F387502
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 286 | 183 | 286 | 224 |
Family's Representative Sequence
| Representative Sequence | 3300031731|Ga0307405_10432042|Ga0307405_104320421 |
| Length | 257 |
| Sequence | MSWVRAFWRSQVGKKVVMAVTGLVGVGFVIGHMVGNLQMFQGPDKMNGYAHFLHHTVGELLWLVRAVLLAAVVLHVLAAYQLSRDRLGARPVGYRKGPQREVSTLASRTIRWGGVLLFAFIVFHILHFTTRSVFPGYSETDVYGNVVRAFRNPLVTLFYVASMIALGLHLYHGAWSSLRSLGASPPSAHPLRRVGATVVAVIVWAGFTAVPIAVLTGLIQPNSSRAAEPAATARRSAPVAPPAGRVIPTAATASTEK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 51 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 52 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 53 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 54 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 55 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 56 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 57 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 58 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 64 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 71 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 73 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 109 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 110 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 111 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 112 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 113 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 114 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 115 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 116 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 117 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 118 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 119 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 120 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 121 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 122 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 123 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 124 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 125 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 126 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 127 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 128 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 129 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 130 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 131 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 132 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 133 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 134 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 135 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 136 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 137 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 138 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 139 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 140 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 141 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 142 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 143 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 144 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 145 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 146 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 147 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 170 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 171 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 175 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 176 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.7 |
| Rhizosphere | 98.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_2909068 | 2162886012 | Bacteria | 1339 |
| 2 | Ga0065715_10156835 | 3300005293 | Unclassified | 1668 |
| 3 | Ga0070683_100005774 | 3300005329 | Bacteria | 10345 |
| 4 | Ga0070683_100032815 | 3300005329 | Bacteria | 4732 |
| 5 | Ga0070683_100294418 | 3300005329 | Bacteria | 1544 |
| 6 | Ga0070683_100365694 | 3300005329 | Bacteria | 1374 |
| 7 | Ga0070670_100258416 | 3300005331 | Bacteria | 1518 |
| 8 | Ga0070677_10042011 | 3300005333 | Bacteria | 1808 |
| 9 | Ga0070680_100091192 | 3300005336 | Bacteria | 2523 |
| 10 | Ga0070680_100165972 | 3300005336 | Bacteria | 1856 |
| 11 | Ga0070680_100636626 | 3300005336 | Bacteria | 916 |
| 12 | Ga0070682_100004316 | 3300005337 | Bacteria | 7894 |
| 13 | Ga0070682_100055553 | 3300005337 | Bacteria | 2487 |
| 14 | Ga0068868_100031144 | 3300005338 | Bacteria | 4095 |
| 15 | Ga0068868_100180488 | 3300005338 | Bacteria | 1751 |
| 16 | Ga0068868_100731770 | 3300005338 | Unclassified | 887 |
| 17 | Ga0070660_100401712 | 3300005339 | Bacteria | 1133 |
| 18 | Ga0070691_10003248 | 3300005341 | Bacteria | 7293 |
| 19 | Ga0070661_100313935 | 3300005344 | Bacteria | 1223 |
| 20 | Ga0070661_100344409 | 3300005344 | Bacteria | 1168 |
| 21 | Ga0070692_10050745 | 3300005345 | Unclassified | 2155 |
| 22 | Ga0070692_10073902 | 3300005345 | Bacteria | 1822 |
| 23 | Ga0070668_100006172 | 3300005347 | Bacteria | 8873 |
| 24 | Ga0070668_100395345 | 3300005347 | Bacteria | 1179 |
| 25 | Ga0070675_100013802 | 3300005354 | Bacteria | 6360 |
| 26 | Ga0070675_100531381 | 3300005354 | Bacteria | 1062 |
| 27 | Ga0070671_100113424 | 3300005355 | Bacteria | 2277 |
| 28 | Ga0070674_100205416 | 3300005356 | Bacteria | 1524 |
| 29 | Ga0070673_100128356 | 3300005364 | Bacteria | 2124 |
| 30 | Ga0070673_100235885 | 3300005364 | Bacteria | 1588 |
| 31 | Ga0070688_100234084 | 3300005365 | Bacteria | 1301 |
| 32 | Ga0070659_100646761 | 3300005366 | Unclassified | 911 |
| 33 | Ga0070659_100708039 | 3300005366 | Unclassified | 871 |
| 34 | Ga0070667_100124473 | 3300005367 | Bacteria | 2245 |
| 35 | Ga0070709_10217640 | 3300005434 | Bacteria | 1360 |
| 36 | Ga0070713_100035688 | 3300005436 | Bacteria | 4005 |
| 37 | Ga0070713_100879272 | 3300005436 | Unclassified | 861 |
| 38 | Ga0070711_100115525 | 3300005439 | Bacteria | 1976 |
| 39 | Ga0070700_100089325 | 3300005441 | Bacteria | 2007 |
| 40 | Ga0070694_100075270 | 3300005444 | Bacteria | 2335 |
| 41 | Ga0070708_100034342 | 3300005445 | Bacteria | 4412 |
| 42 | Ga0070678_100138628 | 3300005456 | Bacteria | 1943 |
| 43 | Ga0070662_100038454 | 3300005457 | Bacteria | 3398 |
| 44 | Ga0070662_100270345 | 3300005457 | Bacteria | 1372 |
| 45 | Ga0070662_100373860 | 3300005457 | Bacteria | 1172 |
| 46 | Ga0070681_10000222 | 3300005458 | Bacteria | 44616 |
| 47 | Ga0070681_10008335 | 3300005458 | Bacteria | 10152 |
| 48 | Ga0070681_10008594 | 3300005458 | Bacteria | 10009 |
| 49 | Ga0070681_10262556 | 3300005458 | Bacteria | 1639 |
| 50 | Ga0068867_100143090 | 3300005459 | Bacteria | 1871 |
| 51 | Ga0068867_100423962 | 3300005459 | Bacteria | 1128 |
| 52 | Ga0070706_100071817 | 3300005467 | Bacteria | 3202 |
| 53 | Ga0070698_100333403 | 3300005471 | Bacteria | 1448 |
| 54 | Ga0070699_100505137 | 3300005518 | Bacteria | 1098 |
| 55 | Ga0070679_100002036 | 3300005530 | Bacteria | 18148 |
| 56 | Ga0070679_100002378 | 3300005530 | Bacteria | 17053 |
| 57 | Ga0070679_100003733 | 3300005530 | Bacteria | 13959 |
| 58 | Ga0070679_100371260 | 3300005530 | Bacteria | 1378 |
| 59 | Ga0070684_100002030 | 3300005535 | Bacteria | 14896 |
| 60 | Ga0070684_100133672 | 3300005535 | Bacteria | 2239 |
| 61 | Ga0068853_100099701 | 3300005539 | Bacteria | 2566 |
| 62 | Ga0070672_100003019 | 3300005543 | Bacteria | 10843 |
| 63 | Ga0070672_100104951 | 3300005543 | Bacteria | 2297 |
| 64 | Ga0070686_100151846 | 3300005544 | Bacteria | 1623 |
| 65 | Ga0070695_100094677 | 3300005545 | Bacteria | 2000 |
| 66 | Ga0070695_100285043 | 3300005545 | Unclassified | 1215 |
| 67 | Ga0070693_100383539 | 3300005547 | Bacteria | 970 |
| 68 | Ga0068855_100001981 | 3300005563 | Bacteria | 25451 |
| 69 | Ga0068855_100073824 | 3300005563 | Bacteria | 3963 |
| 70 | Ga0068855_100264470 | 3300005563 | Bacteria | 1915 |
| 71 | Ga0068855_100554901 | 3300005563 | Unclassified | 1243 |
| 72 | Ga0070664_100002111 | 3300005564 | Bacteria | 15896 |
| 73 | Ga0068857_100039951 | 3300005577 | Bacteria | 4159 |
| 74 | Ga0068854_100035807 | 3300005578 | Bacteria | 3476 |
| 75 | Ga0068854_100651952 | 3300005578 | Unclassified | 904 |
| 76 | Ga0068866_10034177 | 3300005718 | Bacteria | 2474 |
| 77 | Ga0068861_100302805 | 3300005719 | Bacteria | 1385 |
| 78 | Ga0068863_100988445 | 3300005841 | Bacteria | 844 |
| 79 | Ga0070716_100002833 | 3300006173 | Bacteria | 8070 |
| 80 | Ga0097621_100969517 | 3300006237 | Unclassified | 794 |
| 81 | Ga0075428_100005120 | 3300006844 | Bacteria | 14567 |
| 82 | Ga0075430_100002547 | 3300006846 | Bacteria | 15203 |
| 83 | Ga0075431_100002748 | 3300006847 | Bacteria | 17062 |
| 84 | Ga0075433_10021518 | 3300006852 | Bacteria | 5409 |
| 85 | Ga0075429_100007025 | 3300006880 | Bacteria | 9781 |
| 86 | Ga0068865_100031423 | 3300006881 | Bacteria | 3541 |
| 87 | Ga0075436_100038450 | 3300006914 | Bacteria | 3303 |
| 88 | Ga0075435_100472316 | 3300007076 | Unclassified | 1083 |
| 89 | Ga0105240_10426337 | 3300009093 | Bacteria | 1489 |
| 90 | Ga0105245_10041509 | 3300009098 | Bacteria | 4101 |
| 91 | Ga0105245_10106033 | 3300009098 | Bacteria | 2607 |
| 92 | Ga0105245_10394827 | 3300009098 | Bacteria | 1381 |
| 93 | Ga0114129_10243381 | 3300009147 | Bacteria | 2418 |
| 94 | Ga0105241_10816200 | 3300009174 | Unclassified | 860 |
| 95 | Ga0105248_10531247 | 3300009177 | Bacteria | 1327 |
| 96 | Ga0099796_10098811 | 3300010159 | Bacteria | 1095 |
| 97 | Ga0157373_10284750 | 3300013100 | Bacteria | 1171 |
| 98 | Ga0157370_10063167 | 3300013104 | Bacteria | 3510 |
| 99 | Ga0157370_10663072 | 3300013104 | Bacteria | 953 |
| 100 | Ga0157374_10049665 | 3300013296 | Bacteria | 3897 |
| 101 | Ga0157374_10856502 | 3300013296 | Bacteria | 926 |
| 102 | Ga0157378_10016089 | 3300013297 | Bacteria | 6551 |
| 103 | Ga0157378_10355243 | 3300013297 | Bacteria | 1433 |
| 104 | Ga0157372_10022955 | 3300013307 | Bacteria | 6759 |
| 105 | Ga0157372_10052898 | 3300013307 | Bacteria | 4524 |
| 106 | Ga0157372_10378618 | 3300013307 | Bacteria | 1649 |
| 107 | Ga0157372_10609187 | 3300013307 | Bacteria | 1273 |
| 108 | Ga0157375_10632762 | 3300013308 | Bacteria | 1227 |
| 109 | Ga0157375_11097402 | 3300013308 | Bacteria | 931 |
| 110 | Ga0182008_10059729 | 3300014497 | Bacteria | 1881 |
| 111 | Ga0157376_10352441 | 3300014969 | Bacteria | 1409 |
| 112 | Ga0213876_10018576 | 3300021384 | Bacteria | 3671 |
| 113 | Ga0207692_10042847 | 3300025898 | Bacteria | 2249 |
| 114 | Ga0207642_10075937 | 3300025899 | Bacteria | 1616 |
| 115 | Ga0207705_10246674 | 3300025909 | Bacteria | 1361 |
| 116 | Ga0207684_10315621 | 3300025910 | Unclassified | 1347 |
| 117 | Ga0207707_10005302 | 3300025912 | Bacteria | 11269 |
| 118 | Ga0207707_10040083 | 3300025912 | Bacteria | 4093 |
| 119 | Ga0207695_10601237 | 3300025913 | Unclassified | 981 |
| 120 | Ga0207660_10052037 | 3300025917 | Bacteria | 2914 |
| 121 | Ga0207660_10059102 | 3300025917 | Bacteria | 2751 |
| 122 | Ga0207660_10061028 | 3300025917 | Bacteria | 2713 |
| 123 | Ga0207662_10036880 | 3300025918 | Bacteria | 2859 |
| 124 | Ga0207652_10003589 | 3300025921 | Bacteria | 12781 |
| 125 | Ga0207652_10007476 | 3300025921 | Bacteria | 8804 |
| 126 | Ga0207652_10112418 | 3300025921 | Bacteria | 2417 |
| 127 | Ga0207646_10116268 | 3300025922 | Bacteria | 2402 |
| 128 | Ga0207650_10236337 | 3300025925 | Bacteria | 1476 |
| 129 | Ga0207650_10268237 | 3300025925 | Bacteria | 1387 |
| 130 | Ga0207659_10031638 | 3300025926 | Bacteria | 3625 |
| 131 | Ga0207659_10352347 | 3300025926 | Bacteria | 1222 |
| 132 | Ga0207687_10238312 | 3300025927 | Bacteria | 1440 |
| 133 | Ga0207687_10276643 | 3300025927 | Bacteria | 1344 |
| 134 | Ga0207700_10052302 | 3300025928 | Bacteria | 3053 |
| 135 | Ga0207700_10519547 | 3300025928 | Bacteria | 1055 |
| 136 | Ga0207644_10065919 | 3300025931 | Bacteria | 2635 |
| 137 | Ga0207644_10609771 | 3300025931 | Unclassified | 907 |
| 138 | Ga0207690_10399592 | 3300025932 | Bacteria | 1096 |
| 139 | Ga0207706_10010068 | 3300025933 | Bacteria | 8659 |
| 140 | Ga0207665_10000198 | 3300025939 | Bacteria | 40191 |
| 141 | Ga0207665_10401530 | 3300025939 | Bacteria | 1044 |
| 142 | Ga0207691_10025589 | 3300025940 | Bacteria | 5539 |
| 143 | Ga0207691_10099896 | 3300025940 | Bacteria | 2590 |
| 144 | Ga0207661_10001463 | 3300025944 | Bacteria | 15968 |
| 145 | Ga0207679_10004150 | 3300025945 | Bacteria | 8999 |
| 146 | Ga0207667_10031775 | 3300025949 | Bacteria | 5696 |
| 147 | Ga0207667_10134040 | 3300025949 | Bacteria | 2551 |
| 148 | Ga0207651_10067133 | 3300025960 | Bacteria | 2523 |
| 149 | Ga0207651_10356398 | 3300025960 | Bacteria | 1233 |
| 150 | Ga0207668_10005068 | 3300025972 | Bacteria | 7755 |
| 151 | Ga0207668_10257317 | 3300025972 | Bacteria | 1421 |
| 152 | Ga0207658_10258876 | 3300025986 | Bacteria | 1482 |
| 153 | Ga0207677_10060895 | 3300026023 | Bacteria | 2611 |
| 154 | Ga0207677_10118336 | 3300026023 | Bacteria | 1987 |
| 155 | Ga0207677_11031029 | 3300026023 | Unclassified | 747 |
| 156 | Ga0207639_10032706 | 3300026041 | Bacteria | 3831 |
| 157 | Ga0207708_10124078 | 3300026075 | Bacteria | 2014 |
| 158 | Ga0207648_10050508 | 3300026089 | Bacteria | 3637 |
| 159 | Ga0207648_10118459 | 3300026089 | Bacteria | 2327 |
| 160 | Ga0207648_10355443 | 3300026089 | Bacteria | 1321 |
| 161 | Ga0207674_10049475 | 3300026116 | Bacteria | 4299 |
| 162 | Ga0207675_100231614 | 3300026118 | Bacteria | 1782 |
| 163 | Ga0207675_100247001 | 3300026118 | Bacteria | 1726 |
| 164 | Ga0207675_100264884 | 3300026118 | Bacteria | 1666 |
| 165 | Ga0207675_100325928 | 3300026118 | Bacteria | 1500 |
| 166 | Ga0207683_10024672 | 3300026121 | Bacteria | 5181 |
| 167 | Ga0207698_10257523 | 3300026142 | Bacteria | 1601 |
| 168 | Ga0209967_1018097 | 3300027364 | Bacteria | 1019 |
| 169 | Ga0209968_1004258 | 3300027526 | Bacteria | 2148 |
| 170 | Ga0265332_10015668 | 3300031238 | Bacteria | 3347 |
| 171 | Ga0265332_10036651 | 3300031238 | Bacteria | 2129 |
| 172 | Ga0265327_10006193 | 3300031251 | Bacteria | 9650 |
| 173 | Ga0307408_100005157 | 3300031548 | Bacteria | 8761 |
| 174 | Ga0307408_100238358 | 3300031548 | Bacteria | 1494 |
| 175 | Ga0307408_100304092 | 3300031548 | Bacteria | 1337 |
| 176 | Ga0265314_10035773 | 3300031711 | Bacteria | 3617 |
| 177 | Ga0265314_10078469 | 3300031711 | Bacteria | 2186 |
| 178 | Ga0307405_10000086 | 3300031731 | Bacteria | 39376 |
| 179 | Ga0307405_10000905 | 3300031731 | Bacteria | 11779 |
| 180 | Ga0307405_10017951 | 3300031731 | Bacteria | 3894 |
| 181 | Ga0307405_10229599 | 3300031731 | Bacteria | 1367 |
| 182 | Ga0307405_10432042 | 3300031731 | Bacteria | 1039 |
| 183 | Ga0307413_10000077 | 3300031824 | Bacteria | 24398 |
| 184 | Ga0307413_10004259 | 3300031824 | Bacteria | 6194 |
| 185 | Ga0307413_10007052 | 3300031824 | Bacteria | 5183 |
| 186 | Ga0307413_10018755 | 3300031824 | Bacteria | 3638 |
| 187 | Ga0307413_10021457 | 3300031824 | Bacteria | 3459 |
| 188 | Ga0307410_10004881 | 3300031852 | Bacteria | 7018 |
| 189 | Ga0307410_10018693 | 3300031852 | Bacteria | 4193 |
| 190 | Ga0307406_10000581 | 3300031901 | Bacteria | 21084 |
| 191 | Ga0307406_10003327 | 3300031901 | Bacteria | 8767 |
| 192 | Ga0307406_10013210 | 3300031901 | Bacteria | 4726 |
| 193 | Ga0307406_10164593 | 3300031901 | Bacteria | 1598 |
| 194 | Ga0307407_10002465 | 3300031903 | Bacteria | 7252 |
| 195 | Ga0307407_10012324 | 3300031903 | Bacteria | 4106 |
| 196 | Ga0307407_10053646 | 3300031903 | Bacteria | 2320 |
| 197 | Ga0307412_10013744 | 3300031911 | Bacteria | 4756 |
| 198 | Ga0307412_10014318 | 3300031911 | Bacteria | 4674 |
| 199 | Ga0307412_10029611 | 3300031911 | Bacteria | 3438 |
| 200 | Ga0307409_100000277 | 3300031995 | Bacteria | 20763 |
| 201 | Ga0307409_100006782 | 3300031995 | Bacteria | 6773 |
| 202 | Ga0307416_100004116 | 3300032002 | Bacteria | 8707 |
| 203 | Ga0307416_100007098 | 3300032002 | Bacteria | 7080 |
| 204 | Ga0307416_100030861 | 3300032002 | Bacteria | 4027 |
| 205 | Ga0307416_100167815 | 3300032002 | Bacteria | 2038 |
| 206 | Ga0307416_100288836 | 3300032002 | Bacteria | 1622 |
| 207 | Ga0307416_100640572 | 3300032002 | Bacteria | 1147 |
| 208 | Ga0307414_10009785 | 3300032004 | Bacteria | 5525 |
| 209 | Ga0307414_10056401 | 3300032004 | Bacteria | 2755 |
| 210 | Ga0307411_10000937 | 3300032005 | Bacteria | 11130 |
| 211 | Ga0307411_10034799 | 3300032005 | Bacteria | 3138 |
| 212 | Ga0307411_10036011 | 3300032005 | Bacteria | 3096 |
| 213 | Ga0307411_10143376 | 3300032005 | Bacteria | 1764 |
| 214 | Ga0307415_100002617 | 3300032126 | Bacteria | 8970 |
| 215 | Ga0307415_100008643 | 3300032126 | Bacteria | 5658 |
| 216 | Ga0307415_100025293 | 3300032126 | Bacteria | 3722 |
| 217 | Ga0373959_0020420 | 3300034820 | Bacteria | 1264 |
| 218 | Ga0373926_0054317 | 3300035083 | Bacteria | 1451 |
| 219 | Ga0373934_0154644 | 3300035086 | Bacteria | 940 |
| 220 | Ga0373923_0067594 | 3300035111 | Bacteria | 1529 |
| 221 | Ga0373941_0005137 | 3300035115 | Bacteria | 3061 |
| 222 | Ga0373954_0310659 | 3300035118 | Bacteria | 778 |
| 223 | Ga0373956_0160237 | 3300035119 | Unclassified | 1060 |
| 224 | Ga0373957_0031396 | 3300035120 | Bacteria | 1952 |
| 225 | Ga0373957_0075400 | 3300035120 | Bacteria | 1325 |
| 226 | Ga0373943_0011184 | 3300035170 | Bacteria | 4035 |
| 227 | Ga0316574_0040174 | 3300035398 | Bacteria | 2880 |
| 228 | Ga0373924_0005409 | 3300035410 | Bacteria | 4520 |
| 229 | Ga0373935_0086833 | 3300035692 | Bacteria | 2042 |
| 230 | Ga0373927_0011952 | 3300035695 | Bacteria | 5776 |
| 231 | Ga0373927_0366086 | 3300035695 | Bacteria | 950 |
| 232 | Ga0373927_0381732 | 3300035695 | Bacteria | 929 |
| 233 | Ga0373933_0144142 | 3300035724 | Bacteria | 1505 |
| 234 | Ga0373937_0008514 | 3300036401 | Bacteria | 8912 |
| 235 | Ga0373937_0212714 | 3300036401 | Bacteria | 1819 |
| 236 | Ga0373925_0133973 | 3300037068 | Bacteria | 1934 |
| 237 | Ga0395900_0058519 | 3300037418 | Bacteria | 3967 |
| 238 | Ga0395905_0004043 | 3300037471 | Bacteria | 15393 |
| 239 | Ga0395901_0002608 | 3300038443 | Bacteria | 18254 |
| 240 | Ga0242420_047757 | 3300038996 | Bacteria | 831 |
| 241 | Ga0436365_0815860 | 3300039437 | Bacteria | 13587 |
| 242 | Ga0451837_0369968 | 3300041494 | Unclassified | 2069 |
| 243 | Ga0451577_0143244 | 3300042876 | Bacteria | 2148 |
| 244 | Ga0466958_0045253 | 3300045836 | Bacteria | 2654 |
| 245 | Ga0495629_0075960 | 3300046459 | Bacteria | 2346 |
| 246 | Ga0495651_0048407 | 3300046462 | Bacteria | 3284 |
| 247 | Ga0495580_0132120 | 3300046472 | Bacteria | 1731 |
| 248 | Ga0495580_0156479 | 3300046472 | Bacteria | 1578 |
| 249 | Ga0495594_0047364 | 3300046499 | Bacteria | 2361 |
| 250 | Ga0495608_0008584 | 3300046511 | Bacteria | 7156 |
| 251 | Ga0495628_0065450 | 3300046516 | Bacteria | 2843 |
| 252 | Ga0495628_0073937 | 3300046516 | Bacteria | 2655 |
| 253 | Ga0495630_0004942 | 3300046517 | Bacteria | 9376 |
| 254 | Ga0495666_0030672 | 3300046526 | Bacteria | 2637 |
| 255 | Ga0495652_0033082 | 3300046529 | Bacteria | 4518 |
| 256 | Ga0495586_0010835 | 3300046535 | Bacteria | 4847 |
| 257 | Ga0495586_0023502 | 3300046535 | Bacteria | 3293 |
| 258 | Ga0495587_0011754 | 3300046536 | Bacteria | 5537 |
| 259 | Ga0495645_0047922 | 3300046543 | Bacteria | 3112 |
| 260 | Ga0495667_0004021 | 3300046559 | Bacteria | 9884 |
| 261 | Ga0495599_0010151 | 3300046678 | Bacteria | 5767 |
| 262 | Ga0495623_0020234 | 3300046679 | Bacteria | 4301 |
| 263 | Ga0495600_0089281 | 3300046809 | Bacteria | 2011 |
| 264 | Ga0495581_0020329 | 3300047315 | Bacteria | 3854 |
| 265 | Ga0495604_0057535 | 3300047317 | Bacteria | 2989 |
| 266 | Ga0495674_0071461 | 3300047319 | Bacteria | 2995 |
| 267 | Ga0495675_0006888 | 3300047444 | Bacteria | 6979 |
| 268 | Ga0495675_0011290 | 3300047444 | Bacteria | 5605 |
| 269 | Ga0495593_0063962 | 3300047673 | Bacteria | 1921 |
| 270 | Ga0495602_0070742 | 3300048088 | Bacteria | 2983 |
| 271 | Ga0496112_0004636 | 3300048915 | Bacteria | 11692 |
| 272 | Ga0496115_0019628 | 3300048918 | Bacteria | 5204 |
| 273 | Ga0501037_0368317 | 3300049573 | Bacteria | 989 |
| 274 | Ga0501046_0117287 | 3300049580 | Bacteria | 2028 |
| 275 | Ga0501047_0204931 | 3300049581 | Bacteria | 1832 |
| 276 | Ga0501249_057260 | 3300049679 | Bacteria | 900 |
| 277 | Ga0501270_017068 | 3300049767 | Bacteria | 1058 |
| 278 | nmdc:mga05p37_1170_c2 | 3300050507 | Bacteria | 27090 |
| 279 | nmdc:mga09592_3136_c1 | 3300050508 | Bacteria | 13427 |
| 280 | nmdc:mga0qj67_3736_c1 | 3300050509 | Bacteria | 10988 |
| 281 | nmdc:mga0qj67_4807_c1 | 3300050509 | Bacteria | 9809 |
| 282 | nmdc:mga06r32_11880_c1 | 3300050510 | Bacteria | 7844 |
| 283 | nmdc:mga0rr50_39638_c1 | 3300050513 | Bacteria | 3418 |
| 284 | nmdc:mga0a205_30046_c1 | 3300050515 | Bacteria | 5201 |
| 285 | Ga0495601_0107904 | 3300053077 | Bacteria | 1801 |
| 286 | Ga0495619_0361021 | 3300053085 | Unclassified | 1004 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025939 | Ga0207665_10401530 | Ga0207665_104015302 | 161 |
| 2 | 3300005841 | Ga0068863_100988445 | Ga0068863_1009884451 | 169 |
| 3 | 3300013296 | Ga0157374_10856502 | Ga0157374_108565022 | 172 |
| 4 | 3300005329 | Ga0070683_100365694 | Ga0070683_1003656942 | 173 |
| 5 | 3300009177 | Ga0105248_10531247 | Ga0105248_105312472 | 173 |
| 6 | 3300005338 | Ga0068868_100180488 | Ga0068868_1001804882 | 174 |
| 7 | 3300005344 | Ga0070661_100344409 | Ga0070661_1003444092 | 174 |
| 8 | 3300005364 | Ga0070673_100235885 | Ga0070673_1002358852 | 174 |
| 9 | 3300005365 | Ga0070688_100234084 | Ga0070688_1002340842 | 174 |
| 10 | 3300005366 | Ga0070659_100646761 | Ga0070659_1006467612 | 174 |
| 11 | 3300005367 | Ga0070667_100124473 | Ga0070667_1001244732 | 174 |
| 12 | 3300005563 | Ga0068855_100264470 | Ga0068855_1002644702 | 174 |
| 13 | 3300005719 | Ga0068861_100302805 | Ga0068861_1003028052 | 174 |
| 14 | 3300013297 | Ga0157378_10355243 | Ga0157378_103552432 | 174 |
| 15 | 3300013307 | Ga0157372_10052898 | Ga0157372_100528982 | 174 |
| 16 | 3300013308 | Ga0157375_10632762 | Ga0157375_106327622 | 174 |
| 17 | 3300025931 | Ga0207644_10065919 | Ga0207644_100659192 | 174 |
| 18 | 3300026023 | Ga0207677_10118336 | Ga0207677_101183362 | 174 |
| 19 | 3300050509 | nmdc:mga0qj67_4807_c1 | nmdc:mga0qj67_4807_c1_8599_9282 | 175 |
| 20 | 3300005337 | Ga0070682_100055553 | Ga0070682_1000555532 | 181 |
| 21 | 3300005434 | Ga0070709_10217640 | Ga0070709_102176402 | 181 |
| 22 | 3300005444 | Ga0070694_100075270 | Ga0070694_1000752702 | 181 |
| 23 | 3300005563 | Ga0068855_100001981 | Ga0068855_10000198127 | 181 |
| 24 | 3300005578 | Ga0068854_100651952 | Ga0068854_1006519522 | 181 |
| 25 | 3300006173 | Ga0070716_100002833 | Ga0070716_1000028337 | 181 |
| 26 | 3300009098 | Ga0105245_10041509 | Ga0105245_100415092 | 181 |
| 27 | 3300009098 | Ga0105245_10394827 | Ga0105245_103948272 | 181 |
| 28 | 3300013307 | Ga0157372_10022955 | Ga0157372_100229552 | 181 |
| 29 | 3300025898 | Ga0207692_10042847 | Ga0207692_100428472 | 181 |
| 30 | 3300025913 | Ga0207695_10601237 | Ga0207695_106012372 | 181 |
| 31 | 3300025927 | Ga0207687_10238312 | Ga0207687_102383122 | 181 |
| 32 | 3300025939 | Ga0207665_10000198 | Ga0207665_1000019817 | 181 |
| 33 | 3300025949 | Ga0207667_10031775 | Ga0207667_100317754 | 181 |
| 34 | 3300034820 | Ga0373959_0020420 | Ga0373959_0020420_236_868 | 181 |
| 35 | 3300041494 | Ga0451837_0369968 | Ga0451837_0369968_1278_1952 | 183 |
| 36 | 3300045836 | Ga0466958_0045253 | Ga0466958_0045253_1460_2122 | 183 |
| 37 | 3300032002 | Ga0307416_100288836 | Ga0307416_1002888362 | 184 |
| 38 | 3300049679 | Ga0501249_057260 | Ga0501249_057260_130_840 | 184 |
| 39 | 3300005545 | Ga0070695_100285043 | Ga0070695_1002850432 | 185 |
| 40 | 3300035398 | Ga0316574_0040174 | Ga0316574_0040174_458_1135 | 186 |
| 41 | 3300031238 | Ga0265332_10036651 | Ga0265332_100366512 | 187 |
| 42 | 3300031711 | Ga0265314_10078469 | Ga0265314_100784692 | 187 |
| 43 | 3300005329 | Ga0070683_100005774 | Ga0070683_10000577412 | 190 |
| 44 | 3300005331 | Ga0070670_100258416 | Ga0070670_1002584162 | 190 |
| 45 | 3300005333 | Ga0070677_10042011 | Ga0070677_100420112 | 190 |
| 46 | 3300005338 | Ga0068868_100731770 | Ga0068868_1007317701 | 190 |
| 47 | 3300005344 | Ga0070661_100313935 | Ga0070661_1003139352 | 190 |
| 48 | 3300005355 | Ga0070671_100113424 | Ga0070671_1001134241 | 190 |
| 49 | 3300005364 | Ga0070673_100128356 | Ga0070673_1001283563 | 190 |
| 50 | 3300005366 | Ga0070659_100708039 | Ga0070659_1007080391 | 190 |
| 51 | 3300005436 | Ga0070713_100035688 | Ga0070713_1000356882 | 190 |
| 52 | 3300005439 | Ga0070711_100115525 | Ga0070711_1001155252 | 190 |
| 53 | 3300005457 | Ga0070662_100270345 | Ga0070662_1002703452 | 190 |
| 54 | 3300005535 | Ga0070684_100133672 | Ga0070684_1001336722 | 190 |
| 55 | 3300005543 | Ga0070672_100104951 | Ga0070672_1001049512 | 190 |
| 56 | 3300005563 | Ga0068855_100554901 | Ga0068855_1005549012 | 190 |
| 57 | 3300013104 | Ga0157370_10063167 | Ga0157370_100631673 | 190 |
| 58 | 3300014497 | Ga0182008_10059729 | Ga0182008_100597292 | 190 |
| 59 | 3300025925 | Ga0207650_10236337 | Ga0207650_102363372 | 190 |
| 60 | 3300025928 | Ga0207700_10052302 | Ga0207700_100523022 | 190 |
| 61 | 3300025931 | Ga0207644_10609771 | Ga0207644_106097712 | 190 |
| 62 | 3300025940 | Ga0207691_10099896 | Ga0207691_100998963 | 190 |
| 63 | 3300025960 | Ga0207651_10356398 | Ga0207651_103563982 | 190 |
| 64 | 3300031548 | Ga0307408_100005157 | Ga0307408_1000051577 | 190 |
| 65 | 3300031731 | Ga0307405_10000905 | Ga0307405_1000090512 | 190 |
| 66 | 3300031824 | Ga0307413_10000077 | Ga0307413_1000007722 | 190 |
| 67 | 3300031852 | Ga0307410_10018693 | Ga0307410_100186932 | 190 |
| 68 | 3300031901 | Ga0307406_10003327 | Ga0307406_100033277 | 190 |
| 69 | 3300031903 | Ga0307407_10002465 | Ga0307407_100024654 | 190 |
| 70 | 3300031911 | Ga0307412_10014318 | Ga0307412_100143183 | 190 |
| 71 | 3300032002 | Ga0307416_100167815 | Ga0307416_1001678152 | 190 |
| 72 | 3300032004 | Ga0307414_10056401 | Ga0307414_100564012 | 190 |
| 73 | 3300032005 | Ga0307411_10034799 | Ga0307411_100347992 | 190 |
| 74 | 3300032126 | Ga0307415_100008643 | Ga0307415_1000086432 | 190 |
| 75 | 3300035083 | Ga0373926_0054317 | Ga0373926_0054317_617_1297 | 190 |
| 76 | 3300035086 | Ga0373934_0154644 | Ga0373934_0154644_88_768 | 190 |
| 77 | 3300035111 | Ga0373923_0067594 | Ga0373923_0067594_820_1500 | 190 |
| 78 | 3300035118 | Ga0373954_0310659 | Ga0373954_0310659_53_733 | 190 |
| 79 | 3300035119 | Ga0373956_0160237 | Ga0373956_0160237_318_998 | 190 |
| 80 | 3300035120 | Ga0373957_0031396 | Ga0373957_0031396_638_1318 | 190 |
| 81 | 3300035120 | Ga0373957_0075400 | Ga0373957_0075400_583_1263 | 190 |
| 82 | 3300035170 | Ga0373943_0011184 | Ga0373943_0011184_3222_3902 | 190 |
| 83 | 3300035410 | Ga0373924_0005409 | Ga0373924_0005409_3231_3911 | 190 |
| 84 | 3300035695 | Ga0373927_0011952 | Ga0373927_0011952_4517_5197 | 190 |
| 85 | 3300035695 | Ga0373927_0366086 | Ga0373927_0366086_252_932 | 190 |
| 86 | 3300035695 | Ga0373927_0381732 | Ga0373927_0381732_30_710 | 190 |
| 87 | 3300035724 | Ga0373933_0144142 | Ga0373933_0144142_634_1314 | 190 |
| 88 | 3300036401 | Ga0373937_0008514 | Ga0373937_0008514_6869_7549 | 190 |
| 89 | 3300036401 | Ga0373937_0212714 | Ga0373937_0212714_222_902 | 190 |
| 90 | 3300037068 | Ga0373925_0133973 | Ga0373925_0133973_336_1016 | 190 |
| 91 | 3300042876 | Ga0451577_0143244 | Ga0451577_0143244_1076_1735 | 190 |
| 92 | 3300046459 | Ga0495629_0075960 | Ga0495629_0075960_1328_2008 | 190 |
| 93 | 3300046462 | Ga0495651_0048407 | Ga0495651_0048407_1589_2269 | 190 |
| 94 | 3300046472 | Ga0495580_0132120 | Ga0495580_0132120_705_1385 | 190 |
| 95 | 3300046472 | Ga0495580_0156479 | Ga0495580_0156479_273_953 | 190 |
| 96 | 3300046499 | Ga0495594_0047364 | Ga0495594_0047364_1606_2286 | 190 |
| 97 | 3300046511 | Ga0495608_0008584 | Ga0495608_0008584_3562_4242 | 190 |
| 98 | 3300046516 | Ga0495628_0065450 | Ga0495628_0065450_1774_2454 | 190 |
| 99 | 3300046516 | Ga0495628_0073937 | Ga0495628_0073937_26_706 | 190 |
| 100 | 3300046517 | Ga0495630_0004942 | Ga0495630_0004942_7164_7844 | 190 |
| 101 | 3300046526 | Ga0495666_0030672 | Ga0495666_0030672_919_1599 | 190 |
| 102 | 3300046529 | Ga0495652_0033082 | Ga0495652_0033082_1759_2439 | 190 |
| 103 | 3300046535 | Ga0495586_0010835 | Ga0495586_0010835_2223_2903 | 190 |
| 104 | 3300046535 | Ga0495586_0023502 | Ga0495586_0023502_2401_3081 | 190 |
| 105 | 3300046536 | Ga0495587_0011754 | Ga0495587_0011754_3595_4275 | 190 |
| 106 | 3300046543 | Ga0495645_0047922 | Ga0495645_0047922_1614_2294 | 190 |
| 107 | 3300046559 | Ga0495667_0004021 | Ga0495667_0004021_5615_6295 | 190 |
| 108 | 3300046678 | Ga0495599_0010151 | Ga0495599_0010151_1516_2196 | 190 |
| 109 | 3300046679 | Ga0495623_0020234 | Ga0495623_0020234_2629_3309 | 190 |
| 110 | 3300046809 | Ga0495600_0089281 | Ga0495600_0089281_944_1624 | 190 |
| 111 | 3300047315 | Ga0495581_0020329 | Ga0495581_0020329_124_804 | 190 |
| 112 | 3300047317 | Ga0495604_0057535 | Ga0495604_0057535_2039_2719 | 190 |
| 113 | 3300047319 | Ga0495674_0071461 | Ga0495674_0071461_1235_1915 | 190 |
| 114 | 3300047444 | Ga0495675_0006888 | Ga0495675_0006888_5294_5974 | 190 |
| 115 | 3300047444 | Ga0495675_0011290 | Ga0495675_0011290_1330_2010 | 190 |
| 116 | 3300047673 | Ga0495593_0063962 | Ga0495593_0063962_924_1604 | 190 |
| 117 | 3300048088 | Ga0495602_0070742 | Ga0495602_0070742_221_901 | 190 |
| 118 | 3300053077 | Ga0495601_0107904 | Ga0495601_0107904_959_1639 | 190 |
| 119 | 3300053085 | Ga0495619_0361021 | Ga0495619_0361021_204_884 | 190 |
| 120 | 2162886012 | MBSR1b_contig_2909068 | MBSR1b_0228.00007460 | 191 |
| 121 | 3300005293 | Ga0065715_10156835 | Ga0065715_101568352 | 191 |
| 122 | 3300005329 | Ga0070683_100032815 | Ga0070683_1000328152 | 191 |
| 123 | 3300005329 | Ga0070683_100294418 | Ga0070683_1002944182 | 191 |
| 124 | 3300005336 | Ga0070680_100091192 | Ga0070680_1000911922 | 191 |
| 125 | 3300005336 | Ga0070680_100165972 | Ga0070680_1001659722 | 191 |
| 126 | 3300005336 | Ga0070680_100636626 | Ga0070680_1006366262 | 191 |
| 127 | 3300005337 | Ga0070682_100004316 | Ga0070682_1000043167 | 191 |
| 128 | 3300005338 | Ga0068868_100031144 | Ga0068868_1000311442 | 191 |
| 129 | 3300005339 | Ga0070660_100401712 | Ga0070660_1004017122 | 191 |
| 130 | 3300005341 | Ga0070691_10003248 | Ga0070691_100032484 | 191 |
| 131 | 3300005345 | Ga0070692_10050745 | Ga0070692_100507453 | 191 |
| 132 | 3300005345 | Ga0070692_10073902 | Ga0070692_100739022 | 191 |
| 133 | 3300005347 | Ga0070668_100006172 | Ga0070668_1000061727 | 191 |
| 134 | 3300005347 | Ga0070668_100395345 | Ga0070668_1003953452 | 191 |
| 135 | 3300005354 | Ga0070675_100013802 | Ga0070675_1000138023 | 191 |
| 136 | 3300005354 | Ga0070675_100531381 | Ga0070675_1005313812 | 191 |
| 137 | 3300005356 | Ga0070674_100205416 | Ga0070674_1002054162 | 191 |
| 138 | 3300005436 | Ga0070713_100879272 | Ga0070713_1008792721 | 191 |
| 139 | 3300005441 | Ga0070700_100089325 | Ga0070700_1000893252 | 191 |
| 140 | 3300005445 | Ga0070708_100034342 | Ga0070708_1000343423 | 191 |
| 141 | 3300005456 | Ga0070678_100138628 | Ga0070678_1001386283 | 191 |
| 142 | 3300005457 | Ga0070662_100038454 | Ga0070662_1000384542 | 191 |
| 143 | 3300005457 | Ga0070662_100373860 | Ga0070662_1003738602 | 191 |
| 144 | 3300005458 | Ga0070681_10000222 | Ga0070681_1000022243 | 191 |
| 145 | 3300005458 | Ga0070681_10008335 | Ga0070681_100083356 | 191 |
| 146 | 3300005458 | Ga0070681_10008594 | Ga0070681_100085942 | 191 |
| 147 | 3300005458 | Ga0070681_10262556 | Ga0070681_102625562 | 191 |
| 148 | 3300005459 | Ga0068867_100143090 | Ga0068867_1001430902 | 191 |
| 149 | 3300005459 | Ga0068867_100423962 | Ga0068867_1004239622 | 191 |
| 150 | 3300005467 | Ga0070706_100071817 | Ga0070706_1000718172 | 191 |
| 151 | 3300005471 | Ga0070698_100333403 | Ga0070698_1003334032 | 191 |
| 152 | 3300005518 | Ga0070699_100505137 | Ga0070699_1005051372 | 191 |
| 153 | 3300005530 | Ga0070679_100002036 | Ga0070679_10000203616 | 191 |
| 154 | 3300005530 | Ga0070679_100002378 | Ga0070679_10000237818 | 191 |
| 155 | 3300005530 | Ga0070679_100003733 | Ga0070679_10000373311 | 191 |
| 156 | 3300005530 | Ga0070679_100371260 | Ga0070679_1003712602 | 191 |
| 157 | 3300005535 | Ga0070684_100002030 | Ga0070684_10000203010 | 191 |
| 158 | 3300005539 | Ga0068853_100099701 | Ga0068853_1000997013 | 191 |
| 159 | 3300005543 | Ga0070672_100003019 | Ga0070672_1000030196 | 191 |
| 160 | 3300005544 | Ga0070686_100151846 | Ga0070686_1001518462 | 191 |
| 161 | 3300005545 | Ga0070695_100094677 | Ga0070695_1000946772 | 191 |
| 162 | 3300005547 | Ga0070693_100383539 | Ga0070693_1003835392 | 191 |
| 163 | 3300005563 | Ga0068855_100073824 | Ga0068855_1000738243 | 191 |
| 164 | 3300005564 | Ga0070664_100002111 | Ga0070664_10000211116 | 191 |
| 165 | 3300005577 | Ga0068857_100039951 | Ga0068857_1000399513 | 191 |
| 166 | 3300005578 | Ga0068854_100035807 | Ga0068854_1000358072 | 191 |
| 167 | 3300005718 | Ga0068866_10034177 | Ga0068866_100341772 | 191 |
| 168 | 3300006237 | Ga0097621_100969517 | Ga0097621_1009695171 | 191 |
| 169 | 3300006844 | Ga0075428_100005120 | Ga0075428_1000051204 | 191 |
| 170 | 3300006846 | Ga0075430_100002547 | Ga0075430_1000025476 | 191 |
| 171 | 3300006847 | Ga0075431_100002748 | Ga0075431_1000027486 | 191 |
| 172 | 3300006852 | Ga0075433_10021518 | Ga0075433_100215182 | 191 |
| 173 | 3300006880 | Ga0075429_100007025 | Ga0075429_1000070256 | 191 |
| 174 | 3300006881 | Ga0068865_100031423 | Ga0068865_1000314232 | 191 |
| 175 | 3300006914 | Ga0075436_100038450 | Ga0075436_1000384503 | 191 |
| 176 | 3300007076 | Ga0075435_100472316 | Ga0075435_1004723162 | 191 |
| 177 | 3300009093 | Ga0105240_10426337 | Ga0105240_104263372 | 191 |
| 178 | 3300009098 | Ga0105245_10106033 | Ga0105245_101060332 | 191 |
| 179 | 3300009147 | Ga0114129_10243381 | Ga0114129_102433812 | 191 |
| 180 | 3300009174 | Ga0105241_10816200 | Ga0105241_108162002 | 191 |
| 181 | 3300010159 | Ga0099796_10098811 | Ga0099796_100988112 | 191 |
| 182 | 3300013100 | Ga0157373_10284750 | Ga0157373_102847502 | 191 |
| 183 | 3300013104 | Ga0157370_10663072 | Ga0157370_106630722 | 191 |
| 184 | 3300013296 | Ga0157374_10049665 | Ga0157374_100496652 | 191 |
| 185 | 3300013297 | Ga0157378_10016089 | Ga0157378_100160894 | 191 |
| 186 | 3300013307 | Ga0157372_10378618 | Ga0157372_103786182 | 191 |
| 187 | 3300013307 | Ga0157372_10609187 | Ga0157372_106091872 | 191 |
| 188 | 3300013308 | Ga0157375_11097402 | Ga0157375_110974021 | 191 |
| 189 | 3300014969 | Ga0157376_10352441 | Ga0157376_103524412 | 191 |
| 190 | 3300021384 | Ga0213876_10018576 | Ga0213876_100185763 | 191 |
| 191 | 3300025899 | Ga0207642_10075937 | Ga0207642_100759372 | 191 |
| 192 | 3300025909 | Ga0207705_10246674 | Ga0207705_102466742 | 191 |
| 193 | 3300025910 | Ga0207684_10315621 | Ga0207684_103156212 | 191 |
| 194 | 3300025912 | Ga0207707_10005302 | Ga0207707_100053027 | 191 |
| 195 | 3300025912 | Ga0207707_10040083 | Ga0207707_100400832 | 191 |
| 196 | 3300025917 | Ga0207660_10052037 | Ga0207660_100520371 | 191 |
| 197 | 3300025917 | Ga0207660_10059102 | Ga0207660_100591022 | 191 |
| 198 | 3300025917 | Ga0207660_10061028 | Ga0207660_100610282 | 191 |
| 199 | 3300025918 | Ga0207662_10036880 | Ga0207662_100368803 | 191 |
| 200 | 3300025921 | Ga0207652_10003589 | Ga0207652_100035893 | 191 |
| 201 | 3300025921 | Ga0207652_10007476 | Ga0207652_1000747610 | 191 |
| 202 | 3300025921 | Ga0207652_10112418 | Ga0207652_101124182 | 191 |
| 203 | 3300025922 | Ga0207646_10116268 | Ga0207646_101162682 | 191 |
| 204 | 3300025925 | Ga0207650_10268237 | Ga0207650_102682372 | 191 |
| 205 | 3300025926 | Ga0207659_10031638 | Ga0207659_100316383 | 191 |
| 206 | 3300025926 | Ga0207659_10352347 | Ga0207659_103523471 | 191 |
| 207 | 3300025927 | Ga0207687_10276643 | Ga0207687_102766432 | 191 |
| 208 | 3300025928 | Ga0207700_10519547 | Ga0207700_105195472 | 191 |
| 209 | 3300025932 | Ga0207690_10399592 | Ga0207690_103995922 | 191 |
| 210 | 3300025933 | Ga0207706_10010068 | Ga0207706_100100688 | 191 |
| 211 | 3300025940 | Ga0207691_10025589 | Ga0207691_100255893 | 191 |
| 212 | 3300025944 | Ga0207661_10001463 | Ga0207661_100014639 | 191 |
| 213 | 3300025945 | Ga0207679_10004150 | Ga0207679_100041502 | 191 |
| 214 | 3300025949 | Ga0207667_10134040 | Ga0207667_101340403 | 191 |
| 215 | 3300025960 | Ga0207651_10067133 | Ga0207651_100671332 | 191 |
| 216 | 3300025972 | Ga0207668_10005068 | Ga0207668_100050689 | 191 |
| 217 | 3300025972 | Ga0207668_10257317 | Ga0207668_102573171 | 191 |
| 218 | 3300025986 | Ga0207658_10258876 | Ga0207658_102588762 | 191 |
| 219 | 3300026023 | Ga0207677_10060895 | Ga0207677_100608953 | 191 |
| 220 | 3300026023 | Ga0207677_11031029 | Ga0207677_110310291 | 191 |
| 221 | 3300026041 | Ga0207639_10032706 | Ga0207639_100327062 | 191 |
| 222 | 3300026075 | Ga0207708_10124078 | Ga0207708_101240782 | 191 |
| 223 | 3300026089 | Ga0207648_10050508 | Ga0207648_100505082 | 191 |
| 224 | 3300026089 | Ga0207648_10118459 | Ga0207648_101184593 | 191 |
| 225 | 3300026089 | Ga0207648_10355443 | Ga0207648_103554432 | 191 |
| 226 | 3300026116 | Ga0207674_10049475 | Ga0207674_100494753 | 191 |
| 227 | 3300026118 | Ga0207675_100231614 | Ga0207675_1002316143 | 191 |
| 228 | 3300026118 | Ga0207675_100247001 | Ga0207675_1002470012 | 191 |
| 229 | 3300026118 | Ga0207675_100264884 | Ga0207675_1002648842 | 191 |
| 230 | 3300026118 | Ga0207675_100325928 | Ga0207675_1003259282 | 191 |
| 231 | 3300026121 | Ga0207683_10024672 | Ga0207683_100246725 | 191 |
| 232 | 3300026142 | Ga0207698_10257523 | Ga0207698_102575232 | 191 |
| 233 | 3300027364 | Ga0209967_1018097 | Ga0209967_10180971 | 191 |
| 234 | 3300027526 | Ga0209968_1004258 | Ga0209968_10042582 | 191 |
| 235 | 3300031238 | Ga0265332_10015668 | Ga0265332_100156682 | 191 |
| 236 | 3300031251 | Ga0265327_10006193 | Ga0265327_100061935 | 191 |
| 237 | 3300031548 | Ga0307408_100238358 | Ga0307408_1002383582 | 191 |
| 238 | 3300031548 | Ga0307408_100304092 | Ga0307408_1003040922 | 191 |
| 239 | 3300031711 | Ga0265314_10035773 | Ga0265314_100357733 | 191 |
| 240 | 3300031731 | Ga0307405_10000086 | Ga0307405_1000008620 | 191 |
| 241 | 3300031731 | Ga0307405_10017951 | Ga0307405_100179513 | 191 |
| 242 | 3300031731 | Ga0307405_10229599 | Ga0307405_102295992 | 191 |
| 243 | 3300031731 | Ga0307405_10432042 | Ga0307405_104320421 | 191 |
| 244 | 3300031824 | Ga0307413_10004259 | Ga0307413_100042592 | 191 |
| 245 | 3300031824 | Ga0307413_10007052 | Ga0307413_100070522 | 191 |
| 246 | 3300031824 | Ga0307413_10018755 | Ga0307413_100187552 | 191 |
| 247 | 3300031824 | Ga0307413_10021457 | Ga0307413_100214571 | 191 |
| 248 | 3300031852 | Ga0307410_10004881 | Ga0307410_100048816 | 191 |
| 249 | 3300031901 | Ga0307406_10000581 | Ga0307406_100005818 | 191 |
| 250 | 3300031901 | Ga0307406_10013210 | Ga0307406_100132102 | 191 |
| 251 | 3300031901 | Ga0307406_10164593 | Ga0307406_101645932 | 191 |
| 252 | 3300031903 | Ga0307407_10012324 | Ga0307407_100123245 | 191 |
| 253 | 3300031903 | Ga0307407_10053646 | Ga0307407_100536462 | 191 |
| 254 | 3300031911 | Ga0307412_10013744 | Ga0307412_100137445 | 191 |
| 255 | 3300031911 | Ga0307412_10029611 | Ga0307412_100296112 | 191 |
| 256 | 3300031995 | Ga0307409_100000277 | Ga0307409_10000027720 | 191 |
| 257 | 3300031995 | Ga0307409_100006782 | Ga0307409_1000067827 | 191 |
| 258 | 3300032002 | Ga0307416_100004116 | Ga0307416_1000041162 | 191 |
| 259 | 3300032002 | Ga0307416_100007098 | Ga0307416_1000070987 | 191 |
| 260 | 3300032002 | Ga0307416_100030861 | Ga0307416_1000308612 | 191 |
| 261 | 3300032002 | Ga0307416_100640572 | Ga0307416_1006405722 | 191 |
| 262 | 3300032004 | Ga0307414_10009785 | Ga0307414_100097857 | 191 |
| 263 | 3300032005 | Ga0307411_10000937 | Ga0307411_1000093711 | 191 |
| 264 | 3300032005 | Ga0307411_10036011 | Ga0307411_100360113 | 191 |
| 265 | 3300032005 | Ga0307411_10143376 | Ga0307411_101433762 | 191 |
| 266 | 3300032126 | Ga0307415_100002617 | Ga0307415_1000026173 | 191 |
| 267 | 3300032126 | Ga0307415_100025293 | Ga0307415_1000252933 | 191 |
| 268 | 3300035115 | Ga0373941_0005137 | Ga0373941_0005137_1296_1958 | 191 |
| 269 | 3300035692 | Ga0373935_0086833 | Ga0373935_0086833_608_1270 | 191 |
| 270 | 3300037418 | Ga0395900_0058519 | Ga0395900_0058519_452_1204 | 191 |
| 271 | 3300037471 | Ga0395905_0004043 | Ga0395905_0004043_12912_13664 | 191 |
| 272 | 3300038443 | Ga0395901_0002608 | Ga0395901_0002608_13265_14017 | 191 |
| 273 | 3300038996 | Ga0242420_047757 | Ga0242420_047757_39_701 | 191 |
| 274 | 3300039437 | Ga0436365_0815860 | Ga0436365_0815860_11887_12624 | 191 |
| 275 | 3300048915 | Ga0496112_0004636 | Ga0496112_0004636_5682_6344 | 191 |
| 276 | 3300048918 | Ga0496115_0019628 | Ga0496115_0019628_1896_2600 | 191 |
| 277 | 3300049573 | Ga0501037_0368317 | Ga0501037_0368317_257_940 | 191 |
| 278 | 3300049580 | Ga0501046_0117287 | Ga0501046_0117287_999_1682 | 191 |
| 279 | 3300049581 | Ga0501047_0204931 | Ga0501047_0204931_1054_1737 | 191 |
| 280 | 3300049767 | Ga0501270_017068 | Ga0501270_017068_169_921 | 191 |
| 281 | 3300050507 | nmdc:mga05p37_1170_c2 | nmdc:mga05p37_1170_c2_15135_15821 | 191 |
| 282 | 3300050508 | nmdc:mga09592_3136_c1 | nmdc:mga09592_3136_c1_1740_2426 | 191 |
| 283 | 3300050509 | nmdc:mga0qj67_3736_c1 | nmdc:mga0qj67_3736_c1_3445_4131 | 191 |
| 284 | 3300050510 | nmdc:mga06r32_11880_c1 | nmdc:mga06r32_11880_c1_3421_4107 | 191 |
| 285 | 3300050513 | nmdc:mga0rr50_39638_c1 | nmdc:mga0rr50_39638_c1_2003_2665 | 191 |
| 286 | 3300050515 | nmdc:mga0a205_30046_c1 | nmdc:mga0a205_30046_c1_4112_4774 | 191 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ytp-assembly1.cif.gz_D | crystal structure of porcine heart mitochondrial complex ii bound with n-[(4-tert-butylphenyl)methyl]-2-(trifluoromethyl)benzamide | 0.7002 | 98 | 183 |
| 4yxd-assembly1.cif.gz_D | crystal structure of porcine heart mitochondrial complex ii bound with flutolanil | 0.6774 | 98 | 182 |
| 5xmj-assembly2.cif.gz_K | crystal structure of quinol:fumarate reductase from desulfovibrio gigas | 0.6582 | 18 | 178 |
| 2bs4-assembly1.cif.gz_F | glu c180 -> ile variant quinol:fumarate reductase fromwolinella succinogenes | 0.6247 | 17 | 187 |
| 2bs3-assembly1.cif.gz_F | glu c180 -> gln variant quinol:fumarate reductase from wolinella succinogenes | 0.6198 | 17 | 187 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FZC9_1_204_1.20.1300.10 | Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit | 0.7083 | 12 | 184 | 1.20.1300.10 |
| 4ytpD00 | Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit | 0.7002 | 98 | 183 | 1.20.1300.10 |
| 3ae2D00 | Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit | 0.6481 | 98 | 176 | 1.20.1300.10 |
| af_Q2FZC9_1_204_1.20.1300.10 | Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit | 0.6463 | 12 | 184 | 1.20.1300.10 |
| 2ws3H00 | Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit | 0.6242 | 104 | 187 | 1.20.1300.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1EBJ7-F1-model_v4 | Succinate dehydrogenase | 0.9619 | 1 | 91 |
GO:0016020
|
| AF-A0A7W1EBJ7-F1-model_v4 | Succinate dehydrogenase | 0.9517 | 1 | 91 |
GO:0016020
|
| AF-A0A3A8J5A4-F1-model_v4 | Succinate dehydrogenase/fumarate reductase cytochrome b subunit | 0.9185 | 8 | 191 |
GO:0016020
|
| AF-A0A7W1KJY5-F1-model_v4 | Succinate dehydrogenase cytochrome b subunit | 0.9057 | 1 | 191 |
GO:0016020
|
| AF-A9LH46-F1-model_v4 | Succinate dehydrogenase cytochrome b558 subunit (EC 1.3.99.1) | 0.9057 | 6 | 191 |
GO:0016020
GO:0016491 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar