F387304

General Info

Members Datasets Scaffolds Average Seq Length
286 193 572 91

Family's Representative Sequence

Representative Sequence 3300005535|Ga0070684_101582831|Ga0070684_1015828312
Length 108
Sequence MWFGGLYALDGDCFQTMTSESVTVVNQLGMHARAAAKFVHLATQFQAHVRVARDTREMDGKSIMGILLLAAARGTTIRITAEGADEQAAIDALSALVRSGFGEEACDA

Samples

Sample ID Description Type Environment
1 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
2 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
133 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
137 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
138 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
139 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
140 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
141 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
142 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
143 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
144 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
145 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
146 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
147 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
148 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
152 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
153 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
154 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
155 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
156 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
157 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
158 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
163 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
164 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
165 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
166 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
167 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
168 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
169 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
179 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
180 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
181 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
182 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
188 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
189 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
190 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
191 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
192 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
193 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.35
Nodule 0
Rhizoplane 1.4
Rhizosphere 97.55
Stem 0
Stem Tuber 0
Unclassified 12.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070684_101582831 3300005535 Bacteria 618
2 JGI24745J21846_1032983 3300002073 Bacteria 628
3 JGI25406J46586_10000183 3300003203 Bacteria 28210
4 Ga0065704_10156205 3300005289 Unclassified 1379
5 Ga0065712_10249034 3300005290 Unclassified 964
6 Ga0065715_10092547 3300005293 Bacteria 5063
7 Ga0065715_10471179 3300005293 Bacteria 806
8 Ga0065707_10344381 3300005295 Unclassified 928
9 Ga0070676_10029679 3300005328 Unclassified 3112
10 Ga0070690_100004177 3300005330 Bacteria 7993
11 Ga0070677_10000793 3300005333 Bacteria 10504
12 Ga0070666_10008328 3300005335 Bacteria 6431
13 Ga0070666_10024921 3300005335 Bacteria 3899
14 Ga0068868_100005052 3300005338 Bacteria 9262
15 Ga0070689_100426818 3300005340 Bacteria 1124
16 Ga0070687_100051532 3300005343 Bacteria 2131
17 Ga0070661_100002638 3300005344 Bacteria 12263
18 Ga0070668_100027423 3300005347 Bacteria 4324
19 Ga0070669_100009961 3300005353 Bacteria 6760
20 Ga0070675_101341402 3300005354 Bacteria 659
21 Ga0070671_100087756 3300005355 Bacteria 2603
22 Ga0070671_101382801 3300005355 Unclassified 622
23 Ga0070674_100000322 3300005356 Bacteria 23676
24 Ga0070674_101664413 3300005356 Bacteria 576
25 Ga0070673_100030988 3300005364 Bacteria 4009
26 Ga0070688_100001616 3300005365 Bacteria 11281
27 Ga0070659_100262560 3300005366 Bacteria 1433
28 Ga0070667_100009601 3300005367 Bacteria 8024
29 Ga0070703_10031052 3300005406 Unclassified 1613
30 Ga0070703_10624200 3300005406 Bacteria 500
31 Ga0070701_10011875 3300005438 Unclassified 3910
32 Ga0070711_100855553 3300005439 Bacteria 774
33 Ga0070705_100028204 3300005440 Bacteria 3073
34 Ga0070705_100347000 3300005440 Bacteria 1081
35 Ga0070694_101139689 3300005444 Bacteria 652
36 Ga0070678_100025256 3300005456 Unclassified 3994
37 Ga0070662_100010607 3300005457 Bacteria 6057
38 Ga0070662_100187385 3300005457 Bacteria 1634
39 Ga0068867_100038220 3300005459 Unclassified 3494
40 Ga0070685_10003911 3300005466 Bacteria 7528
41 Ga0070706_101118197 3300005467 Bacteria 725
42 Ga0070707_102126045 3300005468 Bacteria 529
43 Ga0070698_100066414 3300005471 Bacteria 3631
44 Ga0070684_100751967 3300005535 Bacteria 910
45 Ga0070672_100540191 3300005543 Bacteria 1011
46 Ga0070672_100699377 3300005543 Bacteria 888
47 Ga0070686_100006395 3300005544 Bacteria 6544
48 Ga0070686_100691049 3300005544 Bacteria 813
49 Ga0070696_100702031 3300005546 Bacteria 825
50 Ga0068855_100851596 3300005563 Bacteria 966
51 Ga0070664_100001625 3300005564 Bacteria 17973
52 Ga0068854_101548705 3300005578 Bacteria 603
53 Ga0070702_100419608 3300005615 Unclassified 962
54 Ga0068852_100082002 3300005616 Unclassified 2865
55 Ga0068859_100006053 3300005617 Bacteria 12283
56 Ga0068864_100042179 3300005618 Bacteria 3905
57 Ga0068861_100009099 3300005719 Bacteria 6847
58 Ga0068861_101353240 3300005719 Bacteria 694
59 Ga0068870_10000670 3300005840 Bacteria 13042
60 Ga0068863_100007754 3300005841 Bacteria 10496
61 Ga0068858_100025540 3300005842 Bacteria 5496
62 Ga0068860_100029423 3300005843 Bacteria 5283
63 Ga0068860_101008259 3300005843 Bacteria 851
64 Ga0068862_100001017 3300005844 Bacteria 26955
65 Ga0081539_10000460 3300005985 Bacteria 86291
66 Ga0081539_10347325 3300005985 Bacteria 624
67 Ga0075367_11117032 3300006178 Bacteria 504
68 Ga0097621_100102510 3300006237 Unclassified 2409
69 Ga0097621_100281095 3300006237 Bacteria 1465
70 Ga0068871_100046889 3300006358 Bacteria 3482
71 Ga0068871_101582463 3300006358 Archaea 620
72 Ga0075428_100187155 3300006844 Unclassified 2240
73 Ga0075428_100610061 3300006844 Bacteria 1165
74 Ga0075430_100000482 3300006846 Bacteria 29804
75 Ga0075430_100105707 3300006846 Bacteria 2349
76 Ga0075430_101505381 3300006846 Bacteria 553
77 Ga0075431_100001333 3300006847 Bacteria 22547
78 Ga0075431_100130080 3300006847 Bacteria 2597
79 Ga0075431_101225171 3300006847 Bacteria 713
80 Ga0075433_10000018 3300006852 Bacteria 63744
81 Ga0075433_10015027 3300006852 Bacteria 6337
82 Ga0075433_10081089 3300006852 Bacteria 2860
83 Ga0075433_10248614 3300006852 Bacteria 1578
84 Ga0075434_100002887 3300006871 Bacteria 15253
85 Ga0075434_100019291 3300006871 Bacteria 6598
86 Ga0075434_101956177 3300006871 Bacteria 592
87 Ga0075429_100006894 3300006880 Bacteria 9866
88 Ga0075429_100040903 3300006880 Unclassified 4036
89 Ga0075429_100070189 3300006880 Bacteria 3050
90 Ga0068865_100033644 3300006881 Bacteria 3432
91 Ga0068865_101434517 3300006881 Bacteria 617
92 Ga0075436_100010831 3300006914 Bacteria 6255
93 Ga0075436_100435800 3300006914 Bacteria 953
94 Ga0075436_100569351 3300006914 Bacteria 833
95 Ga0097620_100006054 3300006931 Bacteria 12283
96 Ga0075435_100000469 3300007076 Bacteria 24538
97 Ga0075435_100008965 3300007076 Bacteria 7212
98 Ga0075435_100154268 3300007076 Unclassified 1932
99 Ga0105244_10332618 3300009036 Bacteria 701
100 Ga0105240_10015340 3300009093 Bacteria 10423
101 Ga0105240_12088555 3300009093 Bacteria 588
102 Ga0105240_12612648 3300009093 Bacteria 522
103 Ga0111539_10003665 3300009094 Bacteria 20230
104 Ga0111539_10056572 3300009094 Bacteria 4661
105 Ga0111539_10136635 3300009094 Bacteria 2871
106 Ga0111539_10207807 3300009094 Bacteria 2281
107 Ga0111539_10795403 3300009094 Bacteria 1101
108 Ga0111539_10840938 3300009094 Unclassified 1068
109 Ga0111539_11282744 3300009094 Bacteria 850
110 Ga0111539_12163685 3300009094 Bacteria 645
111 Ga0105245_10454060 3300009098 Bacteria 1290
112 Ga0105247_10184559 3300009101 Unclassified 1394
113 Ga0114129_10002052 3300009147 Bacteria 27655
114 Ga0114129_10133699 3300009147 Bacteria 3405
115 Ga0114129_10157063 3300009147 Bacteria 3109
116 Ga0114129_10597677 3300009147 Bacteria 1430
117 Ga0114129_12458154 3300009147 Bacteria 623
118 Ga0114129_12637659 3300009147 Unclassified 599
119 Ga0105241_12430739 3300009174 Bacteria 523
120 Ga0105242_10136062 3300009176 Bacteria 2126
121 Ga0105242_11321132 3300009176 Bacteria 746
122 Ga0105248_10050628 3300009177 Bacteria 4659
123 Ga0105248_10275601 3300009177 Bacteria 1894
124 Ga0105248_10313175 3300009177 Bacteria 1768
125 Ga0105248_10412271 3300009177 Unclassified 1521
126 Ga0105238_10757191 3300009551 Bacteria 985
127 Ga0105249_10001377 3300009553 Bacteria 21263
128 Ga0105249_10637040 3300009553 Bacteria 1123
129 Ga0105246_10014380 3300011119 Bacteria 4977
130 Ga0157327_1008409 3300012512 Bacteria 924
131 Ga0157374_10370785 3300013296 Bacteria 1425
132 Ga0163162_10243874 3300013306 Unclassified 1928
133 Ga0163162_11044125 3300013306 Bacteria 925
134 Ga0157375_10029208 3300013308 Bacteria 5182
135 Ga0157375_10101189 3300013308 Bacteria 2964
136 Ga0157375_11080018 3300013308 Bacteria 939
137 Ga0163163_10193421 3300014325 Bacteria 2082
138 Ga0157380_10006111 3300014326 Bacteria 8440
139 Ga0157380_10014072 3300014326 Bacteria 5847
140 Ga0157380_10132891 3300014326 Bacteria 2126
141 Ga0157380_10424756 3300014326 Bacteria 1269
142 Ga0157380_11561374 3300014326 Bacteria 715
143 Ga0157380_12249568 3300014326 Bacteria 609
144 Ga0157377_10000837 3300014745 Bacteria 12750
145 Ga0157377_10131752 3300014745 Bacteria 1528
146 Ga0157379_10010081 3300014968 Bacteria 8238
147 Ga0157379_10506052 3300014968 Bacteria 1120
148 Ga0157376_10996258 3300014969 Bacteria 860
149 Ga0163161_10012329 3300017792 Bacteria 5933
150 Ga0207697_10064738 3300025315 Bacteria 1525
151 Ga0207653_10096310 3300025885 Unclassified 1042
152 Ga0207682_10000597 3300025893 Bacteria 16772
153 Ga0207642_10718992 3300025899 Bacteria 630
154 Ga0207680_10011485 3300025903 Bacteria 4478
155 Ga0207645_10599840 3300025907 Bacteria 748
156 Ga0207695_10015166 3300025913 Bacteria 9086
157 Ga0207695_10790132 3300025913 Bacteria 829
158 Ga0207660_10059162 3300025917 Bacteria 2750
159 Ga0207662_10003673 3300025918 Bacteria 7950
160 Ga0207662_10092363 3300025918 Bacteria 1863
161 Ga0207662_10481076 3300025918 Bacteria 853
162 Ga0207646_11569448 3300025922 Bacteria 568
163 Ga0207694_10544754 3300025924 Bacteria 973
164 Ga0207650_10281251 3300025925 Bacteria 1355
165 Ga0207659_10120178 3300025926 Bacteria 2012
166 Ga0207644_10064881 3300025931 Bacteria 2654
167 Ga0207706_10001498 3300025933 Bacteria 23176
168 Ga0207706_10359575 3300025933 Bacteria 1265
169 Ga0207670_10141740 3300025936 Unclassified 1773
170 Ga0207669_10002942 3300025937 Bacteria 7315
171 Ga0207669_10586071 3300025937 Bacteria 904
172 Ga0207704_10582059 3300025938 Bacteria 914
173 Ga0207691_10032346 3300025940 Bacteria 4878
174 Ga0207711_10292855 3300025941 Unclassified 1500
175 Ga0207689_10003239 3300025942 Bacteria 14911
176 Ga0207651_10057033 3300025960 Bacteria 2691
177 Ga0207651_10069523 3300025960 Unclassified 2486
178 Ga0207712_10180014 3300025961 Bacteria 1659
179 Ga0207668_10051871 3300025972 Unclassified 2836
180 Ga0207640_11280389 3300025981 Bacteria 654
181 Ga0207658_10024720 3300025986 Unclassified 4203
182 Ga0207677_11796581 3300026023 Bacteria 569
183 Ga0207703_10354793 3300026035 Unclassified 1351
184 Ga0207678_10026036 3300026067 Bacteria 5104
185 Ga0207678_10244089 3300026067 Bacteria 1538
186 Ga0207708_10080180 3300026075 Bacteria 2508
187 Ga0207641_10043017 3300026088 Bacteria 3791
188 Ga0207648_10051031 3300026089 Unclassified 3616
189 Ga0207648_10174106 3300026089 Bacteria 1903
190 Ga0207648_10396921 3300026089 Bacteria 1249
191 Ga0207676_10160287 3300026095 Bacteria 1948
192 Ga0207675_100007659 3300026118 Bacteria 10197
193 Ga0207675_100224132 3300026118 Bacteria 1812
194 Ga0207675_102221956 3300026118 Bacteria 563
195 Ga0207683_10017042 3300026121 Bacteria 6184
196 Ga0209970_1071780 3300027614 Bacteria 644
197 Ga0209983_1073085 3300027665 Bacteria 765
198 Ga0209974_10030757 3300027876 Unclassified 1778
199 Ga0207428_10424974 3300027907 Bacteria 971
200 Ga0268265_10006744 3300028380 Bacteria 7769
201 Ga0268265_10295251 3300028380 Bacteria 1457
202 Ga0268264_11347661 3300028381 Bacteria 724
203 Ga0265327_10016649 3300031251 Unclassified 4657
204 Ga0265327_10036020 3300031251 Bacteria 2726
205 Ga0307408_100157957 3300031548 Bacteria 1798
206 Ga0316576_10645174 3300031727 Bacteria 770
207 Ga0316578_10078967 3300031728 Bacteria 1956
208 Ga0307416_100187740 3300032002 Bacteria 1945
209 Ga0307416_102077937 3300032002 Unclassified 670
210 Ga0307411_10738327 3300032005 Bacteria 861
211 Ga0373930_0004092 3300034816 Bacteria 2353
212 Ga0373958_0003231 3300034819 Bacteria 2338
213 Ga0373959_0006928 3300034820 Bacteria 1896
214 Ga0373938_0009584 3300034957 Bacteria 1759
215 Ga0373928_0042828 3300035084 Bacteria 1045
216 Ga0373940_0003495 3300035088 Bacteria 3215
217 Ga0373949_0004426 3300035090 Bacteria 3223
218 Ga0373932_0000219 3300035112 Bacteria 16992
219 Ga0373939_0001555 3300035114 Bacteria 5573
220 Ga0373941_0000159 3300035115 Bacteria 12239
221 Ga0373942_0000994 3300035207 Bacteria 7710
222 Ga0373961_0002956 3300035241 Bacteria 4296
223 Ga0373962_0001234 3300035242 Bacteria 5992
224 Ga0373931_0011691 3300035691 Bacteria 4241
225 Ga0395900_0936600 3300037418 Unclassified 788
226 Ga0400490_45057 3300038726 Bacteria 2552
227 Ga0400483_056512 3300039062 Bacteria 1387
228 Ga0439431_0065490 3300041997 Bacteria 962
229 Ga0450911_030881 3300042115 Bacteria 695
230 Ga0439446_0255234 3300042156 Bacteria 606
231 Ga0439435_0137903 3300042436 Bacteria 775
232 Ga0451577_0259378 3300042876 Bacteria 1574
233 Ga0453683_0000138 3300044673 Bacteria 105792
234 Ga0453683_0185235 3300044673 Bacteria 1321
235 Ga0453683_1100727 3300044673 Bacteria 530
236 Ga0453684_0163785 3300044712 Unclassified 2627
237 Ga0451576_0045540 3300045051 Bacteria 4619
238 Ga0451576_0124367 3300045051 Bacteria 2687
239 Ga0451576_0145973 3300045051 Bacteria 2467
240 Ga0451576_2012036 3300045051 Bacteria 595
241 Ga0451576_2097259 3300045051 Bacteria 581
242 Ga0495580_0519113 3300046472 Unclassified 794
243 Ga0495662_0174377 3300046476 Bacteria 1059
244 Ga0495598_0005819 3300046537 Bacteria 2755
245 Ga0495621_0057892 3300046539 Bacteria 1400
246 Ga0495656_0022159 3300046615 Bacteria 2484
247 Ga0495659_0262239 3300046664 Bacteria 722
248 Ga0495669_0060301 3300046684 Bacteria 1715
249 Ga0495670_0165013 3300046691 Bacteria 1165
250 Ga0495636_0163489 3300047318 Bacteria 1004
251 Ga0496105_0729057 3300048908 Bacteria 759
252 Ga0496106_0164231 3300048909 Bacteria 1757
253 Ga0496107_0479502 3300048910 Bacteria 923
254 Ga0496114_0949780 3300048917 Bacteria 742
255 Ga0501040_0153621 3300049576 Bacteria 1625
256 Ga0501040_0395119 3300049576 Bacteria 993
257 Ga0501041_0583350 3300049577 Bacteria 713
258 Ga0501047_0898751 3300049581 Bacteria 699
259 Ga0501048_0159163 3300049582 Bacteria 1598
260 Ga0501071_0487294 3300049587 Bacteria 945
261 Ga0501072_0479499 3300049588 Unclassified 984
262 Ga0501075_0841065 3300049591 Bacteria 698
263 Ga0501076_0651505 3300049592 Bacteria 869
264 Ga0501076_1250564 3300049592 Bacteria 611
265 Ga0501081_0824535 3300049743 Bacteria 698
266 nmdc:mga05p37_10218_c1 3300050507 Bacteria 9446
267 nmdc:mga05p37_24935_c1 3300050507 Bacteria 7269
268 nmdc:mga05p37_585324_c1 3300050507 Bacteria 1263
269 nmdc:mga09592_524389_c1 3300050508 Bacteria 1019
270 nmdc:mga06r32_1060182_c1 3300050510 Bacteria 761
271 nmdc:mga06r32_446088_c1 3300050510 Bacteria 1274
272 nmdc:mga08y16_391412_c1 3300050511 Bacteria 1424
273 nmdc:mga0n895_13581_c1 3300050512 Bacteria 7357
274 nmdc:mga0n895_471770_c1 3300050512 Bacteria 1266
275 nmdc:mga0rr50_15027_c1 3300050513 Bacteria 5100
276 nmdc:mga0rr50_21540_c1 3300050513 Bacteria 4403
277 nmdc:mga0rr50_26553_c1 3300050513 Bacteria 4042
278 nmdc:mga0rr50_3289_c1 3300050513 Bacteria 9278
279 nmdc:mga08x19_10454_c1 3300050514 Bacteria 5573
280 nmdc:mga08x19_88472_c1 3300050514 Bacteria 2041
281 nmdc:mga0a205_14717_c1 3300050515 Bacteria 7299
282 nmdc:mga0a205_35160_c1 3300050515 Bacteria 4811
283 nmdc:mga0a205_42944_c1 3300050515 Bacteria 4358
284 Ga0501084_0491637 3300054114 Bacteria 1037
285 Ga0590071_034829 3300059421 Unclassified 1205
286 Ga0501082_0182184 3300060353 Bacteria 1827
287 Ga0070684_101582831
288 JGI24745J21846_1032983
289 JGI25406J46586_10000183
290 Ga0065704_10156205
291 Ga0065712_10249034
292 Ga0065715_10092547
293 Ga0065715_10471179
294 Ga0065707_10344381
295 Ga0070676_10029679
296 Ga0070690_100004177
297 Ga0070677_10000793
298 Ga0070666_10008328
299 Ga0070666_10024921
300 Ga0068868_100005052
301 Ga0070689_100426818
302 Ga0070687_100051532
303 Ga0070661_100002638
304 Ga0070668_100027423
305 Ga0070669_100009961
306 Ga0070675_101341402
307 Ga0070671_100087756
308 Ga0070671_101382801
309 Ga0070674_100000322
310 Ga0070674_101664413
311 Ga0070673_100030988
312 Ga0070688_100001616
313 Ga0070659_100262560
314 Ga0070667_100009601
315 Ga0070703_10031052
316 Ga0070703_10624200
317 Ga0070701_10011875
318 Ga0070711_100855553
319 Ga0070705_100028204
320 Ga0070705_100347000
321 Ga0070694_101139689
322 Ga0070678_100025256
323 Ga0070662_100010607
324 Ga0070662_100187385
325 Ga0068867_100038220
326 Ga0070685_10003911
327 Ga0070706_101118197
328 Ga0070707_102126045
329 Ga0070698_100066414
330 Ga0070684_100751967
331 Ga0070672_100540191
332 Ga0070672_100699377
333 Ga0070686_100006395
334 Ga0070686_100691049
335 Ga0070696_100702031
336 Ga0068855_100851596
337 Ga0070664_100001625
338 Ga0068854_101548705
339 Ga0070702_100419608
340 Ga0068852_100082002
341 Ga0068859_100006053
342 Ga0068864_100042179
343 Ga0068861_100009099
344 Ga0068861_101353240
345 Ga0068870_10000670
346 Ga0068863_100007754
347 Ga0068858_100025540
348 Ga0068860_100029423
349 Ga0068860_101008259
350 Ga0068862_100001017
351 Ga0081539_10000460
352 Ga0081539_10347325
353 Ga0075367_11117032
354 Ga0097621_100102510
355 Ga0097621_100281095
356 Ga0068871_100046889
357 Ga0068871_101582463
358 Ga0075428_100187155
359 Ga0075428_100610061
360 Ga0075430_100000482
361 Ga0075430_100105707
362 Ga0075430_101505381
363 Ga0075431_100001333
364 Ga0075431_100130080
365 Ga0075431_101225171
366 Ga0075433_10000018
367 Ga0075433_10015027
368 Ga0075433_10081089
369 Ga0075433_10248614
370 Ga0075434_100002887
371 Ga0075434_100019291
372 Ga0075434_101956177
373 Ga0075429_100006894
374 Ga0075429_100040903
375 Ga0075429_100070189
376 Ga0068865_100033644
377 Ga0068865_101434517
378 Ga0075436_100010831
379 Ga0075436_100435800
380 Ga0075436_100569351
381 Ga0097620_100006054
382 Ga0075435_100000469
383 Ga0075435_100008965
384 Ga0075435_100154268
385 Ga0105244_10332618
386 Ga0105240_10015340
387 Ga0105240_12088555
388 Ga0105240_12612648
389 Ga0111539_10003665
390 Ga0111539_10056572
391 Ga0111539_10136635
392 Ga0111539_10207807
393 Ga0111539_10795403
394 Ga0111539_10840938
395 Ga0111539_11282744
396 Ga0111539_12163685
397 Ga0105245_10454060
398 Ga0105247_10184559
399 Ga0114129_10002052
400 Ga0114129_10133699
401 Ga0114129_10157063
402 Ga0114129_10597677
403 Ga0114129_12458154
404 Ga0114129_12637659
405 Ga0105241_12430739
406 Ga0105242_10136062
407 Ga0105242_11321132
408 Ga0105248_10050628
409 Ga0105248_10275601
410 Ga0105248_10313175
411 Ga0105248_10412271
412 Ga0105238_10757191
413 Ga0105249_10001377
414 Ga0105249_10637040
415 Ga0105246_10014380
416 Ga0157327_1008409
417 Ga0157374_10370785
418 Ga0163162_10243874
419 Ga0163162_11044125
420 Ga0157375_10029208
421 Ga0157375_10101189
422 Ga0157375_11080018
423 Ga0163163_10193421
424 Ga0157380_10006111
425 Ga0157380_10014072
426 Ga0157380_10132891
427 Ga0157380_10424756
428 Ga0157380_11561374
429 Ga0157380_12249568
430 Ga0157377_10000837
431 Ga0157377_10131752
432 Ga0157379_10010081
433 Ga0157379_10506052
434 Ga0157376_10996258
435 Ga0163161_10012329
436 Ga0207697_10064738
437 Ga0207653_10096310
438 Ga0207682_10000597
439 Ga0207642_10718992
440 Ga0207680_10011485
441 Ga0207645_10599840
442 Ga0207695_10015166
443 Ga0207695_10790132
444 Ga0207660_10059162
445 Ga0207662_10003673
446 Ga0207662_10092363
447 Ga0207662_10481076
448 Ga0207646_11569448
449 Ga0207694_10544754
450 Ga0207650_10281251
451 Ga0207659_10120178
452 Ga0207644_10064881
453 Ga0207706_10001498
454 Ga0207706_10359575
455 Ga0207670_10141740
456 Ga0207669_10002942
457 Ga0207669_10586071
458 Ga0207704_10582059
459 Ga0207691_10032346
460 Ga0207711_10292855
461 Ga0207689_10003239
462 Ga0207651_10057033
463 Ga0207651_10069523
464 Ga0207712_10180014
465 Ga0207668_10051871
466 Ga0207640_11280389
467 Ga0207658_10024720
468 Ga0207677_11796581
469 Ga0207703_10354793
470 Ga0207678_10026036
471 Ga0207678_10244089
472 Ga0207708_10080180
473 Ga0207641_10043017
474 Ga0207648_10051031
475 Ga0207648_10174106
476 Ga0207648_10396921
477 Ga0207676_10160287
478 Ga0207675_100007659
479 Ga0207675_100224132
480 Ga0207675_102221956
481 Ga0207683_10017042
482 Ga0209970_1071780
483 Ga0209983_1073085
484 Ga0209974_10030757
485 Ga0207428_10424974
486 Ga0268265_10006744
487 Ga0268265_10295251
488 Ga0268264_11347661
489 Ga0265327_10016649
490 Ga0265327_10036020
491 Ga0307408_100157957
492 Ga0316576_10645174
493 Ga0316578_10078967
494 Ga0307416_100187740
495 Ga0307416_102077937
496 Ga0307411_10738327
497 Ga0373930_0004092
498 Ga0373958_0003231
499 Ga0373959_0006928
500 Ga0373938_0009584
501 Ga0373928_0042828
502 Ga0373940_0003495
503 Ga0373949_0004426
504 Ga0373932_0000219
505 Ga0373939_0001555
506 Ga0373941_0000159
507 Ga0373942_0000994
508 Ga0373961_0002956
509 Ga0373962_0001234
510 Ga0373931_0011691
511 Ga0395900_0936600
512 Ga0400490_45057
513 Ga0400483_056512
514 Ga0439431_0065490
515 Ga0450911_030881
516 Ga0439446_0255234
517 Ga0439435_0137903
518 Ga0451577_0259378
519 Ga0453683_0000138
520 Ga0453683_0185235
521 Ga0453683_1100727
522 Ga0453684_0163785
523 Ga0451576_0045540
524 Ga0451576_0124367
525 Ga0451576_0145973
526 Ga0451576_2012036
527 Ga0451576_2097259
528 Ga0495580_0519113
529 Ga0495662_0174377
530 Ga0495598_0005819
531 Ga0495621_0057892
532 Ga0495656_0022159
533 Ga0495659_0262239
534 Ga0495669_0060301
535 Ga0495670_0165013
536 Ga0495636_0163489
537 Ga0496105_0729057
538 Ga0496106_0164231
539 Ga0496107_0479502
540 Ga0496114_0949780
541 Ga0501040_0153621
542 Ga0501040_0395119
543 Ga0501041_0583350
544 Ga0501047_0898751
545 Ga0501048_0159163
546 Ga0501071_0487294
547 Ga0501072_0479499
548 Ga0501075_0841065
549 Ga0501076_0651505
550 Ga0501076_1250564
551 Ga0501081_0824535
552 nmdc:mga05p37_10218_c1
553 nmdc:mga05p37_24935_c1
554 nmdc:mga05p37_585324_c1
555 nmdc:mga09592_524389_c1
556 nmdc:mga06r32_1060182_c1
557 nmdc:mga06r32_446088_c1
558 nmdc:mga08y16_391412_c1
559 nmdc:mga0n895_13581_c1
560 nmdc:mga0n895_471770_c1
561 nmdc:mga0rr50_15027_c1
562 nmdc:mga0rr50_21540_c1
563 nmdc:mga0rr50_26553_c1
564 nmdc:mga0rr50_3289_c1
565 nmdc:mga08x19_10454_c1
566 nmdc:mga08x19_88472_c1
567 nmdc:mga0a205_14717_c1
568 nmdc:mga0a205_35160_c1
569 nmdc:mga0a205_42944_c1
570 Ga0501084_0491637
571 Ga0590071_034829
572 Ga0501082_0182184

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00381

PTS-HPr

PTS HPr component phosphorylation site

18

99

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ccd-assembly1.cif.gz_A 1.0 a structure of post-succinimide his15asp hpr 0.9838 1 81
5ya0-assembly1.cif.gz_C crystal structure of lsrk and hpr complex 0.9826 1 83
1opd-assembly1.cif.gz_A histidine-containing protein (hpr), mutant with ser 46 replaced by asp (s46d) 0.9816 1 82
4xwj-assembly1.cif.gz_B histidine-containing phosphocarrier protein (hpr) and antisigma factor rsd complex 0.9789 1 81
7ff5-assembly3.cif.gz_C the crystal structure of ruminiclostridium cellulolyticum phosphocarrier 0.9765 1 81
ID Description Score Start End Superfamily
3ccdB00 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9784 1 83 3.30.1340.10
3ihsB00 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9675 2 81 3.30.1340.10
af_P69811_287_371_3.30.1340.10 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9669 4 84 3.30.1340.10
af_P37349_156_242_3.30.1340.10 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9662 2 87 3.30.1340.10
3ccdB00 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9449 1 83 3.30.1340.10
ID Description Score Start End GO Terms
AF-A0A485M606-F1-model_v4 Phosphocarrier protein HPr 1 2 87 GO:0005737
GO:0009401
AF-A0A2D5UEY2-F1-model_v4 Phosphocarrier protein HPr 0.9996 1 87 GO:0005737
GO:0009401
AF-A0A518BW11-F1-model_v4 HPr-like protein Crh 0.9993 2 87 GO:0005737
GO:0009401
AF-A0A645DJH7-F1-model_v4 HPr-like protein Crh 0.9992 1 82 GO:0005737
GO:0009401
AF-A0A7X4EEC6-F1-model_v4 HPr family phosphocarrier protein 0.9991 2 87

Map