F387371

General Info

Members Datasets Scaffolds Average Seq Length
286 165 572 80

Family's Representative Sequence

Representative Sequence 3300007076|Ga0075435_100010328|Ga0075435_1000103287
Length 96
Sequence MRSSWFRFLVFIIVAAAFVLLAHTYAEAQCSMCRASLTSITDSRFIRNFNIGVLVLLVPPATIFCSIFVVLKRYKPQIDADECGSEEERRIRVDPR

Samples

Sample ID Description Type Environment
1 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
143 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
145 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
146 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
147 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
148 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
149 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
150 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
151 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
152 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
153 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
154 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
155 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
156 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
162 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
163 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
164 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.95
Metatranscriptomes 1.05
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.45
Rhizosphere 97.2
Stem 0
Stem Tuber 0
Unclassified 35.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075435_100010328 3300007076 Bacteria 6824
2 CNAas_1001727 3300000532 Unclassified 1735
3 JGI24751J29686_10000072 3300002459 Bacteria 57601
4 Ga0058861_10865738 3300004800 Bacteria 618
5 Ga0065704_10306574 3300005289 Bacteria 876
6 Ga0065712_10547213 3300005290 Unclassified 597
7 Ga0065715_10222697 3300005293 Bacteria 1264
8 Ga0065715_10874902 3300005293 Bacteria 583
9 Ga0065715_11061027 3300005293 Unclassified 529
10 Ga0065707_10273758 3300005295 Bacteria 1051
11 Ga0065707_10517988 3300005295 Unclassified 744
12 Ga0070683_100892902 3300005329 Unclassified 852
13 Ga0070670_100000378 3300005331 Bacteria 37152
14 Ga0070670_100045150 3300005331 Bacteria 3787
15 Ga0070666_10305160 3300005335 Bacteria 1134
16 Ga0070680_100005191 3300005336 Bacteria 9858
17 Ga0070680_100147558 3300005336 Bacteria 1974
18 Ga0070682_101195524 3300005337 Bacteria 641
19 Ga0068868_100651447 3300005338 Bacteria 938
20 Ga0070660_100113771 3300005339 Bacteria 2155
21 Ga0070689_100392409 3300005340 Unclassified 1172
22 Ga0070661_101322040 3300005344 Unclassified 605
23 Ga0070692_10114265 3300005345 Bacteria 1497
24 Ga0070692_11381580 3300005345 Unclassified 508
25 Ga0070692_11408794 3300005345 Unclassified 503
26 Ga0070669_100118742 3300005353 Bacteria 2015
27 Ga0070669_101644633 3300005353 Unclassified 559
28 Ga0070675_100497668 3300005354 Bacteria 1098
29 Ga0070671_101450553 3300005355 Bacteria 607
30 Ga0070673_100102169 3300005364 Bacteria 2363
31 Ga0070659_101262130 3300005366 Unclassified 654
32 Ga0070701_10135554 3300005438 Bacteria 1403
33 Ga0070705_100002015 3300005440 Bacteria 10390
34 Ga0070705_100118487 3300005440 Bacteria 1705
35 Ga0070705_100179198 3300005440 Bacteria 1434
36 Ga0070705_101434936 3300005440 Bacteria 576
37 Ga0070705_101655897 3300005440 Bacteria 540
38 Ga0070700_100391114 3300005441 Bacteria 1043
39 Ga0070694_100039396 3300005444 Bacteria 3145
40 Ga0070694_100293025 3300005444 Bacteria 1244
41 Ga0070694_100400356 3300005444 Bacteria 1074
42 Ga0070708_100550732 3300005445 Bacteria 1088
43 Ga0070678_101716830 3300005456 Unclassified 591
44 Ga0070681_10001421 3300005458 Bacteria 21057
45 Ga0070681_10013450 3300005458 Bacteria 8131
46 Ga0070681_10117341 3300005458 Bacteria 2598
47 Ga0068867_101088341 3300005459 Unclassified 729
48 Ga0070706_102106402 3300005467 Bacteria 510
49 Ga0070698_100011302 3300005471 Bacteria 9478
50 Ga0070699_100016122 3300005518 Bacteria 6414
51 Ga0070679_100000029 3300005530 Bacteria 108401
52 Ga0070679_100200554 3300005530 Bacteria 1962
53 Ga0070697_100089625 3300005536 Bacteria 2541
54 Ga0070697_100983176 3300005536 Unclassified 750
55 Ga0068853_100009465 3300005539 Bacteria 7850
56 Ga0068853_100454661 3300005539 Bacteria 1205
57 Ga0068853_102177507 3300005539 Unclassified 537
58 Ga0070672_101471733 3300005543 Unclassified 610
59 Ga0070695_100521669 3300005545 Unclassified 922
60 Ga0070695_100670425 3300005545 Bacteria 821
61 Ga0070695_101702274 3300005545 Unclassified 528
62 Ga0070696_100016697 3300005546 Bacteria 4950
63 Ga0070696_100081576 3300005546 Unclassified 2292
64 Ga0070696_100121128 3300005546 Bacteria 1894
65 Ga0070696_101915145 3300005546 Unclassified 514
66 Ga0070693_100001932 3300005547 Bacteria 9484
67 Ga0070693_100021492 3300005547 Bacteria 3419
68 Ga0070693_100119757 3300005547 Viruses 1631
69 Ga0070704_100113394 3300005549 Unclassified 2067
70 Ga0070704_100994909 3300005549 Unclassified 758
71 Ga0070664_100002876 3300005564 Bacteria 13949
72 Ga0070664_100419987 3300005564 Bacteria 1225
73 Ga0070664_100558066 3300005564 Unclassified 1059
74 Ga0070664_101206588 3300005564 Unclassified 714
75 Ga0070664_101553328 3300005564 Unclassified 627
76 Ga0068857_100012364 3300005577 Bacteria 7429
77 Ga0068857_100176861 3300005577 Bacteria 1941
78 Ga0068857_101146312 3300005577 Bacteria 752
79 Ga0068857_101684965 3300005577 Unclassified 620
80 Ga0068854_100047550 3300005578 Unclassified 3058
81 Ga0070702_100661573 3300005615 Unclassified 791
82 Ga0068859_100040855 3300005617 Bacteria 4659
83 Ga0068859_100073538 3300005617 Bacteria 3456
84 Ga0068859_100722521 3300005617 Bacteria 1086
85 Ga0068859_100745505 3300005617 Bacteria 1068
86 Ga0068859_100997482 3300005617 Unclassified 920
87 Ga0068859_102862824 3300005617 Unclassified 529
88 Ga0068864_100020105 3300005618 Bacteria 5584
89 Ga0068864_100126111 3300005618 Bacteria 2294
90 Ga0068864_100364945 3300005618 Bacteria 1365
91 Ga0068864_100372026 3300005618 Unclassified 1352
92 Ga0068864_100576734 3300005618 Bacteria 1090
93 Ga0068866_10273641 3300005718 Unclassified 1043
94 Ga0068861_100012351 3300005719 Bacteria 5955
95 Ga0068861_100078600 3300005719 Bacteria 2577
96 Ga0068861_101033493 3300005719 Unclassified 786
97 Ga0068851_10000883 3300005834 Bacteria 12943
98 Ga0068870_10121399 3300005840 Bacteria 1506
99 Ga0068870_10130387 3300005840 Bacteria 1460
100 Ga0068870_10180862 3300005840 Bacteria 1266
101 Ga0068870_11112898 3300005840 Unclassified 568
102 Ga0068863_101109929 3300005841 Bacteria 796
103 Ga0068863_101344331 3300005841 Bacteria 722
104 Ga0068858_100043375 3300005842 Bacteria 4170
105 Ga0068858_100066637 3300005842 Bacteria 3334
106 Ga0068858_102189220 3300005842 Unclassified 547
107 Ga0068860_100058028 3300005843 Unclassified 3679
108 Ga0068860_100907106 3300005843 Unclassified 897
109 Ga0068862_100148120 3300005844 Bacteria 2088
110 Ga0068862_100818019 3300005844 Bacteria 911
111 Ga0068862_101391491 3300005844 Bacteria 705
112 Ga0081455_10852443 3300005937 Unclassified 569
113 Ga0070716_100075567 3300006173 Bacteria 1994
114 Ga0068871_100097864 3300006358 Bacteria 2453
115 Ga0075431_101628543 3300006847 Bacteria 603
116 Ga0075433_10061022 3300006852 Unclassified 3303
117 Ga0075433_10074131 3300006852 Bacteria 2994
118 Ga0075434_100913835 3300006871 Unclassified 892
119 Ga0075434_101704410 3300006871 Unclassified 638
120 Ga0075434_102516684 3300006871 Bacteria 516
121 Ga0075436_100196837 3300006914 Unclassified 1427
122 Ga0097620_100040855 3300006931 Bacteria 4659
123 Ga0097620_100073551 3300006931 Bacteria 3456
124 Ga0097620_100143369 3300006931 Bacteria 2462
125 Ga0097620_100722578 3300006931 Bacteria 1086
126 Ga0097620_100745462 3300006931 Bacteria 1068
127 Ga0097620_100997376 3300006931 Unclassified 920
128 Ga0097620_102863692 3300006931 Unclassified 529
129 Ga0075435_100063830 3300007076 Bacteria 2991
130 Ga0105240_10203586 3300009093 Bacteria 2318
131 Ga0105240_11688793 3300009093 Unclassified 661
132 Ga0105245_11042127 3300009098 Bacteria 863
133 Ga0105245_11591943 3300009098 Unclassified 705
134 Ga0105247_10027299 3300009101 Bacteria 3453
135 Ga0114129_10011179 3300009147 Bacteria 12798
136 Ga0114129_10143882 3300009147 Bacteria 3267
137 Ga0114129_10505605 3300009147 Unclassified 1578
138 Ga0105241_10231510 3300009174 Unclassified 1558
139 Ga0105241_10295392 3300009174 Bacteria 1389
140 Ga0105241_10908998 3300009174 Bacteria 818
141 Ga0105241_10911906 3300009174 Unclassified 817
142 Ga0105241_11057634 3300009174 Unclassified 762
143 Ga0105241_11078439 3300009174 Bacteria 755
144 Ga0105241_11230570 3300009174 Unclassified 710
145 Ga0105241_11340165 3300009174 Unclassified 683
146 Ga0105242_11017513 3300009176 Unclassified 837
147 Ga0105248_10022999 3300009177 Bacteria 6922
148 Ga0105248_10125271 3300009177 Bacteria 2898
149 Ga0105248_10131978 3300009177 Unclassified 2818
150 Ga0105248_10169863 3300009177 Unclassified 2458
151 Ga0105248_10331060 3300009177 Bacteria 1715
152 Ga0105237_10003955 3300009545 Bacteria 17347
153 Ga0105237_11261771 3300009545 Unclassified 745
154 Ga0105238_11085922 3300009551 Bacteria 823
155 Ga0105249_10039835 3300009553 Bacteria 4266
156 Ga0105239_10075388 3300010375 Bacteria 3709
157 Ga0105239_10399486 3300010375 Bacteria 1555
158 Ga0105246_11237039 3300011119 Unclassified 689
159 Ga0157373_10256855 3300013100 Bacteria 1236
160 Ga0157373_10522023 3300013100 Bacteria 859
161 Ga0157378_10455750 3300013297 Unclassified 1270
162 Ga0163162_10136005 3300013306 Bacteria 2568
163 Ga0163162_10329250 3300013306 Unclassified 1660
164 Ga0163162_12271825 3300013306 Bacteria 623
165 Ga0163162_12403245 3300013306 Unclassified 606
166 Ga0157372_10018062 3300013307 Bacteria 7581
167 Ga0157372_11693440 3300013307 Bacteria 728
168 Ga0157375_10011588 3300013308 Bacteria 7790
169 Ga0157375_12821968 3300013308 Unclassified 581
170 Ga0163163_10001302 3300014325 Bacteria 21073
171 Ga0163163_11054123 3300014325 Unclassified 876
172 Ga0163163_12355868 3300014325 Bacteria 591
173 Ga0157380_10336034 3300014326 Bacteria 1407
174 Ga0157380_10848624 3300014326 Unclassified 935
175 Ga0157379_10893564 3300014968 Unclassified 842
176 Ga0182007_10102067 3300015262 Bacteria 950
177 Ga0182007_10223642 3300015262 Unclassified 666
178 Ga0207697_10027417 3300025315 Bacteria 2328
179 Ga0207656_10014993 3300025321 Bacteria 2995
180 Ga0207653_10000754 3300025885 Bacteria 11037
181 Ga0207710_10235190 3300025900 Unclassified 913
182 Ga0207688_10905047 3300025901 Unclassified 559
183 Ga0207680_10421667 3300025903 Bacteria 945
184 Ga0207647_10175654 3300025904 Bacteria 1246
185 Ga0207643_10074973 3300025908 Bacteria 1952
186 Ga0207643_10089165 3300025908 Bacteria 1796
187 Ga0207643_11012419 3300025908 Unclassified 537
188 Ga0207654_10241171 3300025911 Unclassified 1208
189 Ga0207654_10693681 3300025911 Bacteria 731
190 Ga0207707_10000060 3300025912 Bacteria 108561
191 Ga0207707_10002592 3300025912 Bacteria 16195
192 Ga0207707_10386621 3300025912 Bacteria 1202
193 Ga0207671_10016699 3300025914 Bacteria 5697
194 Ga0207660_10003245 3300025917 Bacteria 10651
195 Ga0207660_10171761 3300025917 Bacteria 1678
196 Ga0207662_10208726 3300025918 Unclassified 1267
197 Ga0207657_10146725 3300025919 Bacteria 1924
198 Ga0207652_10000073 3300025921 Bacteria 108588
199 Ga0207652_10075930 3300025921 Bacteria 2929
200 Ga0207652_10169798 3300025921 Bacteria 1957
201 Ga0207646_10285493 3300025922 Bacteria 1491
202 Ga0207681_10388156 3300025923 Bacteria 1125
203 Ga0207694_10761997 3300025924 Bacteria 817
204 Ga0207650_10000027 3300025925 Bacteria 257466
205 Ga0207650_10060108 3300025925 Bacteria 2836
206 Ga0207690_10000867 3300025932 Bacteria 19319
207 Ga0207690_10701559 3300025932 Bacteria 832
208 Ga0207690_11035385 3300025932 Unclassified 683
209 Ga0207686_10028976 3300025934 Bacteria 3261
210 Ga0207709_10002017 3300025935 Bacteria 13174
211 Ga0207709_10407323 3300025935 Bacteria 1041
212 Ga0207670_10198182 3300025936 Bacteria 1524
213 Ga0207665_10162125 3300025939 Unclassified 1609
214 Ga0207711_10060819 3300025941 Bacteria 3256
215 Ga0207689_10625294 3300025942 Bacteria 907
216 Ga0207661_11034672 3300025944 Unclassified 756
217 Ga0207679_10058198 3300025945 Bacteria 2862
218 Ga0207679_11009665 3300025945 Unclassified 763
219 Ga0207667_10499267 3300025949 Bacteria 1234
220 Ga0207651_10082122 3300025960 Bacteria 2326
221 Ga0207640_10125934 3300025981 Unclassified 1844
222 Ga0207677_10074846 3300026023 Unclassified 2404
223 Ga0207703_10050186 3300026035 Bacteria 3376
224 Ga0207703_10491839 3300026035 Bacteria 1150
225 Ga0207703_10624241 3300026035 Bacteria 1021
226 Ga0207639_10023709 3300026041 Unclassified 4433
227 Ga0207708_10098586 3300026075 Bacteria 2259
228 Ga0207708_11654930 3300026075 Bacteria 562
229 Ga0207648_10255705 3300026089 Bacteria 1562
230 Ga0207676_10027328 3300026095 Bacteria 4249
231 Ga0207674_10001414 3300026116 Bacteria 30996
232 Ga0207674_10137381 3300026116 Unclassified 2405
233 Ga0207674_10187719 3300026116 Unclassified 2017
234 Ga0207675_100020896 3300026118 Bacteria 6104
235 Ga0207675_100133156 3300026118 Bacteria 2357
236 Ga0207675_101174380 3300026118 Unclassified 788
237 Ga0207428_10517602 3300027907 Bacteria 865
238 Ga0268264_11381936 3300028381 Unclassified 715
239 Ga0307513_10638991 3300031456 Unclassified 772
240 Ga0307408_101903651 3300031548 Unclassified 570
241 Ga0307408_102472137 3300031548 Unclassified 505
242 Ga0307405_10074157 3300031731 Bacteria 2200
243 Ga0307413_10878618 3300031824 Unclassified 760
244 Ga0307406_10477767 3300031901 Bacteria 1006
245 Ga0307406_10650275 3300031901 Bacteria 875
246 Ga0307409_100243195 3300031995 Bacteria 1640
247 Ga0307414_10458013 3300032004 Bacteria 1120
248 Ga0373951_0101279 3300035091 Unclassified 766
249 Ga0395898_0118961 3300037466 Bacteria 2531
250 Ga0395901_0508183 3300038443 Bacteria 1226
251 Ga0496104_0732826 3300048907 Unclassified 896
252 Ga0496105_1323062 3300048908 Unclassified 525
253 Ga0496107_0397529 3300048910 Bacteria 1025
254 Ga0496109_0703646 3300048912 Bacteria 948
255 Ga0496112_0087001 3300048915 Bacteria 3092
256 Ga0496113_0527369 3300048916 Bacteria 948
257 Ga0496113_0666884 3300048916 Unclassified 831
258 Ga0501038_0001190 3300049574 Bacteria 23650
259 Ga0501217_024197 3300049661 Bacteria 1451
260 Ga0501227_014342 3300049665 Bacteria 1758
261 Ga0501230_096012 3300049667 Unclassified 635
262 Ga0501233_257183 3300049668 Unclassified 527
263 Ga0501235_013117 3300049669 Bacteria 1823
264 Ga0501236_012234 3300049670 Bacteria 1153
265 Ga0501257_106263 3300049686 Bacteria 741
266 Ga0501234_020227 3300049707 Bacteria 1058
267 Ga0501245_048508 3300049708 Bacteria 747
268 Ga0501271_035002 3300049768 Unclassified 635
269 Ga0501272_052821 3300049769 Unclassified 567
270 Ga0501212_007830 3300049851 Bacteria 1474
271 Ga0501226_006607 3300049853 Bacteria 1313
272 nmdc:mga05p37_1058566_c1 3300050507 Unclassified 855
273 nmdc:mga05p37_1593613_c1 3300050507 Bacteria 644
274 nmdc:mga05p37_454207_c1 3300050507 Bacteria 1482
275 nmdc:mga0qj67_150450_c1 3300050509 Bacteria 1888
276 nmdc:mga08y16_267304_c1 3300050511 Bacteria 1766
277 nmdc:mga0n895_158264_c1 3300050512 Bacteria 2296
278 nmdc:mga0rr50_155923_c1 3300050513 Unclassified 1849
279 nmdc:mga0rr50_46620_c1 3300050513 Bacteria 3192
280 nmdc:mga0rr50_486625_c1 3300050513 Unclassified 1048
281 nmdc:mga08x19_353996_c1 3300050514 Unclassified 1025
282 nmdc:mga0a205_1105328_c1 3300050515 Bacteria 640
283 nmdc:mga0a205_234413_c1 3300050515 Unclassified 1328
284 nmdc:mga0a205_863989_c1 3300050515 Unclassified 752
285 Ga0587084_078395 3300059477 Unclassified 636
286 Ga0587085_022120 3300059506 Unclassified 978
287 Ga0075435_100010328
288 CNAas_1001727
289 JGI24751J29686_10000072
290 Ga0058861_10865738
291 Ga0065704_10306574
292 Ga0065712_10547213
293 Ga0065715_10222697
294 Ga0065715_10874902
295 Ga0065715_11061027
296 Ga0065707_10273758
297 Ga0065707_10517988
298 Ga0070683_100892902
299 Ga0070670_100000378
300 Ga0070670_100045150
301 Ga0070666_10305160
302 Ga0070680_100005191
303 Ga0070680_100147558
304 Ga0070682_101195524
305 Ga0068868_100651447
306 Ga0070660_100113771
307 Ga0070689_100392409
308 Ga0070661_101322040
309 Ga0070692_10114265
310 Ga0070692_11381580
311 Ga0070692_11408794
312 Ga0070669_100118742
313 Ga0070669_101644633
314 Ga0070675_100497668
315 Ga0070671_101450553
316 Ga0070673_100102169
317 Ga0070659_101262130
318 Ga0070701_10135554
319 Ga0070705_100002015
320 Ga0070705_100118487
321 Ga0070705_100179198
322 Ga0070705_101434936
323 Ga0070705_101655897
324 Ga0070700_100391114
325 Ga0070694_100039396
326 Ga0070694_100293025
327 Ga0070694_100400356
328 Ga0070708_100550732
329 Ga0070678_101716830
330 Ga0070681_10001421
331 Ga0070681_10013450
332 Ga0070681_10117341
333 Ga0068867_101088341
334 Ga0070706_102106402
335 Ga0070698_100011302
336 Ga0070699_100016122
337 Ga0070679_100000029
338 Ga0070679_100200554
339 Ga0070697_100089625
340 Ga0070697_100983176
341 Ga0068853_100009465
342 Ga0068853_100454661
343 Ga0068853_102177507
344 Ga0070672_101471733
345 Ga0070695_100521669
346 Ga0070695_100670425
347 Ga0070695_101702274
348 Ga0070696_100016697
349 Ga0070696_100081576
350 Ga0070696_100121128
351 Ga0070696_101915145
352 Ga0070693_100001932
353 Ga0070693_100021492
354 Ga0070693_100119757
355 Ga0070704_100113394
356 Ga0070704_100994909
357 Ga0070664_100002876
358 Ga0070664_100419987
359 Ga0070664_100558066
360 Ga0070664_101206588
361 Ga0070664_101553328
362 Ga0068857_100012364
363 Ga0068857_100176861
364 Ga0068857_101146312
365 Ga0068857_101684965
366 Ga0068854_100047550
367 Ga0070702_100661573
368 Ga0068859_100040855
369 Ga0068859_100073538
370 Ga0068859_100722521
371 Ga0068859_100745505
372 Ga0068859_100997482
373 Ga0068859_102862824
374 Ga0068864_100020105
375 Ga0068864_100126111
376 Ga0068864_100364945
377 Ga0068864_100372026
378 Ga0068864_100576734
379 Ga0068866_10273641
380 Ga0068861_100012351
381 Ga0068861_100078600
382 Ga0068861_101033493
383 Ga0068851_10000883
384 Ga0068870_10121399
385 Ga0068870_10130387
386 Ga0068870_10180862
387 Ga0068870_11112898
388 Ga0068863_101109929
389 Ga0068863_101344331
390 Ga0068858_100043375
391 Ga0068858_100066637
392 Ga0068858_102189220
393 Ga0068860_100058028
394 Ga0068860_100907106
395 Ga0068862_100148120
396 Ga0068862_100818019
397 Ga0068862_101391491
398 Ga0081455_10852443
399 Ga0070716_100075567
400 Ga0068871_100097864
401 Ga0075431_101628543
402 Ga0075433_10061022
403 Ga0075433_10074131
404 Ga0075434_100913835
405 Ga0075434_101704410
406 Ga0075434_102516684
407 Ga0075436_100196837
408 Ga0097620_100040855
409 Ga0097620_100073551
410 Ga0097620_100143369
411 Ga0097620_100722578
412 Ga0097620_100745462
413 Ga0097620_100997376
414 Ga0097620_102863692
415 Ga0075435_100063830
416 Ga0105240_10203586
417 Ga0105240_11688793
418 Ga0105245_11042127
419 Ga0105245_11591943
420 Ga0105247_10027299
421 Ga0114129_10011179
422 Ga0114129_10143882
423 Ga0114129_10505605
424 Ga0105241_10231510
425 Ga0105241_10295392
426 Ga0105241_10908998
427 Ga0105241_10911906
428 Ga0105241_11057634
429 Ga0105241_11078439
430 Ga0105241_11230570
431 Ga0105241_11340165
432 Ga0105242_11017513
433 Ga0105248_10022999
434 Ga0105248_10125271
435 Ga0105248_10131978
436 Ga0105248_10169863
437 Ga0105248_10331060
438 Ga0105237_10003955
439 Ga0105237_11261771
440 Ga0105238_11085922
441 Ga0105249_10039835
442 Ga0105239_10075388
443 Ga0105239_10399486
444 Ga0105246_11237039
445 Ga0157373_10256855
446 Ga0157373_10522023
447 Ga0157378_10455750
448 Ga0163162_10136005
449 Ga0163162_10329250
450 Ga0163162_12271825
451 Ga0163162_12403245
452 Ga0157372_10018062
453 Ga0157372_11693440
454 Ga0157375_10011588
455 Ga0157375_12821968
456 Ga0163163_10001302
457 Ga0163163_11054123
458 Ga0163163_12355868
459 Ga0157380_10336034
460 Ga0157380_10848624
461 Ga0157379_10893564
462 Ga0182007_10102067
463 Ga0182007_10223642
464 Ga0207697_10027417
465 Ga0207656_10014993
466 Ga0207653_10000754
467 Ga0207710_10235190
468 Ga0207688_10905047
469 Ga0207680_10421667
470 Ga0207647_10175654
471 Ga0207643_10074973
472 Ga0207643_10089165
473 Ga0207643_11012419
474 Ga0207654_10241171
475 Ga0207654_10693681
476 Ga0207707_10000060
477 Ga0207707_10002592
478 Ga0207707_10386621
479 Ga0207671_10016699
480 Ga0207660_10003245
481 Ga0207660_10171761
482 Ga0207662_10208726
483 Ga0207657_10146725
484 Ga0207652_10000073
485 Ga0207652_10075930
486 Ga0207652_10169798
487 Ga0207646_10285493
488 Ga0207681_10388156
489 Ga0207694_10761997
490 Ga0207650_10000027
491 Ga0207650_10060108
492 Ga0207690_10000867
493 Ga0207690_10701559
494 Ga0207690_11035385
495 Ga0207686_10028976
496 Ga0207709_10002017
497 Ga0207709_10407323
498 Ga0207670_10198182
499 Ga0207665_10162125
500 Ga0207711_10060819
501 Ga0207689_10625294
502 Ga0207661_11034672
503 Ga0207679_10058198
504 Ga0207679_11009665
505 Ga0207667_10499267
506 Ga0207651_10082122
507 Ga0207640_10125934
508 Ga0207677_10074846
509 Ga0207703_10050186
510 Ga0207703_10491839
511 Ga0207703_10624241
512 Ga0207639_10023709
513 Ga0207708_10098586
514 Ga0207708_11654930
515 Ga0207648_10255705
516 Ga0207676_10027328
517 Ga0207674_10001414
518 Ga0207674_10137381
519 Ga0207674_10187719
520 Ga0207675_100020896
521 Ga0207675_100133156
522 Ga0207675_101174380
523 Ga0207428_10517602
524 Ga0268264_11381936
525 Ga0307513_10638991
526 Ga0307408_101903651
527 Ga0307408_102472137
528 Ga0307405_10074157
529 Ga0307413_10878618
530 Ga0307406_10477767
531 Ga0307406_10650275
532 Ga0307409_100243195
533 Ga0307414_10458013
534 Ga0373951_0101279
535 Ga0395898_0118961
536 Ga0395901_0508183
537 Ga0496104_0732826
538 Ga0496105_1323062
539 Ga0496107_0397529
540 Ga0496109_0703646
541 Ga0496112_0087001
542 Ga0496113_0527369
543 Ga0496113_0666884
544 Ga0501038_0001190
545 Ga0501217_024197
546 Ga0501227_014342
547 Ga0501230_096012
548 Ga0501233_257183
549 Ga0501235_013117
550 Ga0501236_012234
551 Ga0501257_106263
552 Ga0501234_020227
553 Ga0501245_048508
554 Ga0501271_035002
555 Ga0501272_052821
556 Ga0501212_007830
557 Ga0501226_006607
558 nmdc:mga05p37_1058566_c1
559 nmdc:mga05p37_1593613_c1
560 nmdc:mga05p37_454207_c1
561 nmdc:mga0qj67_150450_c1
562 nmdc:mga08y16_267304_c1
563 nmdc:mga0n895_158264_c1
564 nmdc:mga0rr50_155923_c1
565 nmdc:mga0rr50_46620_c1
566 nmdc:mga0rr50_486625_c1
567 nmdc:mga08x19_353996_c1
568 nmdc:mga0a205_1105328_c1
569 nmdc:mga0a205_234413_c1
570 nmdc:mga0a205_863989_c1
571 Ga0587084_078395
572 Ga0587085_022120

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map