F387502

General Info

Members Datasets Scaffolds Average Seq Length
286 183 286 224

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10432042|Ga0307405_104320421
Length 257
Sequence MSWVRAFWRSQVGKKVVMAVTGLVGVGFVIGHMVGNLQMFQGPDKMNGYAHFLHHTVGELLWLVRAVLLAAVVLHVLAAYQLSRDRLGARPVGYRKGPQREVSTLASRTIRWGGVLLFAFIVFHILHFTTRSVFPGYSETDVYGNVVRAFRNPLVTLFYVASMIALGLHLYHGAWSSLRSLGASPPSAHPLRRVGATVVAVIVWAGFTAVPIAVLTGLIQPNSSRAAEPAATARRSAPVAPPAGRVIPTAATASTEK

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
109 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
113 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
114 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
124 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
125 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
126 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
128 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
129 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
130 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
131 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
132 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
133 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
151 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
152 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
153 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
154 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
155 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
156 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
157 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
158 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
159 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
160 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
161 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
162 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
163 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
164 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
165 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
166 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
167 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
168 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
175 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
178 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
183 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.7
Rhizosphere 98.25
Stem 0
Stem Tuber 0
Unclassified 1.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_2909068 2162886012 Bacteria 1339
2 Ga0065715_10156835 3300005293 Unclassified 1668
3 Ga0070683_100005774 3300005329 Bacteria 10345
4 Ga0070683_100032815 3300005329 Bacteria 4732
5 Ga0070683_100294418 3300005329 Bacteria 1544
6 Ga0070683_100365694 3300005329 Bacteria 1374
7 Ga0070670_100258416 3300005331 Bacteria 1518
8 Ga0070677_10042011 3300005333 Bacteria 1808
9 Ga0070680_100091192 3300005336 Bacteria 2523
10 Ga0070680_100165972 3300005336 Bacteria 1856
11 Ga0070680_100636626 3300005336 Bacteria 916
12 Ga0070682_100004316 3300005337 Bacteria 7894
13 Ga0070682_100055553 3300005337 Bacteria 2487
14 Ga0068868_100031144 3300005338 Bacteria 4095
15 Ga0068868_100180488 3300005338 Bacteria 1751
16 Ga0068868_100731770 3300005338 Unclassified 887
17 Ga0070660_100401712 3300005339 Bacteria 1133
18 Ga0070691_10003248 3300005341 Bacteria 7293
19 Ga0070661_100313935 3300005344 Bacteria 1223
20 Ga0070661_100344409 3300005344 Bacteria 1168
21 Ga0070692_10050745 3300005345 Unclassified 2155
22 Ga0070692_10073902 3300005345 Bacteria 1822
23 Ga0070668_100006172 3300005347 Bacteria 8873
24 Ga0070668_100395345 3300005347 Bacteria 1179
25 Ga0070675_100013802 3300005354 Bacteria 6360
26 Ga0070675_100531381 3300005354 Bacteria 1062
27 Ga0070671_100113424 3300005355 Bacteria 2277
28 Ga0070674_100205416 3300005356 Bacteria 1524
29 Ga0070673_100128356 3300005364 Bacteria 2124
30 Ga0070673_100235885 3300005364 Bacteria 1588
31 Ga0070688_100234084 3300005365 Bacteria 1301
32 Ga0070659_100646761 3300005366 Unclassified 911
33 Ga0070659_100708039 3300005366 Unclassified 871
34 Ga0070667_100124473 3300005367 Bacteria 2245
35 Ga0070709_10217640 3300005434 Bacteria 1360
36 Ga0070713_100035688 3300005436 Bacteria 4005
37 Ga0070713_100879272 3300005436 Unclassified 861
38 Ga0070711_100115525 3300005439 Bacteria 1976
39 Ga0070700_100089325 3300005441 Bacteria 2007
40 Ga0070694_100075270 3300005444 Bacteria 2335
41 Ga0070708_100034342 3300005445 Bacteria 4412
42 Ga0070678_100138628 3300005456 Bacteria 1943
43 Ga0070662_100038454 3300005457 Bacteria 3398
44 Ga0070662_100270345 3300005457 Bacteria 1372
45 Ga0070662_100373860 3300005457 Bacteria 1172
46 Ga0070681_10000222 3300005458 Bacteria 44616
47 Ga0070681_10008335 3300005458 Bacteria 10152
48 Ga0070681_10008594 3300005458 Bacteria 10009
49 Ga0070681_10262556 3300005458 Bacteria 1639
50 Ga0068867_100143090 3300005459 Bacteria 1871
51 Ga0068867_100423962 3300005459 Bacteria 1128
52 Ga0070706_100071817 3300005467 Bacteria 3202
53 Ga0070698_100333403 3300005471 Bacteria 1448
54 Ga0070699_100505137 3300005518 Bacteria 1098
55 Ga0070679_100002036 3300005530 Bacteria 18148
56 Ga0070679_100002378 3300005530 Bacteria 17053
57 Ga0070679_100003733 3300005530 Bacteria 13959
58 Ga0070679_100371260 3300005530 Bacteria 1378
59 Ga0070684_100002030 3300005535 Bacteria 14896
60 Ga0070684_100133672 3300005535 Bacteria 2239
61 Ga0068853_100099701 3300005539 Bacteria 2566
62 Ga0070672_100003019 3300005543 Bacteria 10843
63 Ga0070672_100104951 3300005543 Bacteria 2297
64 Ga0070686_100151846 3300005544 Bacteria 1623
65 Ga0070695_100094677 3300005545 Bacteria 2000
66 Ga0070695_100285043 3300005545 Unclassified 1215
67 Ga0070693_100383539 3300005547 Bacteria 970
68 Ga0068855_100001981 3300005563 Bacteria 25451
69 Ga0068855_100073824 3300005563 Bacteria 3963
70 Ga0068855_100264470 3300005563 Bacteria 1915
71 Ga0068855_100554901 3300005563 Unclassified 1243
72 Ga0070664_100002111 3300005564 Bacteria 15896
73 Ga0068857_100039951 3300005577 Bacteria 4159
74 Ga0068854_100035807 3300005578 Bacteria 3476
75 Ga0068854_100651952 3300005578 Unclassified 904
76 Ga0068866_10034177 3300005718 Bacteria 2474
77 Ga0068861_100302805 3300005719 Bacteria 1385
78 Ga0068863_100988445 3300005841 Bacteria 844
79 Ga0070716_100002833 3300006173 Bacteria 8070
80 Ga0097621_100969517 3300006237 Unclassified 794
81 Ga0075428_100005120 3300006844 Bacteria 14567
82 Ga0075430_100002547 3300006846 Bacteria 15203
83 Ga0075431_100002748 3300006847 Bacteria 17062
84 Ga0075433_10021518 3300006852 Bacteria 5409
85 Ga0075429_100007025 3300006880 Bacteria 9781
86 Ga0068865_100031423 3300006881 Bacteria 3541
87 Ga0075436_100038450 3300006914 Bacteria 3303
88 Ga0075435_100472316 3300007076 Unclassified 1083
89 Ga0105240_10426337 3300009093 Bacteria 1489
90 Ga0105245_10041509 3300009098 Bacteria 4101
91 Ga0105245_10106033 3300009098 Bacteria 2607
92 Ga0105245_10394827 3300009098 Bacteria 1381
93 Ga0114129_10243381 3300009147 Bacteria 2418
94 Ga0105241_10816200 3300009174 Unclassified 860
95 Ga0105248_10531247 3300009177 Bacteria 1327
96 Ga0099796_10098811 3300010159 Bacteria 1095
97 Ga0157373_10284750 3300013100 Bacteria 1171
98 Ga0157370_10063167 3300013104 Bacteria 3510
99 Ga0157370_10663072 3300013104 Bacteria 953
100 Ga0157374_10049665 3300013296 Bacteria 3897
101 Ga0157374_10856502 3300013296 Bacteria 926
102 Ga0157378_10016089 3300013297 Bacteria 6551
103 Ga0157378_10355243 3300013297 Bacteria 1433
104 Ga0157372_10022955 3300013307 Bacteria 6759
105 Ga0157372_10052898 3300013307 Bacteria 4524
106 Ga0157372_10378618 3300013307 Bacteria 1649
107 Ga0157372_10609187 3300013307 Bacteria 1273
108 Ga0157375_10632762 3300013308 Bacteria 1227
109 Ga0157375_11097402 3300013308 Bacteria 931
110 Ga0182008_10059729 3300014497 Bacteria 1881
111 Ga0157376_10352441 3300014969 Bacteria 1409
112 Ga0213876_10018576 3300021384 Bacteria 3671
113 Ga0207692_10042847 3300025898 Bacteria 2249
114 Ga0207642_10075937 3300025899 Bacteria 1616
115 Ga0207705_10246674 3300025909 Bacteria 1361
116 Ga0207684_10315621 3300025910 Unclassified 1347
117 Ga0207707_10005302 3300025912 Bacteria 11269
118 Ga0207707_10040083 3300025912 Bacteria 4093
119 Ga0207695_10601237 3300025913 Unclassified 981
120 Ga0207660_10052037 3300025917 Bacteria 2914
121 Ga0207660_10059102 3300025917 Bacteria 2751
122 Ga0207660_10061028 3300025917 Bacteria 2713
123 Ga0207662_10036880 3300025918 Bacteria 2859
124 Ga0207652_10003589 3300025921 Bacteria 12781
125 Ga0207652_10007476 3300025921 Bacteria 8804
126 Ga0207652_10112418 3300025921 Bacteria 2417
127 Ga0207646_10116268 3300025922 Bacteria 2402
128 Ga0207650_10236337 3300025925 Bacteria 1476
129 Ga0207650_10268237 3300025925 Bacteria 1387
130 Ga0207659_10031638 3300025926 Bacteria 3625
131 Ga0207659_10352347 3300025926 Bacteria 1222
132 Ga0207687_10238312 3300025927 Bacteria 1440
133 Ga0207687_10276643 3300025927 Bacteria 1344
134 Ga0207700_10052302 3300025928 Bacteria 3053
135 Ga0207700_10519547 3300025928 Bacteria 1055
136 Ga0207644_10065919 3300025931 Bacteria 2635
137 Ga0207644_10609771 3300025931 Unclassified 907
138 Ga0207690_10399592 3300025932 Bacteria 1096
139 Ga0207706_10010068 3300025933 Bacteria 8659
140 Ga0207665_10000198 3300025939 Bacteria 40191
141 Ga0207665_10401530 3300025939 Bacteria 1044
142 Ga0207691_10025589 3300025940 Bacteria 5539
143 Ga0207691_10099896 3300025940 Bacteria 2590
144 Ga0207661_10001463 3300025944 Bacteria 15968
145 Ga0207679_10004150 3300025945 Bacteria 8999
146 Ga0207667_10031775 3300025949 Bacteria 5696
147 Ga0207667_10134040 3300025949 Bacteria 2551
148 Ga0207651_10067133 3300025960 Bacteria 2523
149 Ga0207651_10356398 3300025960 Bacteria 1233
150 Ga0207668_10005068 3300025972 Bacteria 7755
151 Ga0207668_10257317 3300025972 Bacteria 1421
152 Ga0207658_10258876 3300025986 Bacteria 1482
153 Ga0207677_10060895 3300026023 Bacteria 2611
154 Ga0207677_10118336 3300026023 Bacteria 1987
155 Ga0207677_11031029 3300026023 Unclassified 747
156 Ga0207639_10032706 3300026041 Bacteria 3831
157 Ga0207708_10124078 3300026075 Bacteria 2014
158 Ga0207648_10050508 3300026089 Bacteria 3637
159 Ga0207648_10118459 3300026089 Bacteria 2327
160 Ga0207648_10355443 3300026089 Bacteria 1321
161 Ga0207674_10049475 3300026116 Bacteria 4299
162 Ga0207675_100231614 3300026118 Bacteria 1782
163 Ga0207675_100247001 3300026118 Bacteria 1726
164 Ga0207675_100264884 3300026118 Bacteria 1666
165 Ga0207675_100325928 3300026118 Bacteria 1500
166 Ga0207683_10024672 3300026121 Bacteria 5181
167 Ga0207698_10257523 3300026142 Bacteria 1601
168 Ga0209967_1018097 3300027364 Bacteria 1019
169 Ga0209968_1004258 3300027526 Bacteria 2148
170 Ga0265332_10015668 3300031238 Bacteria 3347
171 Ga0265332_10036651 3300031238 Bacteria 2129
172 Ga0265327_10006193 3300031251 Bacteria 9650
173 Ga0307408_100005157 3300031548 Bacteria 8761
174 Ga0307408_100238358 3300031548 Bacteria 1494
175 Ga0307408_100304092 3300031548 Bacteria 1337
176 Ga0265314_10035773 3300031711 Bacteria 3617
177 Ga0265314_10078469 3300031711 Bacteria 2186
178 Ga0307405_10000086 3300031731 Bacteria 39376
179 Ga0307405_10000905 3300031731 Bacteria 11779
180 Ga0307405_10017951 3300031731 Bacteria 3894
181 Ga0307405_10229599 3300031731 Bacteria 1367
182 Ga0307405_10432042 3300031731 Bacteria 1039
183 Ga0307413_10000077 3300031824 Bacteria 24398
184 Ga0307413_10004259 3300031824 Bacteria 6194
185 Ga0307413_10007052 3300031824 Bacteria 5183
186 Ga0307413_10018755 3300031824 Bacteria 3638
187 Ga0307413_10021457 3300031824 Bacteria 3459
188 Ga0307410_10004881 3300031852 Bacteria 7018
189 Ga0307410_10018693 3300031852 Bacteria 4193
190 Ga0307406_10000581 3300031901 Bacteria 21084
191 Ga0307406_10003327 3300031901 Bacteria 8767
192 Ga0307406_10013210 3300031901 Bacteria 4726
193 Ga0307406_10164593 3300031901 Bacteria 1598
194 Ga0307407_10002465 3300031903 Bacteria 7252
195 Ga0307407_10012324 3300031903 Bacteria 4106
196 Ga0307407_10053646 3300031903 Bacteria 2320
197 Ga0307412_10013744 3300031911 Bacteria 4756
198 Ga0307412_10014318 3300031911 Bacteria 4674
199 Ga0307412_10029611 3300031911 Bacteria 3438
200 Ga0307409_100000277 3300031995 Bacteria 20763
201 Ga0307409_100006782 3300031995 Bacteria 6773
202 Ga0307416_100004116 3300032002 Bacteria 8707
203 Ga0307416_100007098 3300032002 Bacteria 7080
204 Ga0307416_100030861 3300032002 Bacteria 4027
205 Ga0307416_100167815 3300032002 Bacteria 2038
206 Ga0307416_100288836 3300032002 Bacteria 1622
207 Ga0307416_100640572 3300032002 Bacteria 1147
208 Ga0307414_10009785 3300032004 Bacteria 5525
209 Ga0307414_10056401 3300032004 Bacteria 2755
210 Ga0307411_10000937 3300032005 Bacteria 11130
211 Ga0307411_10034799 3300032005 Bacteria 3138
212 Ga0307411_10036011 3300032005 Bacteria 3096
213 Ga0307411_10143376 3300032005 Bacteria 1764
214 Ga0307415_100002617 3300032126 Bacteria 8970
215 Ga0307415_100008643 3300032126 Bacteria 5658
216 Ga0307415_100025293 3300032126 Bacteria 3722
217 Ga0373959_0020420 3300034820 Bacteria 1264
218 Ga0373926_0054317 3300035083 Bacteria 1451
219 Ga0373934_0154644 3300035086 Bacteria 940
220 Ga0373923_0067594 3300035111 Bacteria 1529
221 Ga0373941_0005137 3300035115 Bacteria 3061
222 Ga0373954_0310659 3300035118 Bacteria 778
223 Ga0373956_0160237 3300035119 Unclassified 1060
224 Ga0373957_0031396 3300035120 Bacteria 1952
225 Ga0373957_0075400 3300035120 Bacteria 1325
226 Ga0373943_0011184 3300035170 Bacteria 4035
227 Ga0316574_0040174 3300035398 Bacteria 2880
228 Ga0373924_0005409 3300035410 Bacteria 4520
229 Ga0373935_0086833 3300035692 Bacteria 2042
230 Ga0373927_0011952 3300035695 Bacteria 5776
231 Ga0373927_0366086 3300035695 Bacteria 950
232 Ga0373927_0381732 3300035695 Bacteria 929
233 Ga0373933_0144142 3300035724 Bacteria 1505
234 Ga0373937_0008514 3300036401 Bacteria 8912
235 Ga0373937_0212714 3300036401 Bacteria 1819
236 Ga0373925_0133973 3300037068 Bacteria 1934
237 Ga0395900_0058519 3300037418 Bacteria 3967
238 Ga0395905_0004043 3300037471 Bacteria 15393
239 Ga0395901_0002608 3300038443 Bacteria 18254
240 Ga0242420_047757 3300038996 Bacteria 831
241 Ga0436365_0815860 3300039437 Bacteria 13587
242 Ga0451837_0369968 3300041494 Unclassified 2069
243 Ga0451577_0143244 3300042876 Bacteria 2148
244 Ga0466958_0045253 3300045836 Bacteria 2654
245 Ga0495629_0075960 3300046459 Bacteria 2346
246 Ga0495651_0048407 3300046462 Bacteria 3284
247 Ga0495580_0132120 3300046472 Bacteria 1731
248 Ga0495580_0156479 3300046472 Bacteria 1578
249 Ga0495594_0047364 3300046499 Bacteria 2361
250 Ga0495608_0008584 3300046511 Bacteria 7156
251 Ga0495628_0065450 3300046516 Bacteria 2843
252 Ga0495628_0073937 3300046516 Bacteria 2655
253 Ga0495630_0004942 3300046517 Bacteria 9376
254 Ga0495666_0030672 3300046526 Bacteria 2637
255 Ga0495652_0033082 3300046529 Bacteria 4518
256 Ga0495586_0010835 3300046535 Bacteria 4847
257 Ga0495586_0023502 3300046535 Bacteria 3293
258 Ga0495587_0011754 3300046536 Bacteria 5537
259 Ga0495645_0047922 3300046543 Bacteria 3112
260 Ga0495667_0004021 3300046559 Bacteria 9884
261 Ga0495599_0010151 3300046678 Bacteria 5767
262 Ga0495623_0020234 3300046679 Bacteria 4301
263 Ga0495600_0089281 3300046809 Bacteria 2011
264 Ga0495581_0020329 3300047315 Bacteria 3854
265 Ga0495604_0057535 3300047317 Bacteria 2989
266 Ga0495674_0071461 3300047319 Bacteria 2995
267 Ga0495675_0006888 3300047444 Bacteria 6979
268 Ga0495675_0011290 3300047444 Bacteria 5605
269 Ga0495593_0063962 3300047673 Bacteria 1921
270 Ga0495602_0070742 3300048088 Bacteria 2983
271 Ga0496112_0004636 3300048915 Bacteria 11692
272 Ga0496115_0019628 3300048918 Bacteria 5204
273 Ga0501037_0368317 3300049573 Bacteria 989
274 Ga0501046_0117287 3300049580 Bacteria 2028
275 Ga0501047_0204931 3300049581 Bacteria 1832
276 Ga0501249_057260 3300049679 Bacteria 900
277 Ga0501270_017068 3300049767 Bacteria 1058
278 nmdc:mga05p37_1170_c2 3300050507 Bacteria 27090
279 nmdc:mga09592_3136_c1 3300050508 Bacteria 13427
280 nmdc:mga0qj67_3736_c1 3300050509 Bacteria 10988
281 nmdc:mga0qj67_4807_c1 3300050509 Bacteria 9809
282 nmdc:mga06r32_11880_c1 3300050510 Bacteria 7844
283 nmdc:mga0rr50_39638_c1 3300050513 Bacteria 3418
284 nmdc:mga0a205_30046_c1 3300050515 Bacteria 5201
285 Ga0495601_0107904 3300053077 Bacteria 1801
286 Ga0495619_0361021 3300053085 Unclassified 1004

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025939 Ga0207665_10401530 Ga0207665_104015302 161
2 3300005841 Ga0068863_100988445 Ga0068863_1009884451 169
3 3300013296 Ga0157374_10856502 Ga0157374_108565022 172
4 3300005329 Ga0070683_100365694 Ga0070683_1003656942 173
5 3300009177 Ga0105248_10531247 Ga0105248_105312472 173
6 3300005338 Ga0068868_100180488 Ga0068868_1001804882 174
7 3300005344 Ga0070661_100344409 Ga0070661_1003444092 174
8 3300005364 Ga0070673_100235885 Ga0070673_1002358852 174
9 3300005365 Ga0070688_100234084 Ga0070688_1002340842 174
10 3300005366 Ga0070659_100646761 Ga0070659_1006467612 174
11 3300005367 Ga0070667_100124473 Ga0070667_1001244732 174
12 3300005563 Ga0068855_100264470 Ga0068855_1002644702 174
13 3300005719 Ga0068861_100302805 Ga0068861_1003028052 174
14 3300013297 Ga0157378_10355243 Ga0157378_103552432 174
15 3300013307 Ga0157372_10052898 Ga0157372_100528982 174
16 3300013308 Ga0157375_10632762 Ga0157375_106327622 174
17 3300025931 Ga0207644_10065919 Ga0207644_100659192 174
18 3300026023 Ga0207677_10118336 Ga0207677_101183362 174
19 3300050509 nmdc:mga0qj67_4807_c1 nmdc:mga0qj67_4807_c1_8599_9282 175
20 3300005337 Ga0070682_100055553 Ga0070682_1000555532 181
21 3300005434 Ga0070709_10217640 Ga0070709_102176402 181
22 3300005444 Ga0070694_100075270 Ga0070694_1000752702 181
23 3300005563 Ga0068855_100001981 Ga0068855_10000198127 181
24 3300005578 Ga0068854_100651952 Ga0068854_1006519522 181
25 3300006173 Ga0070716_100002833 Ga0070716_1000028337 181
26 3300009098 Ga0105245_10041509 Ga0105245_100415092 181
27 3300009098 Ga0105245_10394827 Ga0105245_103948272 181
28 3300013307 Ga0157372_10022955 Ga0157372_100229552 181
29 3300025898 Ga0207692_10042847 Ga0207692_100428472 181
30 3300025913 Ga0207695_10601237 Ga0207695_106012372 181
31 3300025927 Ga0207687_10238312 Ga0207687_102383122 181
32 3300025939 Ga0207665_10000198 Ga0207665_1000019817 181
33 3300025949 Ga0207667_10031775 Ga0207667_100317754 181
34 3300034820 Ga0373959_0020420 Ga0373959_0020420_236_868 181
35 3300041494 Ga0451837_0369968 Ga0451837_0369968_1278_1952 183
36 3300045836 Ga0466958_0045253 Ga0466958_0045253_1460_2122 183
37 3300032002 Ga0307416_100288836 Ga0307416_1002888362 184
38 3300049679 Ga0501249_057260 Ga0501249_057260_130_840 184
39 3300005545 Ga0070695_100285043 Ga0070695_1002850432 185
40 3300035398 Ga0316574_0040174 Ga0316574_0040174_458_1135 186
41 3300031238 Ga0265332_10036651 Ga0265332_100366512 187
42 3300031711 Ga0265314_10078469 Ga0265314_100784692 187
43 3300005329 Ga0070683_100005774 Ga0070683_10000577412 190
44 3300005331 Ga0070670_100258416 Ga0070670_1002584162 190
45 3300005333 Ga0070677_10042011 Ga0070677_100420112 190
46 3300005338 Ga0068868_100731770 Ga0068868_1007317701 190
47 3300005344 Ga0070661_100313935 Ga0070661_1003139352 190
48 3300005355 Ga0070671_100113424 Ga0070671_1001134241 190
49 3300005364 Ga0070673_100128356 Ga0070673_1001283563 190
50 3300005366 Ga0070659_100708039 Ga0070659_1007080391 190
51 3300005436 Ga0070713_100035688 Ga0070713_1000356882 190
52 3300005439 Ga0070711_100115525 Ga0070711_1001155252 190
53 3300005457 Ga0070662_100270345 Ga0070662_1002703452 190
54 3300005535 Ga0070684_100133672 Ga0070684_1001336722 190
55 3300005543 Ga0070672_100104951 Ga0070672_1001049512 190
56 3300005563 Ga0068855_100554901 Ga0068855_1005549012 190
57 3300013104 Ga0157370_10063167 Ga0157370_100631673 190
58 3300014497 Ga0182008_10059729 Ga0182008_100597292 190
59 3300025925 Ga0207650_10236337 Ga0207650_102363372 190
60 3300025928 Ga0207700_10052302 Ga0207700_100523022 190
61 3300025931 Ga0207644_10609771 Ga0207644_106097712 190
62 3300025940 Ga0207691_10099896 Ga0207691_100998963 190
63 3300025960 Ga0207651_10356398 Ga0207651_103563982 190
64 3300031548 Ga0307408_100005157 Ga0307408_1000051577 190
65 3300031731 Ga0307405_10000905 Ga0307405_1000090512 190
66 3300031824 Ga0307413_10000077 Ga0307413_1000007722 190
67 3300031852 Ga0307410_10018693 Ga0307410_100186932 190
68 3300031901 Ga0307406_10003327 Ga0307406_100033277 190
69 3300031903 Ga0307407_10002465 Ga0307407_100024654 190
70 3300031911 Ga0307412_10014318 Ga0307412_100143183 190
71 3300032002 Ga0307416_100167815 Ga0307416_1001678152 190
72 3300032004 Ga0307414_10056401 Ga0307414_100564012 190
73 3300032005 Ga0307411_10034799 Ga0307411_100347992 190
74 3300032126 Ga0307415_100008643 Ga0307415_1000086432 190
75 3300035083 Ga0373926_0054317 Ga0373926_0054317_617_1297 190
76 3300035086 Ga0373934_0154644 Ga0373934_0154644_88_768 190
77 3300035111 Ga0373923_0067594 Ga0373923_0067594_820_1500 190
78 3300035118 Ga0373954_0310659 Ga0373954_0310659_53_733 190
79 3300035119 Ga0373956_0160237 Ga0373956_0160237_318_998 190
80 3300035120 Ga0373957_0031396 Ga0373957_0031396_638_1318 190
81 3300035120 Ga0373957_0075400 Ga0373957_0075400_583_1263 190
82 3300035170 Ga0373943_0011184 Ga0373943_0011184_3222_3902 190
83 3300035410 Ga0373924_0005409 Ga0373924_0005409_3231_3911 190
84 3300035695 Ga0373927_0011952 Ga0373927_0011952_4517_5197 190
85 3300035695 Ga0373927_0366086 Ga0373927_0366086_252_932 190
86 3300035695 Ga0373927_0381732 Ga0373927_0381732_30_710 190
87 3300035724 Ga0373933_0144142 Ga0373933_0144142_634_1314 190
88 3300036401 Ga0373937_0008514 Ga0373937_0008514_6869_7549 190
89 3300036401 Ga0373937_0212714 Ga0373937_0212714_222_902 190
90 3300037068 Ga0373925_0133973 Ga0373925_0133973_336_1016 190
91 3300042876 Ga0451577_0143244 Ga0451577_0143244_1076_1735 190
92 3300046459 Ga0495629_0075960 Ga0495629_0075960_1328_2008 190
93 3300046462 Ga0495651_0048407 Ga0495651_0048407_1589_2269 190
94 3300046472 Ga0495580_0132120 Ga0495580_0132120_705_1385 190
95 3300046472 Ga0495580_0156479 Ga0495580_0156479_273_953 190
96 3300046499 Ga0495594_0047364 Ga0495594_0047364_1606_2286 190
97 3300046511 Ga0495608_0008584 Ga0495608_0008584_3562_4242 190
98 3300046516 Ga0495628_0065450 Ga0495628_0065450_1774_2454 190
99 3300046516 Ga0495628_0073937 Ga0495628_0073937_26_706 190
100 3300046517 Ga0495630_0004942 Ga0495630_0004942_7164_7844 190
101 3300046526 Ga0495666_0030672 Ga0495666_0030672_919_1599 190
102 3300046529 Ga0495652_0033082 Ga0495652_0033082_1759_2439 190
103 3300046535 Ga0495586_0010835 Ga0495586_0010835_2223_2903 190
104 3300046535 Ga0495586_0023502 Ga0495586_0023502_2401_3081 190
105 3300046536 Ga0495587_0011754 Ga0495587_0011754_3595_4275 190
106 3300046543 Ga0495645_0047922 Ga0495645_0047922_1614_2294 190
107 3300046559 Ga0495667_0004021 Ga0495667_0004021_5615_6295 190
108 3300046678 Ga0495599_0010151 Ga0495599_0010151_1516_2196 190
109 3300046679 Ga0495623_0020234 Ga0495623_0020234_2629_3309 190
110 3300046809 Ga0495600_0089281 Ga0495600_0089281_944_1624 190
111 3300047315 Ga0495581_0020329 Ga0495581_0020329_124_804 190
112 3300047317 Ga0495604_0057535 Ga0495604_0057535_2039_2719 190
113 3300047319 Ga0495674_0071461 Ga0495674_0071461_1235_1915 190
114 3300047444 Ga0495675_0006888 Ga0495675_0006888_5294_5974 190
115 3300047444 Ga0495675_0011290 Ga0495675_0011290_1330_2010 190
116 3300047673 Ga0495593_0063962 Ga0495593_0063962_924_1604 190
117 3300048088 Ga0495602_0070742 Ga0495602_0070742_221_901 190
118 3300053077 Ga0495601_0107904 Ga0495601_0107904_959_1639 190
119 3300053085 Ga0495619_0361021 Ga0495619_0361021_204_884 190
120 2162886012 MBSR1b_contig_2909068 MBSR1b_0228.00007460 191
121 3300005293 Ga0065715_10156835 Ga0065715_101568352 191
122 3300005329 Ga0070683_100032815 Ga0070683_1000328152 191
123 3300005329 Ga0070683_100294418 Ga0070683_1002944182 191
124 3300005336 Ga0070680_100091192 Ga0070680_1000911922 191
125 3300005336 Ga0070680_100165972 Ga0070680_1001659722 191
126 3300005336 Ga0070680_100636626 Ga0070680_1006366262 191
127 3300005337 Ga0070682_100004316 Ga0070682_1000043167 191
128 3300005338 Ga0068868_100031144 Ga0068868_1000311442 191
129 3300005339 Ga0070660_100401712 Ga0070660_1004017122 191
130 3300005341 Ga0070691_10003248 Ga0070691_100032484 191
131 3300005345 Ga0070692_10050745 Ga0070692_100507453 191
132 3300005345 Ga0070692_10073902 Ga0070692_100739022 191
133 3300005347 Ga0070668_100006172 Ga0070668_1000061727 191
134 3300005347 Ga0070668_100395345 Ga0070668_1003953452 191
135 3300005354 Ga0070675_100013802 Ga0070675_1000138023 191
136 3300005354 Ga0070675_100531381 Ga0070675_1005313812 191
137 3300005356 Ga0070674_100205416 Ga0070674_1002054162 191
138 3300005436 Ga0070713_100879272 Ga0070713_1008792721 191
139 3300005441 Ga0070700_100089325 Ga0070700_1000893252 191
140 3300005445 Ga0070708_100034342 Ga0070708_1000343423 191
141 3300005456 Ga0070678_100138628 Ga0070678_1001386283 191
142 3300005457 Ga0070662_100038454 Ga0070662_1000384542 191
143 3300005457 Ga0070662_100373860 Ga0070662_1003738602 191
144 3300005458 Ga0070681_10000222 Ga0070681_1000022243 191
145 3300005458 Ga0070681_10008335 Ga0070681_100083356 191
146 3300005458 Ga0070681_10008594 Ga0070681_100085942 191
147 3300005458 Ga0070681_10262556 Ga0070681_102625562 191
148 3300005459 Ga0068867_100143090 Ga0068867_1001430902 191
149 3300005459 Ga0068867_100423962 Ga0068867_1004239622 191
150 3300005467 Ga0070706_100071817 Ga0070706_1000718172 191
151 3300005471 Ga0070698_100333403 Ga0070698_1003334032 191
152 3300005518 Ga0070699_100505137 Ga0070699_1005051372 191
153 3300005530 Ga0070679_100002036 Ga0070679_10000203616 191
154 3300005530 Ga0070679_100002378 Ga0070679_10000237818 191
155 3300005530 Ga0070679_100003733 Ga0070679_10000373311 191
156 3300005530 Ga0070679_100371260 Ga0070679_1003712602 191
157 3300005535 Ga0070684_100002030 Ga0070684_10000203010 191
158 3300005539 Ga0068853_100099701 Ga0068853_1000997013 191
159 3300005543 Ga0070672_100003019 Ga0070672_1000030196 191
160 3300005544 Ga0070686_100151846 Ga0070686_1001518462 191
161 3300005545 Ga0070695_100094677 Ga0070695_1000946772 191
162 3300005547 Ga0070693_100383539 Ga0070693_1003835392 191
163 3300005563 Ga0068855_100073824 Ga0068855_1000738243 191
164 3300005564 Ga0070664_100002111 Ga0070664_10000211116 191
165 3300005577 Ga0068857_100039951 Ga0068857_1000399513 191
166 3300005578 Ga0068854_100035807 Ga0068854_1000358072 191
167 3300005718 Ga0068866_10034177 Ga0068866_100341772 191
168 3300006237 Ga0097621_100969517 Ga0097621_1009695171 191
169 3300006844 Ga0075428_100005120 Ga0075428_1000051204 191
170 3300006846 Ga0075430_100002547 Ga0075430_1000025476 191
171 3300006847 Ga0075431_100002748 Ga0075431_1000027486 191
172 3300006852 Ga0075433_10021518 Ga0075433_100215182 191
173 3300006880 Ga0075429_100007025 Ga0075429_1000070256 191
174 3300006881 Ga0068865_100031423 Ga0068865_1000314232 191
175 3300006914 Ga0075436_100038450 Ga0075436_1000384503 191
176 3300007076 Ga0075435_100472316 Ga0075435_1004723162 191
177 3300009093 Ga0105240_10426337 Ga0105240_104263372 191
178 3300009098 Ga0105245_10106033 Ga0105245_101060332 191
179 3300009147 Ga0114129_10243381 Ga0114129_102433812 191
180 3300009174 Ga0105241_10816200 Ga0105241_108162002 191
181 3300010159 Ga0099796_10098811 Ga0099796_100988112 191
182 3300013100 Ga0157373_10284750 Ga0157373_102847502 191
183 3300013104 Ga0157370_10663072 Ga0157370_106630722 191
184 3300013296 Ga0157374_10049665 Ga0157374_100496652 191
185 3300013297 Ga0157378_10016089 Ga0157378_100160894 191
186 3300013307 Ga0157372_10378618 Ga0157372_103786182 191
187 3300013307 Ga0157372_10609187 Ga0157372_106091872 191
188 3300013308 Ga0157375_11097402 Ga0157375_110974021 191
189 3300014969 Ga0157376_10352441 Ga0157376_103524412 191
190 3300021384 Ga0213876_10018576 Ga0213876_100185763 191
191 3300025899 Ga0207642_10075937 Ga0207642_100759372 191
192 3300025909 Ga0207705_10246674 Ga0207705_102466742 191
193 3300025910 Ga0207684_10315621 Ga0207684_103156212 191
194 3300025912 Ga0207707_10005302 Ga0207707_100053027 191
195 3300025912 Ga0207707_10040083 Ga0207707_100400832 191
196 3300025917 Ga0207660_10052037 Ga0207660_100520371 191
197 3300025917 Ga0207660_10059102 Ga0207660_100591022 191
198 3300025917 Ga0207660_10061028 Ga0207660_100610282 191
199 3300025918 Ga0207662_10036880 Ga0207662_100368803 191
200 3300025921 Ga0207652_10003589 Ga0207652_100035893 191
201 3300025921 Ga0207652_10007476 Ga0207652_1000747610 191
202 3300025921 Ga0207652_10112418 Ga0207652_101124182 191
203 3300025922 Ga0207646_10116268 Ga0207646_101162682 191
204 3300025925 Ga0207650_10268237 Ga0207650_102682372 191
205 3300025926 Ga0207659_10031638 Ga0207659_100316383 191
206 3300025926 Ga0207659_10352347 Ga0207659_103523471 191
207 3300025927 Ga0207687_10276643 Ga0207687_102766432 191
208 3300025928 Ga0207700_10519547 Ga0207700_105195472 191
209 3300025932 Ga0207690_10399592 Ga0207690_103995922 191
210 3300025933 Ga0207706_10010068 Ga0207706_100100688 191
211 3300025940 Ga0207691_10025589 Ga0207691_100255893 191
212 3300025944 Ga0207661_10001463 Ga0207661_100014639 191
213 3300025945 Ga0207679_10004150 Ga0207679_100041502 191
214 3300025949 Ga0207667_10134040 Ga0207667_101340403 191
215 3300025960 Ga0207651_10067133 Ga0207651_100671332 191
216 3300025972 Ga0207668_10005068 Ga0207668_100050689 191
217 3300025972 Ga0207668_10257317 Ga0207668_102573171 191
218 3300025986 Ga0207658_10258876 Ga0207658_102588762 191
219 3300026023 Ga0207677_10060895 Ga0207677_100608953 191
220 3300026023 Ga0207677_11031029 Ga0207677_110310291 191
221 3300026041 Ga0207639_10032706 Ga0207639_100327062 191
222 3300026075 Ga0207708_10124078 Ga0207708_101240782 191
223 3300026089 Ga0207648_10050508 Ga0207648_100505082 191
224 3300026089 Ga0207648_10118459 Ga0207648_101184593 191
225 3300026089 Ga0207648_10355443 Ga0207648_103554432 191
226 3300026116 Ga0207674_10049475 Ga0207674_100494753 191
227 3300026118 Ga0207675_100231614 Ga0207675_1002316143 191
228 3300026118 Ga0207675_100247001 Ga0207675_1002470012 191
229 3300026118 Ga0207675_100264884 Ga0207675_1002648842 191
230 3300026118 Ga0207675_100325928 Ga0207675_1003259282 191
231 3300026121 Ga0207683_10024672 Ga0207683_100246725 191
232 3300026142 Ga0207698_10257523 Ga0207698_102575232 191
233 3300027364 Ga0209967_1018097 Ga0209967_10180971 191
234 3300027526 Ga0209968_1004258 Ga0209968_10042582 191
235 3300031238 Ga0265332_10015668 Ga0265332_100156682 191
236 3300031251 Ga0265327_10006193 Ga0265327_100061935 191
237 3300031548 Ga0307408_100238358 Ga0307408_1002383582 191
238 3300031548 Ga0307408_100304092 Ga0307408_1003040922 191
239 3300031711 Ga0265314_10035773 Ga0265314_100357733 191
240 3300031731 Ga0307405_10000086 Ga0307405_1000008620 191
241 3300031731 Ga0307405_10017951 Ga0307405_100179513 191
242 3300031731 Ga0307405_10229599 Ga0307405_102295992 191
243 3300031731 Ga0307405_10432042 Ga0307405_104320421 191
244 3300031824 Ga0307413_10004259 Ga0307413_100042592 191
245 3300031824 Ga0307413_10007052 Ga0307413_100070522 191
246 3300031824 Ga0307413_10018755 Ga0307413_100187552 191
247 3300031824 Ga0307413_10021457 Ga0307413_100214571 191
248 3300031852 Ga0307410_10004881 Ga0307410_100048816 191
249 3300031901 Ga0307406_10000581 Ga0307406_100005818 191
250 3300031901 Ga0307406_10013210 Ga0307406_100132102 191
251 3300031901 Ga0307406_10164593 Ga0307406_101645932 191
252 3300031903 Ga0307407_10012324 Ga0307407_100123245 191
253 3300031903 Ga0307407_10053646 Ga0307407_100536462 191
254 3300031911 Ga0307412_10013744 Ga0307412_100137445 191
255 3300031911 Ga0307412_10029611 Ga0307412_100296112 191
256 3300031995 Ga0307409_100000277 Ga0307409_10000027720 191
257 3300031995 Ga0307409_100006782 Ga0307409_1000067827 191
258 3300032002 Ga0307416_100004116 Ga0307416_1000041162 191
259 3300032002 Ga0307416_100007098 Ga0307416_1000070987 191
260 3300032002 Ga0307416_100030861 Ga0307416_1000308612 191
261 3300032002 Ga0307416_100640572 Ga0307416_1006405722 191
262 3300032004 Ga0307414_10009785 Ga0307414_100097857 191
263 3300032005 Ga0307411_10000937 Ga0307411_1000093711 191
264 3300032005 Ga0307411_10036011 Ga0307411_100360113 191
265 3300032005 Ga0307411_10143376 Ga0307411_101433762 191
266 3300032126 Ga0307415_100002617 Ga0307415_1000026173 191
267 3300032126 Ga0307415_100025293 Ga0307415_1000252933 191
268 3300035115 Ga0373941_0005137 Ga0373941_0005137_1296_1958 191
269 3300035692 Ga0373935_0086833 Ga0373935_0086833_608_1270 191
270 3300037418 Ga0395900_0058519 Ga0395900_0058519_452_1204 191
271 3300037471 Ga0395905_0004043 Ga0395905_0004043_12912_13664 191
272 3300038443 Ga0395901_0002608 Ga0395901_0002608_13265_14017 191
273 3300038996 Ga0242420_047757 Ga0242420_047757_39_701 191
274 3300039437 Ga0436365_0815860 Ga0436365_0815860_11887_12624 191
275 3300048915 Ga0496112_0004636 Ga0496112_0004636_5682_6344 191
276 3300048918 Ga0496115_0019628 Ga0496115_0019628_1896_2600 191
277 3300049573 Ga0501037_0368317 Ga0501037_0368317_257_940 191
278 3300049580 Ga0501046_0117287 Ga0501046_0117287_999_1682 191
279 3300049581 Ga0501047_0204931 Ga0501047_0204931_1054_1737 191
280 3300049767 Ga0501270_017068 Ga0501270_017068_169_921 191
281 3300050507 nmdc:mga05p37_1170_c2 nmdc:mga05p37_1170_c2_15135_15821 191
282 3300050508 nmdc:mga09592_3136_c1 nmdc:mga09592_3136_c1_1740_2426 191
283 3300050509 nmdc:mga0qj67_3736_c1 nmdc:mga0qj67_3736_c1_3445_4131 191
284 3300050510 nmdc:mga06r32_11880_c1 nmdc:mga06r32_11880_c1_3421_4107 191
285 3300050513 nmdc:mga0rr50_39638_c1 nmdc:mga0rr50_39638_c1_2003_2665 191
286 3300050515 nmdc:mga0a205_30046_c1 nmdc:mga0a205_30046_c1_4112_4774 191

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ytp-assembly1.cif.gz_D crystal structure of porcine heart mitochondrial complex ii bound with n-[(4-tert-butylphenyl)methyl]-2-(trifluoromethyl)benzamide 0.7002 98 183
4yxd-assembly1.cif.gz_D crystal structure of porcine heart mitochondrial complex ii bound with flutolanil 0.6774 98 182
5xmj-assembly2.cif.gz_K crystal structure of quinol:fumarate reductase from desulfovibrio gigas 0.6582 18 178
2bs4-assembly1.cif.gz_F glu c180 -> ile variant quinol:fumarate reductase fromwolinella succinogenes 0.6247 17 187
2bs3-assembly1.cif.gz_F glu c180 -> gln variant quinol:fumarate reductase from wolinella succinogenes 0.6198 17 187
ID Description Score Start End Superfamily
af_Q2FZC9_1_204_1.20.1300.10 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.7083 12 184 1.20.1300.10
4ytpD00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.7002 98 183 1.20.1300.10
3ae2D00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.6481 98 176 1.20.1300.10
af_Q2FZC9_1_204_1.20.1300.10 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.6463 12 184 1.20.1300.10
2ws3H00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.6242 104 187 1.20.1300.10
ID Description Score Start End GO Terms
AF-A0A7W1EBJ7-F1-model_v4 Succinate dehydrogenase 0.9619 1 91 GO:0016020
AF-A0A7W1EBJ7-F1-model_v4 Succinate dehydrogenase 0.9517 1 91 GO:0016020
AF-A0A3A8J5A4-F1-model_v4 Succinate dehydrogenase/fumarate reductase cytochrome b subunit 0.9185 8 191 GO:0016020
AF-A0A7W1KJY5-F1-model_v4 Succinate dehydrogenase cytochrome b subunit 0.9057 1 191 GO:0016020
AF-A9LH46-F1-model_v4 Succinate dehydrogenase cytochrome b558 subunit (EC 1.3.99.1) 0.9057 6 191 GO:0016020
GO:0016491

Feature Viewer

pLDDT pTM Quality
82.47 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map