F387246

General Info

Members Datasets Scaffolds Average Seq Length
286 210 572 108

Family's Representative Sequence

Representative Sequence 3300005365|Ga0070688_100819022|Ga0070688_1008190221
Length 126
Sequence LTPFEFPATFFKQGSFNHHVSITDRFAAIRKGLLEYLILRIVSADKVYVADILQRLSGTEFATQEGTLYPLLSKMRRDGLVDYEWQESDSGPPRKYYRLTAKGKSQLTELNEYWKDINATISQLGR

Samples

Sample ID Description Type Environment
1 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
109 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
110 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
112 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
113 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
115 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
116 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
121 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
122 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
123 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
124 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
125 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
126 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
127 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
128 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
129 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
130 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
131 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
132 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
133 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
134 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
135 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
136 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
137 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
138 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
139 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
140 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
141 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
142 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
143 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
144 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
145 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
146 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
147 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
148 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
149 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
150 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
151 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
152 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
153 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
154 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
155 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
156 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
157 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
179 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
180 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
181 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
182 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
183 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
184 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
185 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
186 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
187 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
191 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
197 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
201 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
202 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
203 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
204 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
205 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
206 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
207 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
210 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.75
Nodule 0
Rhizoplane 3.15
Rhizosphere 95.1
Stem 0
Stem Tuber 0
Unclassified 32.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070688_100819022 3300005365 Unclassified 729
2 SwRhRL2b_contig_2997981 2162886007 Bacteria 4760
3 2214741041 2209111006 Unclassified 504
4 JGI25406J46586_10190573 3300003203 Bacteria 598
5 Ga0065704_10074757 3300005289 Bacteria 6037
6 Ga0065712_10090394 3300005290 Bacteria 2423
7 Ga0065715_10360866 3300005293 Unclassified 922
8 Ga0065707_10067371 3300005295 Unclassified 573
9 Ga0065707_10731376 3300005295 Unclassified 626
10 Ga0065707_10750444 3300005295 Bacteria 618
11 Ga0070658_10253833 3300005327 Bacteria 1492
12 Ga0070670_100007084 3300005331 Bacteria 9494
13 Ga0070670_100039634 3300005331 Bacteria 4051
14 Ga0070682_101540161 3300005337 Unclassified 573
15 Ga0068868_100105707 3300005338 Bacteria 2283
16 Ga0070660_101546980 3300005339 Unclassified 564
17 Ga0070689_100100911 3300005340 Unclassified 2284
18 Ga0070689_101330878 3300005340 Bacteria 647
19 Ga0070661_100169566 3300005344 Unclassified 1657
20 Ga0070668_100934179 3300005347 Bacteria 777
21 Ga0070669_100084189 3300005353 Bacteria 2372
22 Ga0070675_100751729 3300005354 Bacteria 890
23 Ga0070673_100249336 3300005364 Bacteria 1547
24 Ga0070688_100161499 3300005365 Unclassified 1540
25 Ga0070659_100131486 3300005366 Bacteria 2033
26 Ga0070667_100388793 3300005367 Unclassified 1268
27 Ga0070703_10535480 3300005406 Unclassified 532
28 Ga0070709_11080550 3300005434 Bacteria 641
29 Ga0070710_10241157 3300005437 Bacteria 1158
30 Ga0070701_10505907 3300005438 Bacteria 785
31 Ga0070705_101455631 3300005440 Unclassified 572
32 Ga0070663_101092057 3300005455 Bacteria 697
33 Ga0070678_100704486 3300005456 Bacteria 910
34 Ga0070662_100969490 3300005457 Bacteria 727
35 Ga0070662_101152964 3300005457 Bacteria 666
36 Ga0070662_101164850 3300005457 Bacteria 662
37 Ga0070707_102140275 3300005468 Unclassified 527
38 Ga0070699_100039477 3300005518 Bacteria 4087
39 Ga0070679_100587873 3300005530 Unclassified 1057
40 Ga0070679_100690825 3300005530 Unclassified 963
41 Ga0070672_100037414 3300005543 Bacteria 3702
42 Ga0070686_100075983 3300005544 Bacteria 2211
43 Ga0070695_100890320 3300005545 Bacteria 718
44 Ga0070665_100108380 3300005548 Unclassified 2780
45 Ga0070665_100109540 3300005548 Bacteria 2764
46 Ga0070704_101699847 3300005549 Unclassified 583
47 Ga0068855_100008875 3300005563 Bacteria 12151
48 Ga0068855_100208754 3300005563 Bacteria 2196
49 Ga0068855_100240297 3300005563 Unclassified 2024
50 Ga0070664_100061489 3300005564 Unclassified 3201
51 Ga0070664_100583209 3300005564 Bacteria 1036
52 Ga0070664_102013335 3300005564 Bacteria 548
53 Ga0070664_102337545 3300005564 Unclassified 507
54 Ga0068857_100176195 3300005577 Unclassified 1945
55 Ga0068856_101431965 3300005614 Bacteria 705
56 Ga0068852_101822573 3300005616 Bacteria 631
57 Ga0068859_100096258 3300005617 Unclassified 3013
58 Ga0068859_100408123 3300005617 Unclassified 1454
59 Ga0068864_100088921 3300005618 Unclassified 2721
60 Ga0068863_100716290 3300005841 Bacteria 995
61 Ga0068862_100826211 3300005844 Bacteria 906
62 Ga0068862_101041814 3300005844 Bacteria 811
63 Ga0081539_10031516 3300005985 Bacteria 3265
64 Ga0075431_100400471 3300006847 Unclassified 1374
65 Ga0075433_10214008 3300006852 Unclassified 1712
66 Ga0075433_10332998 3300006852 Unclassified 1342
67 Ga0075434_100011966 3300006871 Bacteria 8208
68 Ga0075434_101538552 3300006871 Unclassified 674
69 Ga0075434_102371539 3300006871 Bacteria 533
70 Ga0075429_100316300 3300006880 Bacteria 1366
71 Ga0075429_100949556 3300006880 Bacteria 752
72 Ga0097620_100096256 3300006931 Unclassified 3013
73 Ga0097620_100408116 3300006931 Unclassified 1454
74 Ga0105240_10010706 3300009093 Bacteria 12871
75 Ga0105240_10760048 3300009093 Unclassified 1053
76 Ga0111539_10020607 3300009094 Bacteria 8120
77 Ga0111539_12835645 3300009094 Bacteria 561
78 Ga0105245_11890406 3300009098 Unclassified 650
79 Ga0114129_10113984 3300009147 Bacteria 3727
80 Ga0114129_10160129 3300009147 Bacteria 3075
81 Ga0105241_10719641 3300009174 Bacteria 913
82 Ga0105242_12249707 3300009176 Unclassified 591
83 Ga0105248_10826076 3300009177 Bacteria 1046
84 Ga0105248_10886440 3300009177 Unclassified 1007
85 Ga0105237_10086286 3300009545 Bacteria 3129
86 Ga0105238_10140005 3300009551 Bacteria 2396
87 Ga0105238_10176975 3300009551 Bacteria 2110
88 Ga0105238_10472805 3300009551 Unclassified 1252
89 Ga0105238_11369511 3300009551 Archaea 734
90 Ga0105249_10515012 3300009553 Unclassified 1243
91 Ga0105249_11657373 3300009553 Bacteria 712
92 Ga0105239_11068519 3300010375 Unclassified 929
93 Ga0105246_10892262 3300011119 Bacteria 797
94 Ga0105246_10925163 3300011119 Bacteria 784
95 Ga0157369_11253328 3300013105 Bacteria 756
96 Ga0157374_10083415 3300013296 Bacteria 3036
97 Ga0157374_10937670 3300013296 Unclassified 884
98 Ga0157372_10381826 3300013307 Bacteria 1641
99 Ga0157372_11373006 3300013307 Bacteria 815
100 Ga0157375_10762172 3300013308 Unclassified 1118
101 Ga0157375_13189926 3300013308 Unclassified 547
102 Ga0163163_10059585 3300014325 Unclassified 3777
103 Ga0163163_12076965 3300014325 Unclassified 628
104 Ga0157380_10135731 3300014326 Unclassified 2105
105 Ga0157380_10273974 3300014326 Bacteria 1540
106 Ga0157377_11588624 3300014745 Bacteria 523
107 Ga0157379_10176446 3300014968 Bacteria 1929
108 Ga0157379_10582317 3300014968 Unclassified 1043
109 Ga0157376_10998370 3300014969 Bacteria 859
110 Ga0207680_10496773 3300025903 Bacteria 869
111 Ga0207699_10157224 3300025906 Bacteria 1510
112 Ga0207643_10860320 3300025908 Bacteria 588
113 Ga0207654_11045462 3300025911 Unclassified 594
114 Ga0207695_10114300 3300025913 Bacteria 2675
115 Ga0207671_10061610 3300025914 Bacteria 2784
116 Ga0207662_10121627 3300025918 Unclassified 1638
117 Ga0207657_10590407 3300025919 Bacteria 867
118 Ga0207681_10473889 3300025923 Bacteria 1021
119 Ga0207694_10212157 3300025924 Bacteria 1577
120 Ga0207694_10638875 3300025924 Bacteria 896
121 Ga0207650_10027927 3300025925 Bacteria 4042
122 Ga0207659_10358903 3300025926 Unclassified 1211
123 Ga0207690_11601563 3300025932 Bacteria 544
124 Ga0207706_10063122 3300025933 Bacteria 3262
125 Ga0207670_10665425 3300025936 Unclassified 860
126 Ga0207670_10895725 3300025936 Unclassified 743
127 Ga0207691_10193357 3300025940 Unclassified 1774
128 Ga0207711_11218496 3300025941 Unclassified 694
129 Ga0207679_11665968 3300025945 Unclassified 584
130 Ga0207667_10003985 3300025949 Bacteria 18151
131 Ga0207667_11388168 3300025949 Bacteria 676
132 Ga0207712_10415739 3300025961 Bacteria 1133
133 Ga0207712_10736690 3300025961 Bacteria 863
134 Ga0207640_11170596 3300025981 Unclassified 682
135 Ga0207658_10112691 3300025986 Bacteria 2153
136 Ga0207703_10004861 3300026035 Bacteria 10936
137 Ga0207702_12111595 3300026078 Bacteria 553
138 Ga0207641_11500037 3300026088 Bacteria 676
139 Ga0207648_10734331 3300026089 Bacteria 916
140 Ga0207676_10075448 3300026095 Unclassified 2720
141 Ga0207676_11281579 3300026095 Bacteria 727
142 Ga0207674_10519730 3300026116 Bacteria 1150
143 Ga0207674_11690750 3300026116 Bacteria 601
144 Ga0207683_10884220 3300026121 Unclassified 830
145 Ga0209999_1038799 3300027543 Bacteria 891
146 Ga0209970_1082216 3300027614 Unclassified 606
147 Ga0268266_10041329 3300028379 Bacteria 3934
148 Ga0268266_10049786 3300028379 Unclassified 3594
149 Ga0268265_10013907 3300028380 Bacteria 5478
150 Ga0268265_10450225 3300028380 Unclassified 1202
151 Ga0268264_11124740 3300028381 Bacteria 794
152 Ga0265316_10736084 3300031344 Bacteria 694
153 Ga0316576_10646903 3300031727 Bacteria 769
154 Ga0373923_0154456 3300035111 Unclassified 1044
155 Ga0316574_0063830 3300035398 Bacteria 2317
156 Ga0373931_0443933 3300035691 Bacteria 829
157 Ga0373935_0833052 3300035692 Unclassified 682
158 Ga0373927_0047864 3300035695 Unclassified 2766
159 Ga0373933_0821969 3300035724 Bacteria 612
160 Ga0373947_0070052 3300035725 Unclassified 2148
161 Ga0373937_0336146 3300036401 Unclassified 1430
162 Ga0373937_0557250 3300036401 Bacteria 1089
163 Ga0316584_0735709 3300036712 Bacteria 674
164 Ga0373925_0016822 3300037068 Bacteria 5296
165 Ga0451807_1204658 3300041486 Bacteria 757
166 Ga0439431_0094486 3300041997 Bacteria 817
167 Ga0439433_0033852 3300041999 Bacteria 1175
168 Ga0439442_057791 3300042002 Bacteria 821
169 Ga0439445_0118214 3300042004 Unclassified 760
170 Ga0439449_0343426 3300042007 Bacteria 565
171 Ga0450917_016634 3300042120 Bacteria 630
172 Ga0450921_005916 3300042123 Bacteria 938
173 Ga0450923_018404 3300042125 Bacteria 1336
174 Ga0450894_004350 3300042131 Unclassified 1840
175 Ga0450898_042838 3300042134 Bacteria 860
176 Ga0450910_088895 3300042147 Unclassified 546
177 Ga0439434_0049707 3300042435 Bacteria 1298
178 Ga0439435_0285783 3300042436 Bacteria 562
179 Ga0450918_048252 3300042531 Unclassified 772
180 Ga0451577_0161202 3300042876 Bacteria 2019
181 Ga0453683_0146705 3300044673 Unclassified 1490
182 Ga0466966_0172443 3300044684 Bacteria 1314
183 Ga0466961_0606226 3300044693 Unclassified 658
184 Ga0453684_0267919 3300044712 Bacteria 1953
185 Ga0453684_1219936 3300044712 Bacteria 789
186 Ga0466968_0670353 3300044735 Unclassified 528
187 Ga0466959_0047958 3300045049 Bacteria 3141
188 Ga0451576_0886146 3300045051 Bacteria 936
189 Ga0495629_0349741 3300046459 Bacteria 1008
190 Ga0495580_0045438 3300046472 Bacteria 3120
191 Ga0495580_0227121 3300046472 Bacteria 1282
192 Ga0495582_0596598 3300046473 Unclassified 639
193 Ga0495594_0293595 3300046499 Bacteria 926
194 Ga0495608_0635448 3300046511 Bacteria 639
195 Ga0495628_0887066 3300046516 Unclassified 620
196 Ga0495654_0104311 3300046530 Bacteria 1301
197 Ga0495586_0280940 3300046535 Unclassified 953
198 Ga0495621_0081577 3300046539 Bacteria 1206
199 Ga0495647_0004704 3300046681 Bacteria 4452
200 Ga0495658_0311049 3300046683 Bacteria 997
201 Ga0495676_0152750 3300047321 Bacteria 1641
202 Ga0495680_0567273 3300047322 Unclassified 763
203 Ga0495681_0024403 3300047470 Unclassified 3187
204 Ga0495614_0428618 3300048089 Bacteria 624
205 Ga0496101_1567448 3300048904 Bacteria 512
206 Ga0496106_0625814 3300048909 Bacteria 861
207 Ga0496108_0135575 3300048911 Bacteria 2118
208 Ga0496108_1154398 3300048911 Bacteria 656
209 Ga0496110_0358710 3300048913 Unclassified 1328
210 Ga0496112_0038793 3300048915 Bacteria 4653
211 Ga0496112_0273532 3300048915 Unclassified 1637
212 Ga0496113_0709056 3300048916 Bacteria 803
213 Ga0501031_0009459 3300049568 Bacteria 6337
214 Ga0501032_0011033 3300049569 Bacteria 6494
215 Ga0501033_0021445 3300049570 Bacteria 4873
216 Ga0501034_0044614 3300049571 Bacteria 4482
217 Ga0501036_0011587 3300049572 Bacteria 7305
218 Ga0501036_0044175 3300049572 Bacteria 3774
219 Ga0501036_0123701 3300049572 Bacteria 2185
220 Ga0501037_0020990 3300049573 Bacteria 4825
221 Ga0501037_0067057 3300049573 Bacteria 2613
222 Ga0501038_0002210 3300049574 Bacteria 18096
223 Ga0501039_0039825 3300049575 Bacteria 3628
224 Ga0501040_0500832 3300049576 Bacteria 876
225 Ga0501042_0056596 3300049578 Bacteria 2798
226 Ga0501042_0417437 3300049578 Bacteria 972
227 Ga0501043_0008459 3300049579 Bacteria 8100
228 Ga0501043_0045952 3300049579 Bacteria 3433
229 Ga0501043_0642437 3300049579 Bacteria 780
230 Ga0501046_0001658 3300049580 Bacteria 21286
231 Ga0501046_0014853 3300049580 Bacteria 6555
232 Ga0501047_0008021 3300049581 Bacteria 9961
233 Ga0501048_0009071 3300049582 Bacteria 7486
234 Ga0501067_0005158 3300049583 Bacteria 7263
235 Ga0501067_0006288 3300049583 Bacteria 6587
236 Ga0501068_0032741 3300049584 Bacteria 3091
237 Ga0501069_0002949 3300049585 Bacteria 8745
238 Ga0501070_0012892 3300049586 Bacteria 7044
239 Ga0501070_0027979 3300049586 Bacteria 4728
240 Ga0501071_0010241 3300049587 Bacteria 6276
241 Ga0501071_0350067 3300049587 Bacteria 1124
242 Ga0501073_0004167 3300049589 Bacteria 10842
243 Ga0501073_0066500 3300049589 Bacteria 2512
244 Ga0501073_0536436 3300049589 Bacteria 809
245 Ga0501074_0005715 3300049590 Bacteria 8967
246 Ga0501074_0017780 3300049590 Bacteria 5165
247 Ga0501075_0509089 3300049591 Bacteria 919
248 Ga0501076_0558017 3300049592 Bacteria 944
249 Ga0501077_0077215 3300049593 Bacteria 2109
250 Ga0501079_0316534 3300049741 Bacteria 1222
251 Ga0501080_0172937 3300049742 Unclassified 1991
252 Ga0501081_1184512 3300049743 Bacteria 579
253 Ga0501083_0002620 3300049744 Bacteria 12392
254 Ga0501083_0147379 3300049744 Bacteria 1541
255 Ga0501035_0000733 3300049822 Bacteria 35527
256 Ga0501035_0207692 3300049822 Bacteria 1677
257 Ga0501035_0687027 3300049822 Bacteria 826
258 Ga0501044_0021761 3300049823 Bacteria 6837
259 Ga0501044_0039064 3300049823 Bacteria 4953
260 Ga0501045_0023005 3300049824 Bacteria 4465
261 Ga0501045_0461420 3300049824 Bacteria 944
262 nmdc:mga05p37_202312_c1 3300050507 Bacteria 2404
263 nmdc:mga05p37_275555_c1 3300050507 Unclassified 2009
264 nmdc:mga09592_798264_c1 3300050508 Bacteria 799
265 nmdc:mga06r32_375319_c1 3300050510 Unclassified 1405
266 nmdc:mga08y16_397210_c1 3300050511 Unclassified 1412
267 nmdc:mga0n895_2251903_c1 3300050512 Unclassified 500
268 nmdc:mga0n895_3820_c1 3300050512 Bacteria 12210
269 nmdc:mga0a205_1036831_c1 3300050515 Unclassified 667
270 nmdc:mga0a205_1117701_c1 3300050515 Bacteria 635
271 nmdc:mga0a205_271450_c1 3300050515 Unclassified 1573
272 nmdc:mga0a205_380875_c1 3300050515 Unclassified 1276
273 Ga0495601_0509492 3300053077 Unclassified 776
274 Ga0495619_1024511 3300053085 Unclassified 551
275 Ga0500651_0345786 3300053093 Unclassified 845
276 Ga0500641_0266488 3300053096 Bacteria 714
277 Ga0500556_0324548 3300053104 Unclassified 599
278 Ga0500642_0265708 3300053130 Unclassified 784
279 Ga0500588_0102206 3300053146 Bacteria 989
280 Ga0501084_0032853 3300054114 Bacteria 4342
281 Ga0501084_0075525 3300054114 Bacteria 2823
282 Ga0501082_0023649 3300060353 Bacteria 5299
283 Ga0501082_0118602 3300060353 Unclassified 2292
284 Ga0501082_0221146 3300060353 Bacteria 1648
285 Ga0501082_1444839 3300060353 Bacteria 601
286 Ga0530510_0286248 3300061734 Unclassified 1232
287 Ga0070688_100819022
288 SwRhRL2b_contig_2997981
289 2214741041
290 JGI25406J46586_10190573
291 Ga0065704_10074757
292 Ga0065712_10090394
293 Ga0065715_10360866
294 Ga0065707_10067371
295 Ga0065707_10731376
296 Ga0065707_10750444
297 Ga0070658_10253833
298 Ga0070670_100007084
299 Ga0070670_100039634
300 Ga0070682_101540161
301 Ga0068868_100105707
302 Ga0070660_101546980
303 Ga0070689_100100911
304 Ga0070689_101330878
305 Ga0070661_100169566
306 Ga0070668_100934179
307 Ga0070669_100084189
308 Ga0070675_100751729
309 Ga0070673_100249336
310 Ga0070688_100161499
311 Ga0070659_100131486
312 Ga0070667_100388793
313 Ga0070703_10535480
314 Ga0070709_11080550
315 Ga0070710_10241157
316 Ga0070701_10505907
317 Ga0070705_101455631
318 Ga0070663_101092057
319 Ga0070678_100704486
320 Ga0070662_100969490
321 Ga0070662_101152964
322 Ga0070662_101164850
323 Ga0070707_102140275
324 Ga0070699_100039477
325 Ga0070679_100587873
326 Ga0070679_100690825
327 Ga0070672_100037414
328 Ga0070686_100075983
329 Ga0070695_100890320
330 Ga0070665_100108380
331 Ga0070665_100109540
332 Ga0070704_101699847
333 Ga0068855_100008875
334 Ga0068855_100208754
335 Ga0068855_100240297
336 Ga0070664_100061489
337 Ga0070664_100583209
338 Ga0070664_102013335
339 Ga0070664_102337545
340 Ga0068857_100176195
341 Ga0068856_101431965
342 Ga0068852_101822573
343 Ga0068859_100096258
344 Ga0068859_100408123
345 Ga0068864_100088921
346 Ga0068863_100716290
347 Ga0068862_100826211
348 Ga0068862_101041814
349 Ga0081539_10031516
350 Ga0075431_100400471
351 Ga0075433_10214008
352 Ga0075433_10332998
353 Ga0075434_100011966
354 Ga0075434_101538552
355 Ga0075434_102371539
356 Ga0075429_100316300
357 Ga0075429_100949556
358 Ga0097620_100096256
359 Ga0097620_100408116
360 Ga0105240_10010706
361 Ga0105240_10760048
362 Ga0111539_10020607
363 Ga0111539_12835645
364 Ga0105245_11890406
365 Ga0114129_10113984
366 Ga0114129_10160129
367 Ga0105241_10719641
368 Ga0105242_12249707
369 Ga0105248_10826076
370 Ga0105248_10886440
371 Ga0105237_10086286
372 Ga0105238_10140005
373 Ga0105238_10176975
374 Ga0105238_10472805
375 Ga0105238_11369511
376 Ga0105249_10515012
377 Ga0105249_11657373
378 Ga0105239_11068519
379 Ga0105246_10892262
380 Ga0105246_10925163
381 Ga0157369_11253328
382 Ga0157374_10083415
383 Ga0157374_10937670
384 Ga0157372_10381826
385 Ga0157372_11373006
386 Ga0157375_10762172
387 Ga0157375_13189926
388 Ga0163163_10059585
389 Ga0163163_12076965
390 Ga0157380_10135731
391 Ga0157380_10273974
392 Ga0157377_11588624
393 Ga0157379_10176446
394 Ga0157379_10582317
395 Ga0157376_10998370
396 Ga0207680_10496773
397 Ga0207699_10157224
398 Ga0207643_10860320
399 Ga0207654_11045462
400 Ga0207695_10114300
401 Ga0207671_10061610
402 Ga0207662_10121627
403 Ga0207657_10590407
404 Ga0207681_10473889
405 Ga0207694_10212157
406 Ga0207694_10638875
407 Ga0207650_10027927
408 Ga0207659_10358903
409 Ga0207690_11601563
410 Ga0207706_10063122
411 Ga0207670_10665425
412 Ga0207670_10895725
413 Ga0207691_10193357
414 Ga0207711_11218496
415 Ga0207679_11665968
416 Ga0207667_10003985
417 Ga0207667_11388168
418 Ga0207712_10415739
419 Ga0207712_10736690
420 Ga0207640_11170596
421 Ga0207658_10112691
422 Ga0207703_10004861
423 Ga0207702_12111595
424 Ga0207641_11500037
425 Ga0207648_10734331
426 Ga0207676_10075448
427 Ga0207676_11281579
428 Ga0207674_10519730
429 Ga0207674_11690750
430 Ga0207683_10884220
431 Ga0209999_1038799
432 Ga0209970_1082216
433 Ga0268266_10041329
434 Ga0268266_10049786
435 Ga0268265_10013907
436 Ga0268265_10450225
437 Ga0268264_11124740
438 Ga0265316_10736084
439 Ga0316576_10646903
440 Ga0373923_0154456
441 Ga0316574_0063830
442 Ga0373931_0443933
443 Ga0373935_0833052
444 Ga0373927_0047864
445 Ga0373933_0821969
446 Ga0373947_0070052
447 Ga0373937_0336146
448 Ga0373937_0557250
449 Ga0316584_0735709
450 Ga0373925_0016822
451 Ga0451807_1204658
452 Ga0439431_0094486
453 Ga0439433_0033852
454 Ga0439442_057791
455 Ga0439445_0118214
456 Ga0439449_0343426
457 Ga0450917_016634
458 Ga0450921_005916
459 Ga0450923_018404
460 Ga0450894_004350
461 Ga0450898_042838
462 Ga0450910_088895
463 Ga0439434_0049707
464 Ga0439435_0285783
465 Ga0450918_048252
466 Ga0451577_0161202
467 Ga0453683_0146705
468 Ga0466966_0172443
469 Ga0466961_0606226
470 Ga0453684_0267919
471 Ga0453684_1219936
472 Ga0466968_0670353
473 Ga0466959_0047958
474 Ga0451576_0886146
475 Ga0495629_0349741
476 Ga0495580_0045438
477 Ga0495580_0227121
478 Ga0495582_0596598
479 Ga0495594_0293595
480 Ga0495608_0635448
481 Ga0495628_0887066
482 Ga0495654_0104311
483 Ga0495586_0280940
484 Ga0495621_0081577
485 Ga0495647_0004704
486 Ga0495658_0311049
487 Ga0495676_0152750
488 Ga0495680_0567273
489 Ga0495681_0024403
490 Ga0495614_0428618
491 Ga0496101_1567448
492 Ga0496106_0625814
493 Ga0496108_0135575
494 Ga0496108_1154398
495 Ga0496110_0358710
496 Ga0496112_0038793
497 Ga0496112_0273532
498 Ga0496113_0709056
499 Ga0501031_0009459
500 Ga0501032_0011033
501 Ga0501033_0021445
502 Ga0501034_0044614
503 Ga0501036_0011587
504 Ga0501036_0044175
505 Ga0501036_0123701
506 Ga0501037_0020990
507 Ga0501037_0067057
508 Ga0501038_0002210
509 Ga0501039_0039825
510 Ga0501040_0500832
511 Ga0501042_0056596
512 Ga0501042_0417437
513 Ga0501043_0008459
514 Ga0501043_0045952
515 Ga0501043_0642437
516 Ga0501046_0001658
517 Ga0501046_0014853
518 Ga0501047_0008021
519 Ga0501048_0009071
520 Ga0501067_0005158
521 Ga0501067_0006288
522 Ga0501068_0032741
523 Ga0501069_0002949
524 Ga0501070_0012892
525 Ga0501070_0027979
526 Ga0501071_0010241
527 Ga0501071_0350067
528 Ga0501073_0004167
529 Ga0501073_0066500
530 Ga0501073_0536436
531 Ga0501074_0005715
532 Ga0501074_0017780
533 Ga0501075_0509089
534 Ga0501076_0558017
535 Ga0501077_0077215
536 Ga0501079_0316534
537 Ga0501080_0172937
538 Ga0501081_1184512
539 Ga0501083_0002620
540 Ga0501083_0147379
541 Ga0501035_0000733
542 Ga0501035_0207692
543 Ga0501035_0687027
544 Ga0501044_0021761
545 Ga0501044_0039064
546 Ga0501045_0023005
547 Ga0501045_0461420
548 nmdc:mga05p37_202312_c1
549 nmdc:mga05p37_275555_c1
550 nmdc:mga09592_798264_c1
551 nmdc:mga06r32_375319_c1
552 nmdc:mga08y16_397210_c1
553 nmdc:mga0n895_2251903_c1
554 nmdc:mga0n895_3820_c1
555 nmdc:mga0a205_1036831_c1
556 nmdc:mga0a205_1117701_c1
557 nmdc:mga0a205_271450_c1
558 nmdc:mga0a205_380875_c1
559 Ga0495601_0509492
560 Ga0495619_1024511
561 Ga0500651_0345786
562 Ga0500641_0266488
563 Ga0500556_0324548
564 Ga0500642_0265708
565 Ga0500588_0102206
566 Ga0501084_0032853
567 Ga0501084_0075525
568 Ga0501082_0023649
569 Ga0501082_0118602
570 Ga0501082_0221146
571 Ga0501082_1444839
572 Ga0530510_0286248

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

38

109

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3l7w-assembly1.cif.gz_A-2 the crystal structure of smu.1704 from streptococcus mutans ua159 0.9299 11 103
5zhv-assembly1.cif.gz_B crystal structure of the padr-family transcriptional regulator rv3488 of mycobacterium tuberculosis h37rv in complex with zinc ion 0.919 2 100
7wjp-assembly1.cif.gz_A-2 structure of padr-like protein from listeria monocytogenes 0.9164 8 103
5zqh-assembly1.cif.gz_A-2 crystal structure of streptococcus transcriptional regulator 0.9033 6 105
6abt-assembly1.cif.gz_A crystal structure of transcription factor from listeria monocytogenes 0.8978 10 103
ID Description Score Start End Superfamily
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9121 8 102 1.10.10.10
3l7wA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9094 11 103 1.10.10.10
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9087 7 103 1.10.10.10
af_O50432_1_88_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9039 14 88 1.10.10.10
5zqhA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9033 6 105 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7L5ZDN2-F1-model_v4 PadR family transcriptional regulator 0.9556 2 98
AF-A0A4T2A6B6-F1-model_v4 deleted 0.9545 6 103
AF-A0A4R7LHV4-F1-model_v4 PadR family transcriptional regulator PadR 0.9531 6 103
AF-A0A2S0LKJ9-F1-model_v4 deleted 0.9529 4 103
AF-A0A1F8GF20-F1-model_v4 PadR family transcriptional regulator 0.9527 11 103

Map