F387398

General Info

Members Datasets Scaffolds Average Seq Length
286 176 572 174

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10023634|Ga0105238_100236345
Length 203
Sequence VGAILVPFVTICHRLTQATGKHKKGFMRRVLVIGSGGSGKSTVAARLGELLGLEVNHLDKFYWRAGWVEPAQDEWIKTVEELMDRDSWVMDGNYSGTLELRLRKCDTVVFLDLPRVLCLWRIVKRFLLYRNGNRPDVAEGCPEKLDFEFVSWVWNYPRRSRPKVIKLLREHAGEKQIFRLRSRNEVKKFLASHQNAKKEHMND

Samples

Sample ID Description Type Environment
1 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
78 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
114 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
117 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
118 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
119 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
133 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
134 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
135 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
136 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
137 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
138 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
141 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
142 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
146 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
147 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
148 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
149 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
150 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
151 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
152 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
153 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
154 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
155 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
156 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
157 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
158 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
159 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
160 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
161 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
162 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
163 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
164 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
169 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
170 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
171 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
172 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
173 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
174 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
175 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
176 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.94
Nodule 0
Rhizoplane 1.4
Rhizosphere 89.86
Stem 0
Stem Tuber 0
Unclassified 33.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105238_10023634 3300009551 Bacteria 6262
2 JGI24751J29686_10000012 3300002459 Bacteria 115709
3 JGI25406J46586_10000408 3300003203 Bacteria 19769
4 JGI25153J46596_10000145 3300003215 Bacteria 72113
5 rootH2_10031820 3300003320 Unclassified 3547
6 rootL2_10225526 3300003322 Unclassified 2553
7 Ga0055531_10004807 3300003794 Bacteria 8067
8 Ga0065714_10023588 3300005288 Bacteria 2306
9 Ga0065704_10256848 3300005289 Bacteria 975
10 Ga0065712_10014942 3300005290 Bacteria 1532
11 Ga0065715_10020811 3300005293 Unclassified 2152
12 Ga0065715_10151092 3300005293 Unclassified 1715
13 Ga0065715_10210023 3300005293 Bacteria 1318
14 Ga0065707_10215494 3300005295 Bacteria 1247
15 Ga0070690_100014306 3300005330 Unclassified 4707
16 Ga0070670_100000174 3300005331 Bacteria 58017
17 Ga0070670_100121146 3300005331 Bacteria 2257
18 Ga0070670_100134854 3300005331 Bacteria 2133
19 Ga0068869_100523505 3300005334 Bacteria 993
20 Ga0068869_100595506 3300005334 Unclassified 933
21 Ga0070666_10007065 3300005335 Bacteria 6918
22 Ga0070666_10425728 3300005335 Unclassified 957
23 Ga0068868_100003437 3300005338 Bacteria 11028
24 Ga0070660_100754014 3300005339 Bacteria 817
25 Ga0070689_100397973 3300005340 Bacteria 1163
26 Ga0070692_10099936 3300005345 Bacteria 1589
27 Ga0070692_10462057 3300005345 Unclassified 815
28 Ga0070692_10598921 3300005345 Unclassified 729
29 Ga0070673_100414864 3300005364 Unclassified 1206
30 Ga0070659_100069651 3300005366 Unclassified 2793
31 Ga0070701_10806764 3300005438 Bacteria 641
32 Ga0070705_100097225 3300005440 Unclassified 1850
33 Ga0070694_100002549 3300005444 Bacteria 10760
34 Ga0070694_100122486 3300005444 Bacteria 1868
35 Ga0070694_100282872 3300005444 Bacteria 1265
36 Ga0070694_100336016 3300005444 Bacteria 1166
37 Ga0070662_100095485 3300005457 Bacteria 2241
38 Ga0070681_10018744 3300005458 Bacteria 6926
39 Ga0070681_10494492 3300005458 Unclassified 1136
40 Ga0068867_100460865 3300005459 Bacteria 1085
41 Ga0068867_100545844 3300005459 Unclassified 1003
42 Ga0070698_100257173 3300005471 Bacteria 1678
43 Ga0070699_100273890 3300005518 Bacteria 1511
44 Ga0070679_100651165 3300005530 Unclassified 996
45 Ga0070684_100124156 3300005535 Bacteria 2324
46 Ga0070684_100229421 3300005535 Bacteria 1695
47 Ga0070672_100004122 3300005543 Bacteria 9486
48 Ga0070695_100167957 3300005545 Unclassified 1546
49 Ga0070695_100309796 3300005545 Bacteria 1170
50 Ga0070695_100533056 3300005545 Unclassified 913
51 Ga0070696_100060632 3300005546 Unclassified 2645
52 Ga0070696_100135113 3300005546 Unclassified 1797
53 Ga0070693_100160138 3300005547 Unclassified 1433
54 Ga0070704_100037229 3300005549 Unclassified 3322
55 Ga0070704_100420387 3300005549 Bacteria 1145
56 Ga0070704_100494109 3300005549 Bacteria 1061
57 Ga0070704_100947755 3300005549 Unclassified 776
58 Ga0068855_100985696 3300005563 Bacteria 886
59 Ga0070664_100004904 3300005564 Bacteria 10712
60 Ga0070664_100102615 3300005564 Bacteria 2489
61 Ga0070664_100278056 3300005564 Bacteria 1509
62 Ga0068857_100531478 3300005577 Bacteria 1106
63 Ga0068857_100631687 3300005577 Bacteria 1014
64 Ga0068854_100133175 3300005578 Bacteria 1900
65 Ga0068854_100185353 3300005578 Unclassified 1628
66 Ga0068854_100307652 3300005578 Bacteria 1284
67 Ga0068859_100002543 3300005617 Bacteria 18515
68 Ga0068859_100100543 3300005617 Unclassified 2947
69 Ga0068859_100135270 3300005617 Bacteria 2537
70 Ga0068859_100512523 3300005617 Bacteria 1295
71 Ga0068859_100742582 3300005617 Unclassified 1071
72 Ga0068859_101030934 3300005617 Unclassified 904
73 Ga0068864_100005294 3300005618 Bacteria 10560
74 Ga0068864_100167147 3300005618 Bacteria 2003
75 Ga0068864_100415687 3300005618 Unclassified 1280
76 Ga0068864_100515029 3300005618 Unclassified 1153
77 Ga0068864_100608722 3300005618 Unclassified 1061
78 Ga0068864_101516966 3300005618 Bacteria 673
79 Ga0068861_100108795 3300005719 Bacteria 2218
80 Ga0068861_101396931 3300005719 Bacteria 684
81 Ga0068861_101629937 3300005719 Unclassified 636
82 Ga0068863_100015617 3300005841 Bacteria 7294
83 Ga0068863_100140800 3300005841 Bacteria 2305
84 Ga0068858_100100275 3300005842 Bacteria 2701
85 Ga0068858_100163424 3300005842 Unclassified 2097
86 Ga0068858_101051547 3300005842 Bacteria 798
87 Ga0068860_100057808 3300005843 Bacteria 3687
88 Ga0068860_100300843 3300005843 Bacteria 1571
89 Ga0068862_100018426 3300005844 Bacteria 5814
90 Ga0068862_100136897 3300005844 Bacteria 2171
91 Ga0068862_100148709 3300005844 Bacteria 2084
92 Ga0068862_100958429 3300005844 Unclassified 844
93 Ga0081455_10421860 3300005937 Bacteria 920
94 Ga0081539_10000033 3300005985 Bacteria 309306
95 Ga0081539_10000612 3300005985 Bacteria 72310
96 Ga0075428_100447497 3300006844 Unclassified 1384
97 Ga0075434_100055595 3300006871 Unclassified 3933
98 Ga0075434_100325716 3300006871 Unclassified 1557
99 Ga0075434_101035466 3300006871 Unclassified 834
100 Ga0097620_100002543 3300006931 Bacteria 18515
101 Ga0097620_100100545 3300006931 Unclassified 2947
102 Ga0097620_100135277 3300006931 Bacteria 2537
103 Ga0097620_100226959 3300006931 Bacteria 1955
104 Ga0097620_100512480 3300006931 Bacteria 1295
105 Ga0097620_100742544 3300006931 Unclassified 1071
106 Ga0097620_101031014 3300006931 Unclassified 904
107 Ga0105240_10150282 3300009093 Unclassified 2775
108 Ga0105240_11031793 3300009093 Unclassified 878
109 Ga0105245_11919503 3300009098 Unclassified 645
110 Ga0105247_10144203 3300009101 Unclassified 1563
111 Ga0105247_10201043 3300009101 Bacteria 1339
112 Ga0114129_10104234 3300009147 Bacteria 3919
113 Ga0114129_12083423 3300009147 Unclassified 685
114 Ga0105243_10111724 3300009148 Bacteria 2288
115 Ga0105243_10429771 3300009148 Bacteria 1234
116 Ga0105241_10353503 3300009174 Bacteria 1276
117 Ga0105241_10377588 3300009174 Bacteria 1237
118 Ga0105241_10478056 3300009174 Unclassified 1107
119 Ga0105241_10680041 3300009174 Unclassified 937
120 Ga0105242_10408221 3300009176 Bacteria 1269
121 Ga0105248_10008746 3300009177 Bacteria 11121
122 Ga0105248_10198578 3300009177 Bacteria 2260
123 Ga0105248_10886256 3300009177 Bacteria 1007
124 Ga0105237_10104163 3300009545 Bacteria 2829
125 Ga0105237_10959684 3300009545 Bacteria 862
126 Ga0105249_10093523 3300009553 Unclassified 2816
127 Ga0105239_10347251 3300010375 Bacteria 1675
128 Ga0105239_10951608 3300010375 Bacteria 986
129 Ga0157373_10155500 3300013100 Bacteria 1609
130 Ga0157373_10357084 3300013100 Bacteria 1043
131 Ga0157374_11925059 3300013296 Unclassified 617
132 Ga0157378_12045993 3300013297 Unclassified 623
133 Ga0163162_10309348 3300013306 Bacteria 1712
134 Ga0163162_10527990 3300013306 Bacteria 1309
135 Ga0157372_11832488 3300013307 Unclassified 698
136 Ga0157372_12290788 3300013307 Bacteria 620
137 Ga0157375_10509157 3300013308 Bacteria 1368
138 Ga0157375_12064630 3300013308 Unclassified 678
139 Ga0163163_10000208 3300014325 Bacteria 60820
140 Ga0157380_10706456 3300014326 Bacteria 1014
141 Ga0157379_10076863 3300014968 Bacteria 2989
142 Ga0157379_10170551 3300014968 Unclassified 1964
143 Ga0157376_10006613 3300014969 Bacteria 8203
144 Ga0182007_10065948 3300015262 Bacteria 1186
145 Ga0213876_10000209 3300021384 Bacteria 58910
146 Ga0209758_1000060 3300025297 Bacteria 324326
147 Ga0209758_1066641 3300025297 Bacteria 1155
148 Ga0209050_1005532 3300025298 Bacteria 7893
149 Ga0209051_1011765 3300025303 Bacteria 4290
150 Ga0209257_1001302 3300025304 Bacteria 30372
151 Ga0209257_1042142 3300025304 Bacteria 1349
152 Ga0207697_10166384 3300025315 Bacteria 963
153 Ga0207647_10026308 3300025904 Unclassified 3809
154 Ga0207647_10382874 3300025904 Unclassified 794
155 Ga0207643_10335066 3300025908 Bacteria 947
156 Ga0207707_10003034 3300025912 Bacteria 14927
157 Ga0207660_10249409 3300025917 Unclassified 1401
158 Ga0207681_10037919 3300025923 Bacteria 3189
159 Ga0207694_10001471 3300025924 Bacteria 20135
160 Ga0207650_10000011 3300025925 Bacteria 450115
161 Ga0207650_10018655 3300025925 Unclassified 4869
162 Ga0207650_10405723 3300025925 Bacteria 1129
163 Ga0207650_10466306 3300025925 Bacteria 1052
164 Ga0207650_10568743 3300025925 Bacteria 951
165 Ga0207650_10725727 3300025925 Unclassified 840
166 Ga0207690_10213400 3300025932 Bacteria 1473
167 Ga0207706_10177931 3300025933 Bacteria 1868
168 Ga0207686_10497956 3300025934 Unclassified 945
169 Ga0207709_10019181 3300025935 Bacteria 3841
170 Ga0207709_10381581 3300025935 Unclassified 1073
171 Ga0207670_10535918 3300025936 Bacteria 955
172 Ga0207670_10662077 3300025936 Unclassified 862
173 Ga0207691_10010672 3300025940 Bacteria 8817
174 Ga0207691_10646465 3300025940 Bacteria 894
175 Ga0207711_10002600 3300025941 Bacteria 16036
176 Ga0207711_10010678 3300025941 Bacteria 7636
177 Ga0207711_10232636 3300025941 Bacteria 1688
178 Ga0207689_10084801 3300025942 Unclassified 2604
179 Ga0207689_10589358 3300025942 Bacteria 935
180 Ga0207679_10087564 3300025945 Unclassified 2398
181 Ga0207679_10369043 3300025945 Bacteria 1256
182 Ga0207679_10511852 3300025945 Unclassified 1072
183 Ga0207679_10537536 3300025945 Unclassified 1047
184 Ga0207667_10460366 3300025949 Bacteria 1292
185 Ga0207651_10792666 3300025960 Unclassified 840
186 Ga0207712_10190574 3300025961 Bacteria 1618
187 Ga0207668_10109581 3300025972 Bacteria 2069
188 Ga0207640_10148337 3300025981 Bacteria 1720
189 Ga0207640_10274628 3300025981 Bacteria 1320
190 Ga0207677_10093162 3300026023 Bacteria 2195
191 Ga0207703_10311666 3300026035 Bacteria 1439
192 Ga0207703_11036709 3300026035 Bacteria 787
193 Ga0207703_11862713 3300026035 Unclassified 578
194 Ga0207708_10000091 3300026075 Bacteria 71484
195 Ga0207708_10190870 3300026075 Bacteria 1631
196 Ga0207708_10282602 3300026075 Unclassified 1345
197 Ga0207641_10161938 3300026088 Bacteria 2035
198 Ga0207648_10102457 3300026089 Bacteria 2509
199 Ga0207676_10007651 3300026095 Bacteria 7669
200 Ga0207676_10453324 3300026095 Bacteria 1209
201 Ga0207676_10795594 3300026095 Unclassified 922
202 Ga0207674_10226957 3300026116 Bacteria 1815
203 Ga0207674_10487962 3300026116 Bacteria 1191
204 Ga0207674_10566455 3300026116 Bacteria 1097
205 Ga0207675_100634793 3300026118 Bacteria 1073
206 Ga0207675_101164216 3300026118 Unclassified 791
207 Ga0207675_101777652 3300026118 Unclassified 636
208 Ga0268266_10606697 3300028379 Bacteria 1052
209 Ga0268265_10031452 3300028380 Bacteria 3832
210 Ga0268265_11778140 3300028380 Unclassified 623
211 Ga0265322_10013920 3300028654 Bacteria 2328
212 Ga0265329_10027413 3300031242 Bacteria 1872
213 Ga0265316_10021063 3300031344 Bacteria 5532
214 Ga0265316_10388987 3300031344 Unclassified 1005
215 Ga0307513_10002993 3300031456 Bacteria 23041
216 Ga0307508_10106593 3300031616 Bacteria 2401
217 Ga0265342_10073055 3300031712 Bacteria 1995
218 Ga0307516_10387578 3300031730 Bacteria 1058
219 Ga0307405_10285872 3300031731 Bacteria 1244
220 Ga0307413_10511665 3300031824 Unclassified 966
221 Ga0307413_10883529 3300031824 Unclassified 758
222 Ga0307410_10514670 3300031852 Unclassified 987
223 Ga0307406_10652334 3300031901 Unclassified 874
224 Ga0307407_10125100 3300031903 Unclassified 1636
225 Ga0307409_100324608 3300031995 Bacteria 1442
226 Ga0307416_100498680 3300032002 Bacteria 1281
227 Ga0307416_102181613 3300032002 Unclassified 655
228 Ga0307411_10035237 3300032005 Bacteria 3123
229 Ga0307415_100089390 3300032126 Bacteria 2225
230 Ga0307415_100489575 3300032126 Unclassified 1073
231 Ga0373931_0019084 3300035691 Unclassified 3418
232 Ga0242420_001268 3300038996 Bacteria 3317
233 Ga0436365_0039241 3300039437 Bacteria 90885
234 Ga0439455_0013404 3300042012 Bacteria 1856
235 Ga0450890_025784 3300042127 Bacteria 817
236 Ga0450892_011964 3300042130 Unclassified 776
237 Ga0439458_0005424 3300042157 Bacteria 2868
238 Ga0453684_0015762 3300044712 Bacteria 11898
239 Ga0466957_0277231 3300044842 Bacteria 1121
240 Ga0466960_0320125 3300044901 Bacteria 878
241 Ga0451576_0274664 3300045051 Bacteria 1762
242 Ga0495592_0011757 3300046454 Bacteria 6631
243 Ga0495632_0057935 3300046519 Bacteria 1889
244 Ga0496106_0033416 3300048909 Bacteria 3838
245 Ga0496108_0016303 3300048911 Bacteria 6061
246 Ga0496112_0082107 3300048915 Bacteria 3188
247 Ga0496112_0274327 3300048915 Bacteria 1634
248 Ga0496121_0102057 3300048924 Bacteria 2211
249 Ga0501291_005582 3300049514 Unclassified 1650
250 Ga0501296_023712 3300049519 Unclassified 796
251 Ga0501298_000185 3300049521 Bacteria 7784
252 Ga0501299_026669 3300049522 Unclassified 1093
253 Ga0501299_057610 3300049522 Bacteria 816
254 Ga0501072_0007245 3300049588 Bacteria 8420
255 Ga0501076_0981757 3300049592 Bacteria 696
256 Ga0501077_0385935 3300049593 Bacteria 895
257 Ga0501207_108430 3300049654 Unclassified 565
258 Ga0501217_025920 3300049661 Bacteria 1414
259 Ga0501217_248594 3300049661 Bacteria 572
260 Ga0501224_004394 3300049664 Unclassified 2004
261 Ga0501227_001994 3300049665 Bacteria 4532
262 Ga0501236_064179 3300049670 Unclassified 658
263 Ga0501243_018678 3300049675 Unclassified 1131
264 Ga0501260_015891 3300049689 Unclassified 788
265 Ga0501261_060808 3300049690 Unclassified 641
266 Ga0501225_0016133 3300049705 Bacteria 2078
267 Ga0501225_0028004 3300049705 Unclassified 1549
268 Ga0501225_0041113 3300049705 Bacteria 1275
269 Ga0501225_0083353 3300049705 Unclassified 920
270 Ga0501234_012874 3300049707 Unclassified 1312
271 Ga0501283_000449 3300049779 Bacteria 5431
272 Ga0501212_011982 3300049851 Unclassified 1256
273 nmdc:mga05p37_128384_c1 3300050507 Bacteria 3112
274 nmdc:mga06r32_457189_c1 3300050510 Unclassified 1256
275 nmdc:mga0n895_10109_c1 3300050512 Bacteria 8307
276 nmdc:mga0n895_154512_c1 3300050512 Unclassified 2325
277 nmdc:mga0a205_76618_c1 3300050515 Bacteria 3232
278 Ga0500646_0339368 3300053090 Bacteria 546
279 Ga0500651_0642539 3300053093 Bacteria 572
280 Ga0500555_006606 3300053103 Bacteria 3298
281 Ga0500594_0018973 3300053118 Bacteria 1700
282 Ga0500642_0004697 3300053130 Bacteria 4312
283 Ga0500642_0168507 3300053130 Bacteria 1025
284 Ga0500568_0028605 3300053139 Bacteria 2322
285 Ga0500577_0007821 3300053142 Bacteria 3014
286 Ga0500609_001512 3300053731 Bacteria 3403
287 Ga0105238_10023634
288 JGI24751J29686_10000012
289 JGI25406J46586_10000408
290 JGI25153J46596_10000145
291 rootH2_10031820
292 rootL2_10225526
293 Ga0055531_10004807
294 Ga0065714_10023588
295 Ga0065704_10256848
296 Ga0065712_10014942
297 Ga0065715_10020811
298 Ga0065715_10151092
299 Ga0065715_10210023
300 Ga0065707_10215494
301 Ga0070690_100014306
302 Ga0070670_100000174
303 Ga0070670_100121146
304 Ga0070670_100134854
305 Ga0068869_100523505
306 Ga0068869_100595506
307 Ga0070666_10007065
308 Ga0070666_10425728
309 Ga0068868_100003437
310 Ga0070660_100754014
311 Ga0070689_100397973
312 Ga0070692_10099936
313 Ga0070692_10462057
314 Ga0070692_10598921
315 Ga0070673_100414864
316 Ga0070659_100069651
317 Ga0070701_10806764
318 Ga0070705_100097225
319 Ga0070694_100002549
320 Ga0070694_100122486
321 Ga0070694_100282872
322 Ga0070694_100336016
323 Ga0070662_100095485
324 Ga0070681_10018744
325 Ga0070681_10494492
326 Ga0068867_100460865
327 Ga0068867_100545844
328 Ga0070698_100257173
329 Ga0070699_100273890
330 Ga0070679_100651165
331 Ga0070684_100124156
332 Ga0070684_100229421
333 Ga0070672_100004122
334 Ga0070695_100167957
335 Ga0070695_100309796
336 Ga0070695_100533056
337 Ga0070696_100060632
338 Ga0070696_100135113
339 Ga0070693_100160138
340 Ga0070704_100037229
341 Ga0070704_100420387
342 Ga0070704_100494109
343 Ga0070704_100947755
344 Ga0068855_100985696
345 Ga0070664_100004904
346 Ga0070664_100102615
347 Ga0070664_100278056
348 Ga0068857_100531478
349 Ga0068857_100631687
350 Ga0068854_100133175
351 Ga0068854_100185353
352 Ga0068854_100307652
353 Ga0068859_100002543
354 Ga0068859_100100543
355 Ga0068859_100135270
356 Ga0068859_100512523
357 Ga0068859_100742582
358 Ga0068859_101030934
359 Ga0068864_100005294
360 Ga0068864_100167147
361 Ga0068864_100415687
362 Ga0068864_100515029
363 Ga0068864_100608722
364 Ga0068864_101516966
365 Ga0068861_100108795
366 Ga0068861_101396931
367 Ga0068861_101629937
368 Ga0068863_100015617
369 Ga0068863_100140800
370 Ga0068858_100100275
371 Ga0068858_100163424
372 Ga0068858_101051547
373 Ga0068860_100057808
374 Ga0068860_100300843
375 Ga0068862_100018426
376 Ga0068862_100136897
377 Ga0068862_100148709
378 Ga0068862_100958429
379 Ga0081455_10421860
380 Ga0081539_10000033
381 Ga0081539_10000612
382 Ga0075428_100447497
383 Ga0075434_100055595
384 Ga0075434_100325716
385 Ga0075434_101035466
386 Ga0097620_100002543
387 Ga0097620_100100545
388 Ga0097620_100135277
389 Ga0097620_100226959
390 Ga0097620_100512480
391 Ga0097620_100742544
392 Ga0097620_101031014
393 Ga0105240_10150282
394 Ga0105240_11031793
395 Ga0105245_11919503
396 Ga0105247_10144203
397 Ga0105247_10201043
398 Ga0114129_10104234
399 Ga0114129_12083423
400 Ga0105243_10111724
401 Ga0105243_10429771
402 Ga0105241_10353503
403 Ga0105241_10377588
404 Ga0105241_10478056
405 Ga0105241_10680041
406 Ga0105242_10408221
407 Ga0105248_10008746
408 Ga0105248_10198578
409 Ga0105248_10886256
410 Ga0105237_10104163
411 Ga0105237_10959684
412 Ga0105249_10093523
413 Ga0105239_10347251
414 Ga0105239_10951608
415 Ga0157373_10155500
416 Ga0157373_10357084
417 Ga0157374_11925059
418 Ga0157378_12045993
419 Ga0163162_10309348
420 Ga0163162_10527990
421 Ga0157372_11832488
422 Ga0157372_12290788
423 Ga0157375_10509157
424 Ga0157375_12064630
425 Ga0163163_10000208
426 Ga0157380_10706456
427 Ga0157379_10076863
428 Ga0157379_10170551
429 Ga0157376_10006613
430 Ga0182007_10065948
431 Ga0213876_10000209
432 Ga0209758_1000060
433 Ga0209758_1066641
434 Ga0209050_1005532
435 Ga0209051_1011765
436 Ga0209257_1001302
437 Ga0209257_1042142
438 Ga0207697_10166384
439 Ga0207647_10026308
440 Ga0207647_10382874
441 Ga0207643_10335066
442 Ga0207707_10003034
443 Ga0207660_10249409
444 Ga0207681_10037919
445 Ga0207694_10001471
446 Ga0207650_10000011
447 Ga0207650_10018655
448 Ga0207650_10405723
449 Ga0207650_10466306
450 Ga0207650_10568743
451 Ga0207650_10725727
452 Ga0207690_10213400
453 Ga0207706_10177931
454 Ga0207686_10497956
455 Ga0207709_10019181
456 Ga0207709_10381581
457 Ga0207670_10535918
458 Ga0207670_10662077
459 Ga0207691_10010672
460 Ga0207691_10646465
461 Ga0207711_10002600
462 Ga0207711_10010678
463 Ga0207711_10232636
464 Ga0207689_10084801
465 Ga0207689_10589358
466 Ga0207679_10087564
467 Ga0207679_10369043
468 Ga0207679_10511852
469 Ga0207679_10537536
470 Ga0207667_10460366
471 Ga0207651_10792666
472 Ga0207712_10190574
473 Ga0207668_10109581
474 Ga0207640_10148337
475 Ga0207640_10274628
476 Ga0207677_10093162
477 Ga0207703_10311666
478 Ga0207703_11036709
479 Ga0207703_11862713
480 Ga0207708_10000091
481 Ga0207708_10190870
482 Ga0207708_10282602
483 Ga0207641_10161938
484 Ga0207648_10102457
485 Ga0207676_10007651
486 Ga0207676_10453324
487 Ga0207676_10795594
488 Ga0207674_10226957
489 Ga0207674_10487962
490 Ga0207674_10566455
491 Ga0207675_100634793
492 Ga0207675_101164216
493 Ga0207675_101777652
494 Ga0268266_10606697
495 Ga0268265_10031452
496 Ga0268265_11778140
497 Ga0265322_10013920
498 Ga0265329_10027413
499 Ga0265316_10021063
500 Ga0265316_10388987
501 Ga0307513_10002993
502 Ga0307508_10106593
503 Ga0265342_10073055
504 Ga0307516_10387578
505 Ga0307405_10285872
506 Ga0307413_10511665
507 Ga0307413_10883529
508 Ga0307410_10514670
509 Ga0307406_10652334
510 Ga0307407_10125100
511 Ga0307409_100324608
512 Ga0307416_100498680
513 Ga0307416_102181613
514 Ga0307411_10035237
515 Ga0307415_100089390
516 Ga0307415_100489575
517 Ga0373931_0019084
518 Ga0242420_001268
519 Ga0436365_0039241
520 Ga0439455_0013404
521 Ga0450890_025784
522 Ga0450892_011964
523 Ga0439458_0005424
524 Ga0453684_0015762
525 Ga0466957_0277231
526 Ga0466960_0320125
527 Ga0451576_0274664
528 Ga0495592_0011757
529 Ga0495632_0057935
530 Ga0496106_0033416
531 Ga0496108_0016303
532 Ga0496112_0082107
533 Ga0496112_0274327
534 Ga0496121_0102057
535 Ga0501291_005582
536 Ga0501296_023712
537 Ga0501298_000185
538 Ga0501299_026669
539 Ga0501299_057610
540 Ga0501072_0007245
541 Ga0501076_0981757
542 Ga0501077_0385935
543 Ga0501207_108430
544 Ga0501217_025920
545 Ga0501217_248594
546 Ga0501224_004394
547 Ga0501227_001994
548 Ga0501236_064179
549 Ga0501243_018678
550 Ga0501260_015891
551 Ga0501261_060808
552 Ga0501225_0016133
553 Ga0501225_0028004
554 Ga0501225_0041113
555 Ga0501225_0083353
556 Ga0501234_012874
557 Ga0501283_000449
558 Ga0501212_011982
559 nmdc:mga05p37_128384_c1
560 nmdc:mga06r32_457189_c1
561 nmdc:mga0n895_10109_c1
562 nmdc:mga0n895_154512_c1
563 nmdc:mga0a205_76618_c1
564 Ga0500646_0339368
565 Ga0500651_0642539
566 Ga0500555_006606
567 Ga0500594_0018973
568 Ga0500642_0004697
569 Ga0500642_0168507
570 Ga0500568_0028605
571 Ga0500577_0007821
572 Ga0500609_001512

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nwj-assembly3.cif.gz_A crystal structure of shikimate kinase from arabidopsis thaliana (atsk2) 0.7176 2 102
3nwj-assembly3.cif.gz_B crystal structure of shikimate kinase from arabidopsis thaliana (atsk2) 0.6762 2 104
1ukz-assembly1.cif.gz_A substrate specificity and assembly of catalytic center derived from two structures of ligated uridylate kinase 0.6712 2 173
3fb4-assembly1.cif.gz_A crystal structure of adenylate kinase from marinibacillus marinus 0.6697 1 166
4cvn-assembly1.cif.gz_D structure of the fap7-rps14 complex 0.6694 4 166
ID Description Score Start End Superfamily
af_A0A1D6H6N6_28_186_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7268 1 97 3.40.50.300
af_Q7EYP9_5_180_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6808 1 172 3.40.50.300
3nwjB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6762 2 104 3.40.50.300
4cvnD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6694 4 166 3.40.50.300
af_Q5TCS8_1409_1601_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.666 2 167 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A6I3QBT7-F1-model_v4 Adenylate kinase 0.9847 2 170 GO:0016301
AF-A0A0Q1CJ15-F1-model_v4 Adenylate kinase 0.9821 2 166 GO:0016301
AF-A0A1Z4S9T8-F1-model_v4 deleted 0.9811 6 168
AF-A0A2Y9BE67-F1-model_v4 Adenylate kinase family enzyme 0.9799 1 140 GO:0016301
AF-A0A6I5XGN0-F1-model_v4 deleted 0.9788 2 167

Map