F387663

General Info

Members Datasets Scaffolds Average Seq Length
286 129 572 122

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0000440|Ga0501031_0000440_3878_4279
Length 133
Sequence MNPGTEGGRGMHRNPEVDRWFERAGRPLEATMRRARDIILGADGRVTESIKWKTPTFAYRGNIASFNPSKHLLSIMFHRGAEIPGNHPRLEGDGKLVRTMRFADLGELEAGKADLEAVVRAWCDWKSASSTRR

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
13 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
14 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
17 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
19 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
24 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
25 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
26 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
27 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
36 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
45 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
47 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
48 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
49 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
50 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
51 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
52 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
53 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
54 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
55 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
56 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
57 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
58 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
59 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
60 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
61 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
62 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
63 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
64 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
65 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
66 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
67 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
68 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
69 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
70 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
71 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
72 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
73 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
74 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
75 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
76 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
77 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
78 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
79 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
80 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
81 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
82 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
83 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
84 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
85 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
86 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
87 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
88 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
102 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
103 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
104 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
105 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
106 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
107 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
108 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
109 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
110 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
111 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
112 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
113 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
114 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
115 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
118 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
119 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
120 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
121 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
122 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
123 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
124 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
125 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
126 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
127 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
128 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
129 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.05
Rhizosphere 98.6
Stem 0
Stem Tuber 0
Unclassified 13.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0000440 3300049568 Bacteria 23918
2 JGI25406J46586_10005312 3300003203 Bacteria 5977
3 JGI25406J46586_10069410 3300003203 Bacteria 1110
4 JGI25407J50210_10005286 3300003373 Bacteria 3169
5 JGI25407J50210_10022173 3300003373 Bacteria 1651
6 JGI25407J50210_10025847 3300003373 Bacteria 1522
7 JGI25407J50210_10058146 3300003373 Unclassified 974
8 Ga0070692_10033708 3300005345 Bacteria 2581
9 Ga0070668_100015940 3300005347 Bacteria 5622
10 Ga0070669_100410746 3300005353 Bacteria 1109
11 Ga0070659_100026108 3300005366 Bacteria 4493
12 Ga0070694_101521812 3300005444 Bacteria 566
13 Ga0070662_101074232 3300005457 Bacteria 690
14 Ga0068867_100205497 3300005459 Unclassified 1579
15 Ga0068853_100364445 3300005539 Bacteria 1347
16 Ga0070695_100303278 3300005545 Bacteria 1181
17 Ga0068866_11138277 3300005718 Unclassified 561
18 Ga0068861_100113882 3300005719 Bacteria 2171
19 Ga0068861_100130080 3300005719 Bacteria 2042
20 Ga0081455_10110346 3300005937 Bacteria 2187
21 Ga0081455_10111831 3300005937 Bacteria 2169
22 Ga0081455_10371918 3300005937 Unclassified 1001
23 Ga0081455_10377414 3300005937 Bacteria 991
24 Ga0081455_10461802 3300005937 Unclassified 864
25 Ga0081538_10000922 3300005981 Bacteria 31684
26 Ga0081538_10001065 3300005981 Bacteria 29204
27 Ga0081538_10001942 3300005981 Bacteria 20692
28 Ga0081538_10002060 3300005981 Bacteria 20073
29 Ga0081538_10002207 3300005981 Bacteria 19294
30 Ga0081538_10004591 3300005981 Bacteria 12700
31 Ga0081538_10006485 3300005981 Bacteria 10298
32 Ga0081538_10006672 3300005981 Bacteria 10113
33 Ga0081538_10006786 3300005981 Bacteria 10003
34 Ga0081538_10010403 3300005981 Bacteria 7627
35 Ga0081538_10012967 3300005981 Bacteria 6636
36 Ga0081538_10013041 3300005981 Bacteria 6614
37 Ga0081538_10018257 3300005981 Bacteria 5280
38 Ga0081538_10018315 3300005981 Bacteria 5266
39 Ga0081538_10055892 3300005981 Bacteria 2318
40 Ga0081538_10066063 3300005981 Bacteria 2031
41 Ga0081538_10093511 3300005981 Bacteria 1543
42 Ga0081538_10151857 3300005981 Bacteria 1047
43 Ga0081538_10327435 3300005981 Unclassified 557
44 Ga0081539_10001230 3300005985 Bacteria 45730
45 Ga0081539_10002470 3300005985 Bacteria 26024
46 Ga0081539_10055764 3300005985 Bacteria 2196
47 Ga0081539_10093555 3300005985 Bacteria 1548
48 Ga0075432_10012663 3300006058 Bacteria 2864
49 Ga0075432_10248661 3300006058 Bacteria 721
50 Ga0075427_10024313 3300006194 Bacteria 973
51 Ga0075428_100009143 3300006844 Bacteria 10996
52 Ga0075428_100262457 3300006844 Unclassified 1859
53 Ga0075430_100831082 3300006846 Unclassified 761
54 Ga0075431_100052672 3300006847 Bacteria 4196
55 Ga0075433_10017830 3300006852 Bacteria 5890
56 Ga0075433_10028212 3300006852 Bacteria 4771
57 Ga0075433_10030375 3300006852 Bacteria 4610
58 Ga0075434_100056034 3300006871 Bacteria 3917
59 Ga0075434_100092968 3300006871 Bacteria 3019
60 Ga0075429_100016640 3300006880 Bacteria 6369
61 Ga0075429_100082600 3300006880 Unclassified 2800
62 Ga0075429_100195490 3300006880 Bacteria 1772
63 Ga0068865_102175731 3300006881 Bacteria 505
64 Ga0075435_100032006 3300007076 Bacteria 4151
65 Ga0075435_101069032 3300007076 Bacteria 705
66 Ga0111539_10019331 3300009094 Bacteria 8411
67 Ga0111539_10071268 3300009094 Bacteria 4101
68 Ga0111539_10122253 3300009094 Bacteria 3051
69 Ga0111539_10509227 3300009094 Unclassified 1402
70 Ga0111539_10609979 3300009094 Bacteria 1271
71 Ga0105245_10104137 3300009098 Bacteria 2630
72 Ga0114129_10000831 3300009147 Bacteria 39916
73 Ga0114129_10025213 3300009147 Bacteria 8425
74 Ga0114129_10101600 3300009147 Bacteria 3978
75 Ga0114129_10142923 3300009147 Unclassified 3279
76 Ga0114129_10651452 3300009147 Bacteria 1359
77 Ga0114129_10907623 3300009147 Bacteria 1116
78 Ga0114129_11713210 3300009147 Bacteria 767
79 Ga0105238_10692251 3300009551 Bacteria 1031
80 Ga0105249_10021953 3300009553 Bacteria 5717
81 Ga0105249_11779578 3300009553 Bacteria 689
82 Ga0163162_10031667 3300013306 Bacteria 5246
83 Ga0163162_12870958 3300013306 Bacteria 554
84 Ga0157372_10150648 3300013307 Bacteria 2684
85 Ga0157375_12042990 3300013308 Bacteria 682
86 Ga0207681_10222254 3300025923 Bacteria 1462
87 Ga0207687_10742360 3300025927 Bacteria 835
88 Ga0207687_10782582 3300025927 Unclassified 813
89 Ga0207704_11385764 3300025938 Bacteria 602
90 Ga0207712_10268902 3300025961 Unclassified 1386
91 Ga0207677_12094858 3300026023 Bacteria 526
92 Ga0207639_10065342 3300026041 Bacteria 2824
93 Ga0207648_10065507 3300026089 Unclassified 3167
94 Ga0207675_100029399 3300026118 Bacteria 5120
95 Ga0207675_100537177 3300026118 Bacteria 1167
96 Ga0207428_10005360 3300027907 Bacteria 11967
97 Ga0207428_10197362 3300027907 Unclassified 1515
98 Ga0207428_10197409 3300027907 Unclassified 1515
99 Ga0207428_10707051 3300027907 Bacteria 720
100 Ga0207428_10851565 3300027907 Unclassified 646
101 Ga0268265_10075088 3300028380 Bacteria 2647
102 Ga0307408_100028972 3300031548 Bacteria 3831
103 Ga0307408_100511217 3300031548 Bacteria 1053
104 Ga0307405_10056601 3300031731 Bacteria 2460
105 Ga0307405_10101014 3300031731 Bacteria 1934
106 Ga0307413_10018948 3300031824 Bacteria 3624
107 Ga0307413_10133223 3300031824 Bacteria 1704
108 Ga0307413_10371381 3300031824 Bacteria 1111
109 Ga0307410_10145232 3300031852 Bacteria 1760
110 Ga0307410_10245560 3300031852 Bacteria 1389
111 Ga0307410_10399979 3300031852 Bacteria 1109
112 Ga0307406_10007097 3300031901 Bacteria 6203
113 Ga0307406_11935573 3300031901 Bacteria 526
114 Ga0307407_10024348 3300031903 Bacteria 3173
115 Ga0307407_10265543 3300031903 Bacteria 1182
116 Ga0307412_10135218 3300031911 Bacteria 1797
117 Ga0307412_10339284 3300031911 Bacteria 1202
118 Ga0307409_100105921 3300031995 Bacteria 2345
119 Ga0307409_100131814 3300031995 Bacteria 2137
120 Ga0307409_100467581 3300031995 Bacteria 1221
121 Ga0307416_100007283 3300032002 Bacteria 7017
122 Ga0307416_100045247 3300032002 Bacteria 3464
123 Ga0307416_100911128 3300032002 Unclassified 979
124 Ga0307416_102595789 3300032002 Bacteria 604
125 Ga0307414_10654475 3300032004 Bacteria 947
126 Ga0307411_10282960 3300032005 Bacteria 1321
127 Ga0307415_100063536 3300032126 Bacteria 2565
128 Ga0307415_100181069 3300032126 Bacteria 1653
129 Ga0307415_102278205 3300032126 Bacteria 531
130 Ga0395899_0195150 3300037312 Bacteria 1415
131 Ga0395900_0369486 3300037418 Bacteria 1404
132 Ga0395900_0520591 3300037418 Bacteria 1137
133 Ga0395898_0059776 3300037466 Bacteria 3706
134 Ga0395898_0850291 3300037466 Bacteria 852
135 Ga0395901_0038248 3300038443 Bacteria 4963
136 Ga0395901_0260422 3300038443 Bacteria 1805
137 Ga0451787_315947 3300041441 Unclassified 851
138 Ga0451797_1493084 3300041453 Unclassified 658
139 Ga0451802_1278337 3300041460 Unclassified 599
140 Ga0451843_0776006 3300041509 Bacteria 1343
141 Ga0439443_010795 3300042003 Bacteria 1330
142 Ga0439448_0014300 3300042005 Bacteria 2392
143 Ga0439448_0054102 3300042005 Unclassified 1318
144 Ga0439450_005437 3300042008 Bacteria 2239
145 Ga0439450_023839 3300042008 Bacteria 1330
146 Ga0439450_026742 3300042008 Unclassified 1274
147 Ga0439450_116395 3300042008 Bacteria 686
148 Ga0439451_033681 3300042009 Bacteria 1030
149 Ga0439454_014761 3300042011 Bacteria 1086
150 Ga0439455_0002288 3300042012 Bacteria 3447
151 Ga0439455_0046935 3300042012 Bacteria 1120
152 Ga0439455_0165301 3300042012 Unclassified 634
153 Ga0439456_105194 3300042013 Unclassified 641
154 Ga0439463_001605 3300042016 Bacteria 5956
155 Ga0439463_003839 3300042016 Bacteria 3790
156 Ga0439463_005118 3300042016 Bacteria 3263
157 Ga0439463_056528 3300042016 Unclassified 1002
158 Ga0439463_087723 3300042016 Bacteria 800
159 Ga0450888_026690 3300042126 Bacteria 759
160 Ga0450903_038760 3300042138 Bacteria 708
161 Ga0450905_064203 3300042142 Bacteria 618
162 Ga0439458_0024966 3300042157 Bacteria 1400
163 Ga0439435_0049814 3300042436 Bacteria 1196
164 Ga0439444_0007026 3300042437 Bacteria 1718
165 Ga0439444_0015609 3300042437 Bacteria 1284
166 Ga0439464_0007923 3300042439 Bacteria 2783
167 Ga0439464_0016232 3300042439 Bacteria 2011
168 Ga0439464_0076094 3300042439 Bacteria 998
169 Ga0439460_0000802 3300042461 Bacteria 7116
170 Ga0439460_0009428 3300042461 Bacteria 2480
171 Ga0439460_0016481 3300042461 Unclassified 1968
172 Ga0439460_0050482 3300042461 Bacteria 1246
173 Ga0439460_0069876 3300042461 Bacteria 1086
174 Ga0450916_021862 3300042530 Bacteria 883
175 Ga0439440_0000772 3300042993 Bacteria 5528
176 Ga0439440_0001724 3300042993 Bacteria 4022
177 Ga0439440_0018250 3300042993 Unclassified 1552
178 Ga0439440_0101500 3300042993 Bacteria 783
179 Ga0466967_0466618 3300045976 Unclassified 1235
180 Ga0466967_1137770 3300045976 Bacteria 778
181 Ga0495631_0356181 3300046518 Bacteria 623
182 Ga0495656_0358546 3300046615 Bacteria 757
183 Ga0495656_0537575 3300046615 Bacteria 622
184 Ga0495677_0444352 3300047445 Unclassified 514
185 Ga0501031_0002989 3300049568 Bacteria 10823
186 Ga0501032_0050509 3300049569 Bacteria 2805
187 Ga0501033_0011413 3300049570 Bacteria 6800
188 Ga0501036_0000187 3300049572 Bacteria 41184
189 Ga0501036_0001264 3300049572 Bacteria 19365
190 Ga0501037_0029890 3300049573 Bacteria 4025
191 Ga0501037_1076249 3300049573 Bacteria 521
192 Ga0501038_0090848 3300049574 Bacteria 2559
193 Ga0501038_0156873 3300049574 Bacteria 1852
194 Ga0501039_0000373 3300049575 Bacteria 32121
195 Ga0501039_0170010 3300049575 Bacteria 1714
196 Ga0501039_1539966 3300049575 Bacteria 511
197 Ga0501040_0000125 3300049576 Bacteria 41181
198 Ga0501040_0001229 3300049576 Bacteria 16287
199 Ga0501041_0032832 3300049577 Bacteria 3138
200 Ga0501041_0048934 3300049577 Bacteria 2574
201 Ga0501041_0172738 3300049577 Bacteria 1352
202 Ga0501042_0000184 3300049578 Bacteria 29060
203 Ga0501042_0000405 3300049578 Bacteria 21851
204 Ga0501043_0028688 3300049579 Bacteria 4368
205 Ga0501043_0049007 3300049579 Bacteria 3320
206 Ga0501046_0000606 3300049580 Bacteria 35238
207 Ga0501046_0001807 3300049580 Bacteria 20375
208 Ga0501047_0292375 3300049581 Bacteria 1473
209 Ga0501047_0732985 3300049581 Bacteria 805
210 Ga0501048_0001898 3300049582 Bacteria 15868
211 Ga0501048_0001929 3300049582 Bacteria 15762
212 Ga0501068_0008836 3300049584 Bacteria 5621
213 Ga0501069_0015430 3300049585 Bacteria 4094
214 Ga0501069_0361983 3300049585 Bacteria 856
215 Ga0501070_0367205 3300049586 Bacteria 1167
216 Ga0501071_0005019 3300049587 Bacteria 8458
217 Ga0501071_0006133 3300049587 Bacteria 7791
218 Ga0501071_0216551 3300049587 Bacteria 1441
219 Ga0501071_0449622 3300049587 Bacteria 986
220 Ga0501072_0000208 3300049588 Bacteria 42606
221 Ga0501072_0014744 3300049588 Bacteria 5993
222 Ga0501073_0712363 3300049589 Unclassified 692
223 Ga0501074_0001299 3300049590 Bacteria 16569
224 Ga0501075_0000245 3300049591 Bacteria 29148
225 Ga0501075_0002502 3300049591 Bacteria 12245
226 Ga0501076_0000697 3300049592 Bacteria 21627
227 Ga0501076_0001132 3300049592 Bacteria 17622
228 Ga0501077_0002008 3300049593 Bacteria 12290
229 Ga0501077_0005849 3300049593 Bacteria 7496
230 Ga0501079_0000355 3300049741 Bacteria 29388
231 Ga0501079_0000654 3300049741 Bacteria 23125
232 Ga0501079_0078541 3300049741 Bacteria 2553
233 Ga0501079_0177440 3300049741 Unclassified 1662
234 Ga0501080_0016073 3300049742 Bacteria 6908
235 Ga0501080_0176571 3300049742 Bacteria 1967
236 Ga0501081_0000966 3300049743 Bacteria 17090
237 Ga0501081_0023072 3300049743 Bacteria 4168
238 Ga0501083_0040612 3300049744 Bacteria 3158
239 Ga0501083_0162456 3300049744 Bacteria 1461
240 Ga0501035_0005298 3300049822 Bacteria 12210
241 Ga0501035_0086678 3300049822 Bacteria 2759
242 Ga0501044_0129450 3300049823 Bacteria 2519
243 Ga0501044_0458048 3300049823 Bacteria 1181
244 Ga0501044_0856051 3300049823 Bacteria 786
245 Ga0501045_0000039 3300049824 Bacteria 55389
246 Ga0501045_0003903 3300049824 Bacteria 10266
247 nmdc:mga05p37_1213708_c1 3300050507 Bacteria 778
248 nmdc:mga05p37_1849927_c1 3300050507 Unclassified 580
249 nmdc:mga05p37_18641_c1 3300050507 Bacteria 8387
250 nmdc:mga05p37_19663_c1 3300050507 Bacteria 8171
251 nmdc:mga05p37_287322_c1 3300050507 Unclassified 1959
252 nmdc:mga05p37_336680_c1 3300050507 Unclassified 1781
253 nmdc:mga05p37_535568_c1 3300050507 Bacteria 1336
254 nmdc:mga05p37_57641_c1 3300050507 Bacteria 4784
255 nmdc:mga09592_1207634_c1 3300050508 Unclassified 625
256 nmdc:mga09592_136165_c1 3300050508 Bacteria 2115
257 nmdc:mga09592_605294_c1 3300050508 Bacteria 939
258 nmdc:mga09592_83429_c1 3300050508 Bacteria 2724
259 nmdc:mga0qj67_13007_c1 3300050509 Bacteria 6281
260 nmdc:mga06r32_27135_c1 3300050510 Bacteria 5346
261 nmdc:mga06r32_29874_c1 3300050510 Bacteria 5112
262 nmdc:mga08y16_20399_c1 3300050511 Bacteria 6996
263 nmdc:mga08y16_379924_c1 3300050511 Bacteria 1448
264 nmdc:mga08y16_543440_c1 3300050511 Unclassified 1177
265 nmdc:mga08y16_595729_c1 3300050511 Bacteria 1114
266 nmdc:mga08y16_946427_c1 3300050511 Bacteria 845
267 nmdc:mga0n895_1636031_c1 3300050512 Bacteria 608
268 nmdc:mga0n895_68708_c1 3300050512 Bacteria 3510
269 nmdc:mga0rr50_1083577_c1 3300050513 Bacteria 682
270 nmdc:mga0rr50_1470554_c1 3300050513 Unclassified 576
271 nmdc:mga0rr50_933718_c1 3300050513 Bacteria 740
272 nmdc:mga0a205_19665_c1 3300050515 Bacteria 6371
273 nmdc:mga0a205_19905_c1 3300050515 Bacteria 6331
274 nmdc:mga0a205_38097_c1 3300050515 Bacteria 4625
275 nmdc:mga0a205_7494_c1 3300050515 Bacteria 9882
276 Ga0501084_0000108 3300054114 Bacteria 61886
277 Ga0501084_0002791 3300054114 Bacteria 14100
278 Ga0501084_0115407 3300054114 Bacteria 2257
279 Ga0501084_0458328 3300054114 Unclassified 1078
280 Ga0501084_1361649 3300054114 Bacteria 595
281 Ga0590075_045492 3300059424 Bacteria 1124
282 Ga0501082_0000443 3300060353 Bacteria 36659
283 Ga0501082_0003073 3300060353 Bacteria 14559
284 Ga0530510_0000074 3300061734 Bacteria 51407
285 Ga0530510_0000396 3300061734 Bacteria 28342
286 Ga0530510_0085772 3300061734 Bacteria 2294
287 Ga0501031_0000440
288 JGI25406J46586_10005312
289 JGI25406J46586_10069410
290 JGI25407J50210_10005286
291 JGI25407J50210_10022173
292 JGI25407J50210_10025847
293 JGI25407J50210_10058146
294 Ga0070692_10033708
295 Ga0070668_100015940
296 Ga0070669_100410746
297 Ga0070659_100026108
298 Ga0070694_101521812
299 Ga0070662_101074232
300 Ga0068867_100205497
301 Ga0068853_100364445
302 Ga0070695_100303278
303 Ga0068866_11138277
304 Ga0068861_100113882
305 Ga0068861_100130080
306 Ga0081455_10110346
307 Ga0081455_10111831
308 Ga0081455_10371918
309 Ga0081455_10377414
310 Ga0081455_10461802
311 Ga0081538_10000922
312 Ga0081538_10001065
313 Ga0081538_10001942
314 Ga0081538_10002060
315 Ga0081538_10002207
316 Ga0081538_10004591
317 Ga0081538_10006485
318 Ga0081538_10006672
319 Ga0081538_10006786
320 Ga0081538_10010403
321 Ga0081538_10012967
322 Ga0081538_10013041
323 Ga0081538_10018257
324 Ga0081538_10018315
325 Ga0081538_10055892
326 Ga0081538_10066063
327 Ga0081538_10093511
328 Ga0081538_10151857
329 Ga0081538_10327435
330 Ga0081539_10001230
331 Ga0081539_10002470
332 Ga0081539_10055764
333 Ga0081539_10093555
334 Ga0075432_10012663
335 Ga0075432_10248661
336 Ga0075427_10024313
337 Ga0075428_100009143
338 Ga0075428_100262457
339 Ga0075430_100831082
340 Ga0075431_100052672
341 Ga0075433_10017830
342 Ga0075433_10028212
343 Ga0075433_10030375
344 Ga0075434_100056034
345 Ga0075434_100092968
346 Ga0075429_100016640
347 Ga0075429_100082600
348 Ga0075429_100195490
349 Ga0068865_102175731
350 Ga0075435_100032006
351 Ga0075435_101069032
352 Ga0111539_10019331
353 Ga0111539_10071268
354 Ga0111539_10122253
355 Ga0111539_10509227
356 Ga0111539_10609979
357 Ga0105245_10104137
358 Ga0114129_10000831
359 Ga0114129_10025213
360 Ga0114129_10101600
361 Ga0114129_10142923
362 Ga0114129_10651452
363 Ga0114129_10907623
364 Ga0114129_11713210
365 Ga0105238_10692251
366 Ga0105249_10021953
367 Ga0105249_11779578
368 Ga0163162_10031667
369 Ga0163162_12870958
370 Ga0157372_10150648
371 Ga0157375_12042990
372 Ga0207681_10222254
373 Ga0207687_10742360
374 Ga0207687_10782582
375 Ga0207704_11385764
376 Ga0207712_10268902
377 Ga0207677_12094858
378 Ga0207639_10065342
379 Ga0207648_10065507
380 Ga0207675_100029399
381 Ga0207675_100537177
382 Ga0207428_10005360
383 Ga0207428_10197362
384 Ga0207428_10197409
385 Ga0207428_10707051
386 Ga0207428_10851565
387 Ga0268265_10075088
388 Ga0307408_100028972
389 Ga0307408_100511217
390 Ga0307405_10056601
391 Ga0307405_10101014
392 Ga0307413_10018948
393 Ga0307413_10133223
394 Ga0307413_10371381
395 Ga0307410_10145232
396 Ga0307410_10245560
397 Ga0307410_10399979
398 Ga0307406_10007097
399 Ga0307406_11935573
400 Ga0307407_10024348
401 Ga0307407_10265543
402 Ga0307412_10135218
403 Ga0307412_10339284
404 Ga0307409_100105921
405 Ga0307409_100131814
406 Ga0307409_100467581
407 Ga0307416_100007283
408 Ga0307416_100045247
409 Ga0307416_100911128
410 Ga0307416_102595789
411 Ga0307414_10654475
412 Ga0307411_10282960
413 Ga0307415_100063536
414 Ga0307415_100181069
415 Ga0307415_102278205
416 Ga0395899_0195150
417 Ga0395900_0369486
418 Ga0395900_0520591
419 Ga0395898_0059776
420 Ga0395898_0850291
421 Ga0395901_0038248
422 Ga0395901_0260422
423 Ga0451787_315947
424 Ga0451797_1493084
425 Ga0451802_1278337
426 Ga0451843_0776006
427 Ga0439443_010795
428 Ga0439448_0014300
429 Ga0439448_0054102
430 Ga0439450_005437
431 Ga0439450_023839
432 Ga0439450_026742
433 Ga0439450_116395
434 Ga0439451_033681
435 Ga0439454_014761
436 Ga0439455_0002288
437 Ga0439455_0046935
438 Ga0439455_0165301
439 Ga0439456_105194
440 Ga0439463_001605
441 Ga0439463_003839
442 Ga0439463_005118
443 Ga0439463_056528
444 Ga0439463_087723
445 Ga0450888_026690
446 Ga0450903_038760
447 Ga0450905_064203
448 Ga0439458_0024966
449 Ga0439435_0049814
450 Ga0439444_0007026
451 Ga0439444_0015609
452 Ga0439464_0007923
453 Ga0439464_0016232
454 Ga0439464_0076094
455 Ga0439460_0000802
456 Ga0439460_0009428
457 Ga0439460_0016481
458 Ga0439460_0050482
459 Ga0439460_0069876
460 Ga0450916_021862
461 Ga0439440_0000772
462 Ga0439440_0001724
463 Ga0439440_0018250
464 Ga0439440_0101500
465 Ga0466967_0466618
466 Ga0466967_1137770
467 Ga0495631_0356181
468 Ga0495656_0358546
469 Ga0495656_0537575
470 Ga0495677_0444352
471 Ga0501031_0002989
472 Ga0501032_0050509
473 Ga0501033_0011413
474 Ga0501036_0000187
475 Ga0501036_0001264
476 Ga0501037_0029890
477 Ga0501037_1076249
478 Ga0501038_0090848
479 Ga0501038_0156873
480 Ga0501039_0000373
481 Ga0501039_0170010
482 Ga0501039_1539966
483 Ga0501040_0000125
484 Ga0501040_0001229
485 Ga0501041_0032832
486 Ga0501041_0048934
487 Ga0501041_0172738
488 Ga0501042_0000184
489 Ga0501042_0000405
490 Ga0501043_0028688
491 Ga0501043_0049007
492 Ga0501046_0000606
493 Ga0501046_0001807
494 Ga0501047_0292375
495 Ga0501047_0732985
496 Ga0501048_0001898
497 Ga0501048_0001929
498 Ga0501068_0008836
499 Ga0501069_0015430
500 Ga0501069_0361983
501 Ga0501070_0367205
502 Ga0501071_0005019
503 Ga0501071_0006133
504 Ga0501071_0216551
505 Ga0501071_0449622
506 Ga0501072_0000208
507 Ga0501072_0014744
508 Ga0501073_0712363
509 Ga0501074_0001299
510 Ga0501075_0000245
511 Ga0501075_0002502
512 Ga0501076_0000697
513 Ga0501076_0001132
514 Ga0501077_0002008
515 Ga0501077_0005849
516 Ga0501079_0000355
517 Ga0501079_0000654
518 Ga0501079_0078541
519 Ga0501079_0177440
520 Ga0501080_0016073
521 Ga0501080_0176571
522 Ga0501081_0000966
523 Ga0501081_0023072
524 Ga0501083_0040612
525 Ga0501083_0162456
526 Ga0501035_0005298
527 Ga0501035_0086678
528 Ga0501044_0129450
529 Ga0501044_0458048
530 Ga0501044_0856051
531 Ga0501045_0000039
532 Ga0501045_0003903
533 nmdc:mga05p37_1213708_c1
534 nmdc:mga05p37_1849927_c1
535 nmdc:mga05p37_18641_c1
536 nmdc:mga05p37_19663_c1
537 nmdc:mga05p37_287322_c1
538 nmdc:mga05p37_336680_c1
539 nmdc:mga05p37_535568_c1
540 nmdc:mga05p37_57641_c1
541 nmdc:mga09592_1207634_c1
542 nmdc:mga09592_136165_c1
543 nmdc:mga09592_605294_c1
544 nmdc:mga09592_83429_c1
545 nmdc:mga0qj67_13007_c1
546 nmdc:mga06r32_27135_c1
547 nmdc:mga06r32_29874_c1
548 nmdc:mga08y16_20399_c1
549 nmdc:mga08y16_379924_c1
550 nmdc:mga08y16_543440_c1
551 nmdc:mga08y16_595729_c1
552 nmdc:mga08y16_946427_c1
553 nmdc:mga0n895_1636031_c1
554 nmdc:mga0n895_68708_c1
555 nmdc:mga0rr50_1083577_c1
556 nmdc:mga0rr50_1470554_c1
557 nmdc:mga0rr50_933718_c1
558 nmdc:mga0a205_19665_c1
559 nmdc:mga0a205_19905_c1
560 nmdc:mga0a205_38097_c1
561 nmdc:mga0a205_7494_c1
562 Ga0501084_0000108
563 Ga0501084_0002791
564 Ga0501084_0115407
565 Ga0501084_0458328
566 Ga0501084_1361649
567 Ga0590075_045492
568 Ga0501082_0000443
569 Ga0501082_0003073
570 Ga0530510_0000074
571 Ga0530510_0000396
572 Ga0530510_0085772

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08818

DUF1801

Domain of unknown function (DU1801)

28

123

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.7086 4 121
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.6796 4 121
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.6407 8 110
2lkk-assembly1.cif.gz_A human l-fabp in complex with oleate 0.6166 36 94
3nk3-assembly1.cif.gz_B crystal structure of full-length sperm receptor zp3 at 2.6 a resolution 0.5692 54 91
ID Description Score Start End Superfamily
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.8952 3 111 3.90.1150.200
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.8512 3 111 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7254 7 88 3.90.1150.200
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6533 18 122 3.90.1150.30
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6421 22 110 3.90.1150.30
ID Description Score Start End GO Terms
AF-A0A1F8T6E2-F1-model_v4 YdhG-like domain-containing protein 0.9888 22 117
AF-A0A7W0P0S0-F1-model_v4 DUF1801 domain-containing protein 0.9872 1 117
AF-A0A7C6F7W7-F1-model_v4 DUF1801 domain-containing protein 0.9861 1 118
AF-A0A2D8YJP9-F1-model_v4 deleted 0.9853 1 119
AF-A0A1F8PZR4-F1-model_v4 YdhG-like domain-containing protein 0.9813 1 117

Map