | 222 |
| 64 | 3300053150 | Ga0500603_077500 | Ga0500603_077500_118_876 | 222 |
| 65 | 3300005354 | Ga0070675_100120275 | Ga0070675_1001202752 | 223 |
| 66 | 3300005364 | Ga0070673_100114714 | Ga0070673_1001147142 | 223 |
| 67 | 3300005843 | Ga0068860_100686535 | Ga0068860_1006865351 | 223 |
| 68 | 3300009101 | Ga0105247_10003883 | Ga0105247_100038833 | 223 |
| 69 | 3300025900 | Ga0207710_10005830 | Ga0207710_100058302 | 223 |
| 70 | 3300028381 | Ga0268264_10905705 | Ga0268264_109057051 | 223 |
| 71 | 3300036401 | Ga0373937_0298391 | Ga0373937_0298391_352_1050 | 223 |
| 72 | 3300042157 | Ga0439458_0028305 | Ga0439458_0028305_303_1034 | 223 |
| 73 | 3300045051 | Ga0451576_0001909 | Ga0451576_0001909_11324_12064 | 223 |
| 74 | 3300049460 | Ga0495682_0114156 | Ga0495682_0114156_191_919 | 223 |
| 75 | 3300003479 | Ga0006556J51387_1003553 | Ga0006556J51387_10035532 | 224 |
| 76 | 3300003556 | Ga0006557J51388_1004214 | Ga0006557J51388_10042141 | 224 |
| 77 | 3300003558 | Ga0006558J51389_1003221 | Ga0006558J51389_10032211 | 224 |
| 78 | 3300003560 | Ga0006559J51393_1004630 | Ga0006559J51393_10046301 | 224 |
| 79 | 3300003561 | Ga0006553J51392_1004328 | Ga0006553J51392_10043281 | 224 |
| 80 | 3300003564 | Ga0006555J51386_1003708 | Ga0006555J51386_10037081 | 224 |
| 81 | 3300003565 | Ga0006560J51390_1003455 | Ga0006560J51390_10034551 | 224 |
| 82 | 3300003567 | Ga0006554J51385_1003746 | Ga0006554J51385_10037461 | 224 |
| 83 | 3300005354 | Ga0070675_100059686 | Ga0070675_1000596862 | 224 |
| 84 | 3300005364 | Ga0070673_100076345 | Ga0070673_1000763453 | 224 |
| 85 | 3300005456 | Ga0070678_100302556 | Ga0070678_1003025562 | 224 |
| 86 | 3300005535 | Ga0070684_100184070 | Ga0070684_1001840702 | 224 |
| 87 | 3300005548 | Ga0070665_100006064 | Ga0070665_1000060649 | 224 |
| 88 | 3300006163 | Ga0070715_10047791 | Ga0070715_100477912 | 224 |
| 89 | 3300009098 | Ga0105245_10011594 | Ga0105245_100115944 | 224 |
| 90 | 3300009147 | Ga0114129_10555791 | Ga0114129_105557912 | 224 |
| 91 | 3300023553 | Ga0247524_104997 | Ga0247524_1049971 | 224 |
| 92 | 3300023556 | Ga0247519_106376 | Ga0247519_1063761 | 224 |
| 93 | 3300023558 | Ga0247526_104433 | Ga0247526_1044331 | 224 |
| 94 | 3300023560 | Ga0247514_107770 | Ga0247514_1077701 | 224 |
| 95 | 3300023561 | Ga0247518_111106 | Ga0247518_1111061 | 224 |
| 96 | 3300023562 | Ga0247516_107874 | Ga0247516_1078741 | 224 |
| 97 | 3300023563 | Ga0247530_104542 | Ga0247530_1045421 | 224 |
| 98 | 3300023564 | Ga0247515_108299 | Ga0247515_1082991 | 224 |
| 99 | 3300023664 | Ga0247527_104723 | Ga0247527_1047231 | 224 |
| 100 | 3300023666 | Ga0247531_105065 | Ga0247531_1050651 | 224 |
| 101 | 3300023668 | Ga0247525_106157 | Ga0247525_1061571 | 224 |
| 102 | 3300023680 | Ga0247528_104468 | Ga0247528_1044681 | 224 |
| 103 | 3300023686 | Ga0247520_105991 | Ga0247520_1059911 | 224 |
| 104 | 3300023688 | Ga0247522_106368 | Ga0247522_1063681 | 224 |
| 105 | 3300023689 | Ga0247517_106691 | Ga0247517_1066911 | 224 |
| 106 | 3300023690 | Ga0247512_108133 | Ga0247512_1081331 | 224 |
| 107 | 3300025909 | Ga0207705_10556804 | Ga0207705_105568041 | 224 |
| 108 | 3300025927 | Ga0207687_10034186 | Ga0207687_100341862 | 224 |
| 109 | 3300025931 | Ga0207644_10129649 | Ga0207644_101296492 | 224 |
| 110 | 3300025944 | Ga0207661_10322883 | Ga0207661_103228832 | 224 |
| 111 | 3300026121 | Ga0207683_10308875 | Ga0207683_103088751 | 224 |
| 112 | 3300028379 | Ga0268266_10003387 | Ga0268266_1000338715 | 224 |
| 113 | 3300031456 | Ga0307513_10438890 | Ga0307513_104388902 | 224 |
| 114 | 3300031591 | Ga0310116_106038 | Ga0310116_1060381 | 224 |
| 115 | 3300031592 | Ga0310117_107224 | Ga0310117_1072241 | 224 |
| 116 | 3300031614 | Ga0310103_111680 | Ga0310103_1116801 | 224 |
| 117 | 3300031632 | Ga0310102_102086 | Ga0310102_1020861 | 224 |
| 118 | 3300031634 | Ga0310106_104006 | Ga0310106_1040061 | 224 |
| 119 | 3300031635 | Ga0310115_109021 | Ga0310115_1090211 | 224 |
| 120 | 3300031636 | Ga0310113_108323 | Ga0310113_1083231 | 224 |
| 121 | 3300031664 | Ga0310118_104834 | Ga0310118_1048341 | 224 |
| 122 | 3300031666 | Ga0310105_107067 | Ga0310105_1070671 | 224 |
| 123 | 3300031667 | Ga0310111_110433 | Ga0310111_1104331 | 224 |
| 124 | 3300031678 | Ga0310114_106579 | Ga0310114_1065792 | 224 |
| 125 | 3300031686 | Ga0310119_108583 | Ga0310119_1085831 | 224 |
| 126 | 3300031730 | Ga0307516_10028540 | Ga0307516_100285404 | 224 |
| 127 | 3300031815 | Ga0316045_108708 | Ga0316045_1087081 | 224 |
| 128 | 3300031816 | Ga0316042_111457 | Ga0316042_1114571 | 224 |
| 129 | 3300036242 | Ga0310104_04797 | Ga0310104_04797_10_870 | 224 |
| 130 | 3300036458 | Ga0310112_011256 | Ga0310112_011256_339_1205 | 224 |
| 131 | 3300036459 | Ga0372808_012914 | Ga0372808_012914_259_1119 | 224 |
| 132 | 3300036534 | Ga0310109_011223 | Ga0310109_011223_81_941 | 224 |
| 133 | 3300036535 | Ga0310110_012968 | Ga0310110_012968_78_938 | 224 |
| 134 | 3300041506 | Ga0451850_30012 | Ga0451850_30012_38_850 | 224 |
| 135 | 3300053135 | Ga0500659_0002099 | Ga0500659_0002099_11329_12150 | 224 |
| 136 | 3300005340 | Ga0070689_100018395 | Ga0070689_1000183954 | 225 |
| 137 | 3300005341 | Ga0070691_10262493 | Ga0070691_102624932 | 225 |
| 138 | 3300005445 | Ga0070708_100001771 | Ga0070708_10000177111 | 225 |
| 139 | 3300005518 | Ga0070699_100129723 | Ga0070699_1001297233 | 225 |
| 140 | 3300005536 | Ga0070697_100145884 | Ga0070697_1001458843 | 225 |
| 141 | 3300006028 | Ga0070717_10036999 | Ga0070717_100369992 | 225 |
| 142 | 3300006173 | Ga0070716_100404185 | Ga0070716_1004041851 | 225 |
| 143 | 3300006237 | Ga0097621_100006536 | Ga0097621_1000065368 | 225 |
| 144 | 3300006358 | Ga0068871_100003445 | Ga0068871_1000034452 | 225 |
| 145 | 3300023686 | Ga0247520_108329 | Ga0247520_1083292 | 225 |
| 146 | 3300025906 | Ga0207699_10066990 | Ga0207699_100669903 | 225 |
| 147 | 3300025910 | Ga0207684_10141056 | Ga0207684_101410562 | 225 |
| 148 | 3300025939 | Ga0207665_10492249 | Ga0207665_104922491 | 225 |
| 149 | 3300035111 | Ga0373923_0136859 | Ga0373923_0136859_191_916 | 225 |
| 150 | 3300036535 | Ga0310110_020189 | Ga0310110_020189_37_780 | 225 |
| 151 | 3300041502 | Ga0451846_28745 | Ga0451846_28745_63_884 | 225 |
| 152 | 3300041510 | Ga0451854_23194 | Ga0451854_23194_211_1032 | 225 |
| 153 | 3300041907 | Ga0452268_40115 | Ga0452268_40115_21_821 | 225 |
| 154 | 3300042876 | Ga0451577_0348050 | Ga0451577_0348050_211_963 | 225 |
| 155 | 3300046459 | Ga0495629_0096375 | Ga0495629_0096375_499_1224 | 225 |
| 156 | 3300046475 | Ga0495639_0047608 | Ga0495639_0047608_465_1202 | 225 |
| 157 | 3300046475 | Ga0495639_0316953 | Ga0495639_0316953_11_736 | 225 |
| 158 | 3300046511 | Ga0495608_0198332 | Ga0495608_0198332_451_1176 | 225 |
| 159 | 3300046536 | Ga0495587_0298368 | Ga0495587_0298368_109_834 | 225 |
| 160 | 3300046543 | Ga0495645_0006871 | Ga0495645_0006871_232_957 | 225 |
| 161 | 3300046543 | Ga0495645_0315652 | Ga0495645_0315652_21_746 | 225 |
| 162 | 3300046559 | Ga0495667_0007614 | Ga0495667_0007614_1886_2611 | 225 |
| 163 | 3300046683 | Ga0495658_0063757 | Ga0495658_0063757_35_760 | 225 |
| 164 | 3300046684 | Ga0495669_0243876 | Ga0495669_0243876_49_765 | 225 |
| 165 | 3300046689 | Ga0495613_0014299 | Ga0495613_0014299_2644_3369 | 225 |
| 166 | 3300047315 | Ga0495581_0040766 | Ga0495581_0040766_1532_2260 | 225 |
| 167 | 3300047317 | Ga0495604_0459826 | Ga0495604_0459826_39_764 | 225 |
| 168 | 3300047319 | Ga0495674_0018207 | Ga0495674_0018207_5235_5960 | 225 |
| 169 | 3300047471 | Ga0495684_0014894 | Ga0495684_0014894_1895_2620 | 225 |
| 170 | 3300049571 | Ga0501034_0250429 | Ga0501034_0250429_389_1123 | 225 |
| 171 | 3300049591 | Ga0501075_0022913 | Ga0501075_0022913_1903_2631 | 225 |
| 172 | 3300049592 | Ga0501076_0022677 | Ga0501076_0022677_3945_4673 | 225 |
| 173 | 3300049743 | Ga0501081_0045436 | Ga0501081_0045436_2179_2907 | 225 |
| 174 | 3300049824 | Ga0501045_0180398 | Ga0501045_0180398_517_1245 | 225 |
| 175 | 3300053077 | Ga0495601_0004998 | Ga0495601_0004998_2732_3457 | 225 |
| 176 | 3300053084 | Ga0495595_0035342 | Ga0495595_0035342_535_1260 | 225 |
| 177 | 3300053094 | Ga0500566_0035944 | Ga0500566_0035944_105_902 | 225 |
| 178 | 3300054114 | Ga0501084_0325864 | Ga0501084_0325864_56_784 | 225 |
| 179 | 3300061734 | Ga0530510_0029189 | Ga0530510_0029189_241_969 | 225 |
| 180 | 3300005335 | Ga0070666_10287107 | Ga0070666_102871071 | 226 |
| 181 | 3300005344 | Ga0070661_100039955 | Ga0070661_1000399553 | 226 |
| 182 | 3300005617 | Ga0068859_100312061 | Ga0068859_1003120611 | 226 |
| 183 | 3300006931 | Ga0097620_100312044 | Ga0097620_1003120441 | 226 |
| 184 | 3300014968 | Ga0157379_10239189 | Ga0157379_102391893 | 226 |
| 185 | 3300025920 | Ga0207649_10026229 | Ga0207649_100262292 | 226 |
| 186 | 3300025986 | Ga0207658_10033582 | Ga0207658_100335822 | 226 |
| 187 | 3300028563 | Ga0265319_1000600 | Ga0265319_10006003 | 226 |
| 188 | 3300028800 | Ga0265338_10179325 | Ga0265338_101793252 | 226 |
| 189 | 3300031240 | Ga0265320_10001826 | Ga0265320_1000182611 | 226 |
| 190 | 3300048908 | Ga0496105_0285066 | Ga0496105_0285066_594_1301 | 226 |
| 191 | 3300048917 | Ga0496114_0087073 | Ga0496114_0087073_1343_2092 | 226 |
| 192 | 3300005356 | Ga0070674_100158906 | Ga0070674_1001589062 | 227 |
| 193 | 3300005439 | Ga0070711_100539058 | Ga0070711_1005390582 | 227 |
| 194 | 3300025941 | Ga0207711_10739997 | Ga0207711_107399971 | 227 |
| 195 | 3300031239 | Ga0265328_10068364 | Ga0265328_100683642 | 227 |
| 196 | 3300032004 | Ga0307414_10868463 | Ga0307414_108684631 | 227 |
| 197 | 3300034816 | Ga0373930_0000113 | Ga0373930_0000113_4715_5467 | 227 |
| 198 | 3300035084 | Ga0373928_0000122 | Ga0373928_0000122_13657_14409 | 227 |
| 199 | 3300035085 | Ga0373929_0000570 | Ga0373929_0000570_5202_5954 | 227 |
| 200 | 3300035090 | Ga0373949_0001330 | Ga0373949_0001330_1373_2125 | 227 |
| 201 | 3300035091 | Ga0373951_0006768 | Ga0373951_0006768_1842_2594 | 227 |
| 202 | 3300035111 | Ga0373923_0029596 | Ga0373923_0029596_453_1172 | 227 |
| 203 | 3300035112 | Ga0373932_0000001 | Ga0373932_0000001_1268631_1269383 | 227 |
| 204 | 3300035113 | Ga0373936_0041703 | Ga0373936_0041703_344_1063 | 227 |
| 205 | 3300035118 | Ga0373954_0134381 | Ga0373954_0134381_346_1065 | 227 |
| 206 | 3300035170 | Ga0373943_0006262 | Ga0373943_0006262_4229_4948 | 227 |
| 207 | 3300035171 | Ga0373946_0077077 | Ga0373946_0077077_609_1328 | 227 |
| 208 | 3300035172 | Ga0373955_0060112 | Ga0373955_0060112_746_1465 | 227 |
| 209 | 3300035242 | Ga0373962_0000013 | Ga0373962_0000013_2605_3357 | 227 |
| 210 | 3300035410 | Ga0373924_0002880 | Ga0373924_0002880_1163_1882 | 227 |
| 211 | 3300035691 | Ga0373931_0000002 | Ga0373931_0000002_226015_226767 | 227 |
| 212 | 3300035692 | Ga0373935_0030585 | Ga0373935_0030585_2438_3157 | 227 |
| 213 | 3300035695 | Ga0373927_0010602 | Ga0373927_0010602_1748_2500 | 227 |
| 214 | 3300035725 | Ga0373947_0037720 | Ga0373947_0037720_1369_2088 | 227 |
| 215 | 3300037068 | Ga0373925_0002323 | Ga0373925_0002323_5786_6538 | 227 |
| 216 | 3300037068 | Ga0373925_0060054 | Ga0373925_0060054_1858_2577 | 227 |
| 217 | 3300037068 | Ga0373925_0225811 | Ga0373925_0225811_681_1397 | 227 |
| 218 | 3300039437 | Ga0436365_0638097 | Ga0436365_0638097_88_834 | 227 |
| 219 | 3300046463 | Ga0495653_0057393 | Ga0495653_0057393_672_1391 | 227 |
| 220 | 3300046475 | Ga0495639_0063580 | Ga0495639_0063580_671_1390 | 227 |
| 221 | 3300046516 | Ga0495628_0088350 | Ga0495628_0088350_1573_2292 | 227 |
| 222 | 3300046517 | Ga0495630_0000173 | Ga0495630_0000173_2058_2777 | 227 |
| 223 | 3300046526 | Ga0495666_0048219 | Ga0495666_0048219_484_1203 | 227 |
| 224 | 3300046531 | Ga0495665_0120149 | Ga0495665_0120149_43_762 | 227 |
| 225 | 3300046678 | Ga0495599_0142619 | Ga0495599_0142619_34_753 | 227 |
| 226 | 3300046689 | Ga0495613_0168820 | Ga0495613_0168820_695_1414 | 227 |
| 227 | 3300046690 | Ga0495624_0010793 | Ga0495624_0010793_248_967 | 227 |
| 228 | 3300047315 | Ga0495581_0010360 | Ga0495581_0010360_1028_1747 | 227 |
| 229 | 3300047319 | Ga0495674_0089189 | Ga0495674_0089189_1381_2100 | 227 |
| 230 | 3300047471 | Ga0495684_0129844 | Ga0495684_0129844_684_1403 | 227 |
| 231 | 3300003320 | rootH2_10003144 | rootH2_100031445 | 228 |
| 232 | 3300005334 | Ga0068869_100031096 | Ga0068869_1000310962 | 228 |
| 233 | 3300005338 | Ga0068868_100413324 | Ga0068868_1004133242 | 228 |
| 234 | 3300005340 | Ga0070689_100074199 | Ga0070689_1000741992 | 228 |
| 235 | 3300005364 | Ga0070673_100309159 | Ga0070673_1003091592 | 228 |
| 236 | 3300005438 | Ga0070701_10003865 | Ga0070701_100038654 | 228 |
| 237 | 3300005444 | Ga0070694_100014573 | Ga0070694_1000145734 | 228 |
| 238 | 3300005445 | Ga0070708_100225626 | Ga0070708_1002256262 | 228 |
| 239 | 3300005467 | Ga0070706_100112149 | Ga0070706_1001121492 | 228 |
| 240 | 3300005468 | Ga0070707_100068082 | Ga0070707_1000680823 | 228 |
| 241 | 3300005468 | Ga0070707_100604651 | Ga0070707_1006046511 | 228 |
| 242 | 3300005544 | Ga0070686_100012074 | Ga0070686_1000120743 | 228 |
| 243 | 3300005544 | Ga0070686_100103683 | Ga0070686_1001036832 | 228 |
| 244 | 3300005548 | Ga0070665_100034155 | Ga0070665_1000341552 | 228 |
| 245 | 3300005563 | Ga0068855_100053069 | Ga0068855_1000530692 | 228 |
| 246 | 3300005614 | Ga0068856_100003612 | Ga0068856_1000036124 | 228 |
| 247 | 3300005617 | Ga0068859_100370761 | Ga0068859_1003707612 | 228 |
| 248 | 3300006237 | Ga0097621_100420438 | Ga0097621_1004204382 | 228 |
| 249 | 3300006847 | Ga0075431_100011781 | Ga0075431_1000117813 | 228 |
| 250 | 3300006881 | Ga0068865_100105050 | Ga0068865_1001050502 | 228 |
| 251 | 3300006881 | Ga0068865_100117527 | Ga0068865_1001175273 | 228 |
| 252 | 3300006931 | Ga0097620_100370804 | Ga0097620_1003708041 | 228 |
| 253 | 3300009093 | Ga0105240_10119296 | Ga0105240_101192964 | 228 |
| 254 | 3300009098 | Ga0105245_10226572 | Ga0105245_102265723 | 228 |
| 255 | 3300009176 | Ga0105242_10060832 | Ga0105242_100608322 | 228 |
| 256 | 3300009176 | Ga0105242_10162484 | Ga0105242_101624842 | 228 |
| 257 | 3300009177 | Ga0105248_10282731 | Ga0105248_102827313 | 228 |
| 258 | 3300013306 | Ga0163162_10144285 | Ga0163162_101442852 | 228 |
| 259 | 3300014969 | Ga0157376_10037219 | Ga0157376_100372192 | 228 |
| 260 | 3300025910 | Ga0207684_10030523 | Ga0207684_100305232 | 228 |
| 261 | 3300025913 | Ga0207695_10137561 | Ga0207695_101375614 | 228 |
| 262 | 3300025922 | Ga0207646_10041039 | Ga0207646_100410392 | 228 |
| 263 | 3300025927 | Ga0207687_10031889 | Ga0207687_100318892 | 228 |
| 264 | 3300025934 | Ga0207686_10080621 | Ga0207686_100806212 | 228 |
| 265 | 3300025934 | Ga0207686_10254334 | Ga0207686_102543342 | 228 |
| 266 | 3300025935 | Ga0207709_10053191 | Ga0207709_100531912 | 228 |
| 267 | 3300025937 | Ga0207669_10458795 | Ga0207669_104587952 | 228 |
| 268 | 3300025938 | Ga0207704_10122624 | Ga0207704_101226242 | 228 |
| 269 | 3300025941 | Ga0207711_10110021 | Ga0207711_101100212 | 228 |
| 270 | 3300025942 | Ga0207689_10398230 | Ga0207689_103982301 | 228 |
| 271 | 3300025949 | Ga0207667_10077254 | Ga0207667_100772542 | 228 |
| 272 | 3300025949 | Ga0207667_10096732 | Ga0207667_100967324 | 228 |
| 273 | 3300026023 | Ga0207677_10150592 | Ga0207677_101505922 | 228 |
| 274 | 3300026078 | Ga0207702_10002632 | Ga0207702_100026326 | 228 |
| 275 | 3300026089 | Ga0207648_10009972 | Ga0207648_100099722 | 228 |
| 276 | 3300026121 | Ga0207683_10111707 | Ga0207683_101117072 | 228 |
| 277 | 3300028379 | Ga0268266_10060609 | Ga0268266_100606092 | 228 |
| 278 | 3300028556 | Ga0265337_1016361 | Ga0265337_10163615 | 228 |
| 279 | 3300028666 | Ga0265336_10024656 | Ga0265336_100246564 | 228 |
| 280 | 3300031240 | Ga0265320_10001277 | Ga0265320_100012776 | 228 |
| 281 | 3300042876 | Ga0451577_0008024 | Ga0451577_0008024_6399_7109 | 228 |
| 282 | 3300045051 | Ga0451576_0160924 | Ga0451576_0160924_236_946 | 228 |
| 283 | 3300046473 | Ga0495582_0062699 | Ga0495582_0062699_707_1426 | 228 |
| 284 | 3300046499 | Ga0495594_0149419 | Ga0495594_0149419_180_929 | 228 |
| 285 | 3300046681 | Ga0495647_0099471 | Ga0495647_0099471_382_1101 | 228 |
| 286 | 3300048918 | Ga0496115_0012627 | Ga0496115_0012627_4684_5427 | 228 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5xkt-assembly1.cif.gz_B | klebsiella pneumoniae ureg in complex with gmppnp and nickel | 0.9401 | 24 | 214 |
| 4hi0-assembly1.cif.gz_F | crystal structure of helicobacter pylori urease accessory protein uref/h/g complex | 0.9281 | 26 | 215 |
| 5xkt-assembly1.cif.gz_B | klebsiella pneumoniae ureg in complex with gmppnp and nickel | 0.8991 | 24 | 214 |
| 4hi0-assembly1.cif.gz_F | crystal structure of helicobacter pylori urease accessory protein uref/h/g complex | 0.8965 | 26 | 215 |
| 2hf9-assembly1.cif.gz_A | crystal structure of hypb from methanocaldococcus jannaschii in the triphosphate form | 0.8947 | 22 | 219 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O64700_71_266_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9464 | 24 | 218 | 3.40.50.300 |
| af_O64700_71_266_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9371 | 24 | 218 | 3.40.50.300 |
| 2wsmA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8396 | 22 | 218 | 3.40.50.300 |
| af_Q57584_1_187_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8111 | 26 | 215 | 3.40.50.300 |
| af_P0AAN3_68_289_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7922 | 22 | 218 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6N6PVS4-F1-model_v4 | Urease accessory protein UreG | 0.9542 | 6 | 228 |
GO:0003924
GO:0005525 GO:0005737 GO:0016151 GO:0043419 |
| AF-Q095M1-F1-model_v4 | Urease accessory protein UreG | 0.9539 | 6 | 225 |
GO:0003924
GO:0005525 GO:0016151 GO:0043419 |
| AF-A0A3B8L059-F1-model_v4 | Urease accessory protein UreG | 0.9513 | 18 | 223 |
GO:0003924
GO:0005525 GO:0016151 GO:0043419 |
| AF-A0A5B1BG10-F1-model_v4 | Urease accessory protein UreG | 0.9501 | 7 | 228 |
GO:0003924
GO:0005525 GO:0005737 GO:0016151 GO:0043419 |
| AF-A0A803MDI2-F1-model_v4 | CobW/HypB/UreG nucleotide-binding domain-containing protein | 0.9486 | 4 | 223 |
GO:0003924
GO:0005525 GO:0016151 GO:0043419 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar