F387099

General Info

Members Datasets Scaffolds Average Seq Length
285 207 570 355

Family's Representative Sequence

Representative Sequence 3300049822|Ga0501035_0046979|Ga0501035_0046979_896_1912
Length 338
Sequence MRFKASTIFVTGGAGFIGSAVIRHLLRNTHARVVNIDKFTYAANLDSLPGTTDNLNYAFEKQCICDGPGLRQLFAKYQPDAVMNLAAESHVDRSIDGPGEFIQTNIVGTFTLLQETLRYWHTLSADKRKTFRFHHVSTDEVFGSLGDDGFFTETTAYAPNSPYSASKASSDHLVRAWRETYDLPTMIPHMIIKGLAGEPLPVYGDGKNVRDWLYVEDHARALTLVLEHGAVGETYNVGGRNERTNLHVVESICDLLDEVAPTADGPHRDLITFVADRPGHDHRYAIDASKLERELGWQAEENFESGIEKTVRWYVDEQPWWRAILERGYAAKRVGLSQ

Samples

Sample ID Description Type Environment
1 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
14 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
16 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
17 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
18 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
19 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
20 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
25 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
26 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
27 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
28 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
31 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
32 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
33 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
34 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
36 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
38 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
39 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
41 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
47 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
48 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
49 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
50 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
51 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
52 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
53 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
54 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
55 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
56 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
57 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
58 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
59 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
60 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
61 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
62 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
63 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
64 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
65 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
66 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
67 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
68 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
69 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
70 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
71 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
72 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
73 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
74 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
75 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
76 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
77 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
78 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
79 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
80 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
81 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
82 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
83 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
84 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
85 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
86 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
87 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
88 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
89 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
90 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
91 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
92 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
93 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
94 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
95 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
96 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
97 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
110 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
111 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
112 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
113 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
114 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
116 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
117 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
118 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
119 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
120 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
121 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
122 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
123 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
124 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
125 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
126 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
127 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
128 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
129 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
130 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
131 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
132 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
133 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
134 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
135 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
136 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
137 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
138 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
139 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
140 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
141 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
142 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
143 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
144 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
145 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
146 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
147 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
148 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
149 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
150 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
151 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
152 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
153 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
154 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
155 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
156 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
157 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
158 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
159 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
160 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
161 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
162 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
163 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
164 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
165 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
166 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
167 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
168 2904699407
169 2906610324
170 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
171 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
172 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
173 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
174 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
175 2922425934
176 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
177 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
178 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
179 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
180 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
181 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
182 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
183 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
184 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
185 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
186 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
187 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
188 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
189 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
190 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
191 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
192 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
193 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
194 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
195 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
196 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
197 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
198 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
199 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
200 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
201 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
202 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
203 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
204 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
205 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
206 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
207 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 74.38
Metatranscriptomes 0
Isolates 25.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.65
Nodule 19.3
Rhizoplane 3.51
Rhizosphere 45.61
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501035_0046979 3300049822 Bacteria 3879
2 JGI25153J46596_10000502 3300003215 Bacteria 24875
3 JGI25160J50197_1000344 3300003354 Bacteria 31105
4 JGI25160J50197_1004733 3300003354 Bacteria 5822
5 JGI25160J50197_1008646 3300003354 Bacteria 3861
6 Ga0055542_1007529 3300003762 Bacteria 2203
7 Ga0055526_1018034 3300003771 Bacteria 2658
8 Ga0055543_1001128 3300004625 Bacteria 11446
9 Ga0065165_1000054 3300005262 Bacteria 187351
10 Ga0065165_1002041 3300005262 Bacteria 18738
11 Ga0065165_1004508 3300005262 Bacteria 8555
12 Ga0070683_100310132 3300005329 Bacteria 1501
13 Ga0070667_100412229 3300005367 Bacteria 1231
14 Ga0070713_100090051 3300005436 Bacteria 2637
15 Ga0070713_100099432 3300005436 Bacteria 2517
16 Ga0068867_100105679 3300005459 Bacteria 2156
17 Ga0070665_100016709 3300005548 Bacteria 7354
18 Ga0068852_100038874 3300005616 Bacteria 4003
19 Ga0081455_10002908 3300005937 Bacteria 20103
20 Ga0081540_1004075 3300005983 Bacteria 11312
21 Ga0081540_1019967 3300005983 Bacteria 4048
22 Ga0081540_1031660 3300005983 Bacteria 2903
23 Ga0075365_10039057 3300006038 Bacteria 3089
24 Ga0075364_10179015 3300006051 Bacteria 1434
25 Ga0075369_10002752 3300006186 Bacteria 6310
26 Ga0075369_10008001 3300006186 Bacteria 4050
27 Ga0075366_10005937 3300006195 Bacteria 6642
28 Ga0075366_10149188 3300006195 Bacteria 1416
29 Ga0075370_10087169 3300006353 Bacteria 1798
30 Ga0105240_10000793 3300009093 Bacteria 57276
31 Ga0111539_10022931 3300009094 Bacteria 7664
32 Ga0114129_10499832 3300009147 Bacteria 1588
33 Ga0105241_10018954 3300009174 Bacteria 5071
34 Ga0105237_10000153 3300009545 Bacteria 96552
35 Ga0105237_10017760 3300009545 Bacteria 7376
36 Ga0105239_10036441 3300010375 Bacteria 5401
37 Ga0105239_10093102 3300010375 Bacteria 3327
38 Ga0105239_10258802 3300010375 Bacteria 1955
39 Ga0157373_10300131 3300013100 Bacteria 1140
40 Ga0157370_10073595 3300013104 Bacteria 3224
41 Ga0157369_10334977 3300013105 Bacteria 1572
42 Ga0163162_10406522 3300013306 Bacteria 1494
43 Ga0157380_10165623 3300014326 Bacteria 1926
44 Ga0157379_10047576 3300014968 Bacteria 3826
45 Ga0157379_10052795 3300014968 Bacteria 3630
46 Ga0163161_10151661 3300017792 Bacteria 1762
47 Ga0209148_1000239 3300025254 Bacteria 87710
48 Ga0209233_1000600 3300025261 Bacteria 18662
49 Ga0209233_1009105 3300025261 Bacteria 3037
50 Ga0209455_1002439 3300025272 Bacteria 7203
51 Ga0209564_1015186 3300025295 Bacteria 3150
52 Ga0209564_1015835 3300025295 Bacteria 3044
53 Ga0209758_1000806 3300025297 Bacteria 44157
54 Ga0209758_1001068 3300025297 Bacteria 35664
55 Ga0209256_1003643 3300025299 Bacteria 10552
56 Ga0207426_1000375 3300025302 Bacteria 78261
57 Ga0207426_1000467 3300025302 Bacteria 62488
58 Ga0207426_1000527 3300025302 Bacteria 55514
59 Ga0207426_1010975 3300025302 Bacteria 3481
60 Ga0207695_10000797 3300025913 Bacteria 59086
61 Ga0207695_10000830 3300025913 Bacteria 57286
62 Ga0207671_10001174 3300025914 Bacteria 31189
63 Ga0207671_10011775 3300025914 Bacteria 7082
64 Ga0207671_10126549 3300025914 Bacteria 1958
65 Ga0207711_10027057 3300025941 Bacteria 4815
66 Ga0207708_10139594 3300026075 Bacteria 1900
67 Ga0268266_10027915 3300028379 Bacteria 4800
68 Ga0265324_10041708 3300029957 Bacteria 1587
69 Ga0265328_10000043 3300031239 Bacteria 89024
70 Ga0265325_10002297 3300031241 Bacteria 12971
71 Ga0265327_10000002 3300031251 Bacteria 856593
72 Ga0265327_10051181 3300031251 Bacteria 2157
73 Ga0265342_10045125 3300031712 Bacteria 2654
74 Ga0307510_10064141 3300033180 Bacteria 3733
75 Ga0315911_1000002 3300033442 Bacteria 926833
76 Ga0373927_0180643 3300035695 Bacteria 1384
77 Ga0395900_0057908 3300037418 Bacteria 3989
78 Ga0395898_0148526 3300037466 Bacteria 2243
79 Ga0395898_0155733 3300037466 Bacteria 2186
80 Ga0395905_0366444 3300037471 Bacteria 1334
81 Ga0436364_0392793 3300037853 Bacteria 2351
82 Ga0395901_0514292 3300038443 Bacteria 1217
83 Ga0436360_1309131 3300039438 Bacteria 7974
84 Ga0436361_0132686 3300039447 Bacteria 1867
85 Ga0436363_0348235 3300039450 Bacteria 1453
86 Ga0439453_0006128 3300041408 Bacteria 1860
87 Ga0466963_0129812 3300044694 Bacteria 1740
88 Ga0495653_0077352 3300046463 Bacteria 2471
89 Ga0495650_0053640 3300046471 Bacteria 1650
90 Ga0495664_0017458 3300046477 Bacteria 4103
91 Ga0495648_0065224 3300046524 Bacteria 2142
92 Ga0495648_0073220 3300046524 Bacteria 1979
93 Ga0495587_0078931 3300046536 Bacteria 1909
94 Ga0495587_0122042 3300046536 Bacteria 1492
95 Ga0495609_0032316 3300046538 Bacteria 2378
96 Ga0495645_0178158 3300046543 Bacteria 1458
97 Ga0495635_0014160 3300046663 Bacteria 5581
98 Ga0495657_0022744 3300046675 Bacteria 4486
99 Ga0495599_0070765 3300046678 Bacteria 2177
100 Ga0495613_0118264 3300046689 Bacteria 1905
101 Ga0495624_0084992 3300046690 Bacteria 1955
102 Ga0495604_0031297 3300047317 Bacteria 4221
103 Ga0495604_0067253 3300047317 Bacteria 2723
104 Ga0495604_0076224 3300047317 Bacteria 2523
105 Ga0495604_0118523 3300047317 Bacteria 1919
106 Ga0495674_0159032 3300047319 Bacteria 1891
107 Ga0495674_0273922 3300047319 Bacteria 1384
108 Ga0495672_0042930 3300047320 Bacteria 2722
109 Ga0495672_0071734 3300047320 Bacteria 1959
110 Ga0495676_0025479 3300047321 Bacteria 5107
111 Ga0495675_0114242 3300047444 Bacteria 1684
112 Ga0495602_0114844 3300048088 Bacteria 2179
113 Ga0495602_0163660 3300048088 Bacteria 1734
114 Ga0496102_0087221 3300048905 Bacteria 2883
115 Ga0496104_0001655 3300048907 Bacteria 19236
116 Ga0496104_0062661 3300048907 Bacteria 3526
117 Ga0496105_0006734 3300048908 Bacteria 8836
118 Ga0496109_0030558 3300048912 Bacteria 4828
119 Ga0496109_0115361 3300048912 Bacteria 2499
120 Ga0496112_0008387 3300048915 Bacteria 9255
121 Ga0496114_0122999 3300048917 Bacteria 2233
122 Ga0496115_0113885 3300048918 Bacteria 2223
123 Ga0496118_0024750 3300048921 Bacteria 5172
124 Ga0496119_0067573 3300048922 Bacteria 2107
125 Ga0496119_0133310 3300048922 Bacteria 1351
126 Ga0496120_0015101 3300048923 Bacteria 5110
127 Ga0496122_0058464 3300048925 Bacteria 2854
128 Ga0496124_0127938 3300048927 Bacteria 2022
129 Ga0496125_0006808 3300048928 Bacteria 12270
130 Ga0496125_0050095 3300048928 Bacteria 3462
131 Ga0496126_0002472 3300048929 Bacteria 24884
132 Ga0496126_0006015 3300048929 Bacteria 13627
133 Ga0496126_0058290 3300048929 Bacteria 3481
134 Ga0495682_0026800 3300049460 Bacteria 2139
135 Ga0495682_0051886 3300049460 Bacteria 1491
136 Ga0501031_0103266 3300049568 Bacteria 1860
137 Ga0501031_0106871 3300049568 Bacteria 1827
138 Ga0501032_0032322 3300049569 Bacteria 3586
139 Ga0501032_0084316 3300049569 Bacteria 2112
140 Ga0501032_0229350 3300049569 Bacteria 1207
141 Ga0501033_0000674 3300049570 Bacteria 31495
142 Ga0501034_0058323 3300049571 Bacteria 3880
143 Ga0501034_0179592 3300049571 Bacteria 2082
144 Ga0501034_0188961 3300049571 Bacteria 2023
145 Ga0501034_0277900 3300049571 Bacteria 1614
146 Ga0501034_0422728 3300049571 Bacteria 1253
147 Ga0501036_0039149 3300049572 Bacteria 4014
148 Ga0501036_0155051 3300049572 Bacteria 1932
149 Ga0501036_0325306 3300049572 Bacteria 1284
150 Ga0501037_0002637 3300049573 Bacteria 12924
151 Ga0501037_0078565 3300049573 Bacteria 2395
152 Ga0501038_0000734 3300049574 Bacteria 29279
153 Ga0501038_0007103 3300049574 Bacteria 10341
154 Ga0501038_0078055 3300049574 Bacteria 2795
155 Ga0501038_0089231 3300049574 Bacteria 2586
156 Ga0501039_0105497 3300049575 Bacteria 2200
157 Ga0501039_0146056 3300049575 Bacteria 1858
158 Ga0501040_0005957 3300049576 Bacteria 7885
159 Ga0501042_0049685 3300049578 Bacteria 2992
160 Ga0501043_0002923 3300049579 Bacteria 14261
161 Ga0501043_0009885 3300049579 Bacteria 7479
162 Ga0501043_0021212 3300049579 Bacteria 5092
163 Ga0501046_0132666 3300049580 Bacteria 1888
164 Ga0501068_0094206 3300049584 Bacteria 1851
165 Ga0501070_0056862 3300049586 Bacteria 3243
166 Ga0501070_0223170 3300049586 Bacteria 1545
167 Ga0501073_0055431 3300049589 Bacteria 2774
168 Ga0501074_0006081 3300049590 Bacteria 8717
169 Ga0501077_0045550 3300049593 Bacteria 2787
170 Ga0501035_0001334 3300049822 Bacteria 25468
171 Ga0501035_0068669 3300049822 Bacteria 3142
172 Ga0501035_0089026 3300049822 Bacteria 2719
173 Ga0501035_0271001 3300049822 Bacteria 1437
174 Ga0501044_0040327 3300049823 Bacteria 4866
175 Ga0501044_0234450 3300049823 Bacteria 1781
176 Ga0501045_0006283 3300049824 Bacteria 8214
177 nmdc:mga00v17_29615_c1 3300050491 Bacteria 1407
178 nmdc:mga0yw44_21036_c1 3300050492 Bacteria 3633
179 nmdc:mga0k408_13805_c1 3300050493 Bacteria 3535
180 nmdc:mga07m45_15067_c1 3300050496 Bacteria 4129
181 nmdc:mga07m45_47646_c1 3300050496 Bacteria 2409
182 nmdc:mga08y16_525013_c1 3300050511 Bacteria 1200
183 nmdc:mga0sz30_3128_c1 3300050516 Bacteria 4552
184 nmdc:mga0sz30_5801_c1 3300050516 Bacteria 4548
185 Ga0495601_0002800 3300053077 Bacteria 9897
186 Ga0495601_0036166 3300053077 Bacteria 3083
187 Ga0495612_0008841 3300053078 Bacteria 4080
188 Ga0495612_0067203 3300053078 Bacteria 1491
189 Ga0495595_0002902 3300053084 Bacteria 6760
190 Ga0500578_0062192 3300053086 Bacteria 2383
191 Ga0500578_0220485 3300053086 Bacteria 1153
192 Ga0500643_000095 3300053087 Bacteria 92535
193 Ga0500641_0008907 3300053096 Bacteria 3597
194 Ga0500562_004557 3300053108 Bacteria 3499
195 Ga0500592_005546 3300053116 Bacteria 2009
196 Ga0500595_035180 3300053119 Bacteria 1651
197 Ga0500595_038098 3300053119 Bacteria 1565
198 Ga0500614_008701 3300053123 Bacteria 2155
199 Ga0500642_0026610 3300053130 Bacteria 2363
200 Ga0500559_0012469 3300053136 Bacteria 3612
201 Ga0500568_0006229 3300053139 Bacteria 6022
202 Ga0500568_0023347 3300053139 Bacteria 2631
203 Ga0500616_0010100 3300053153 Bacteria 5671
204 Ga0500619_004398 3300053154 Bacteria 3020
205 Ga0500627_0001129 3300053158 Bacteria 7306
206 Ga0500633_0021839 3300053160 Bacteria 1951
207 Ga0500636_0000807 3300053177 Bacteria 16914
208 Ga0500601_000088 3300053737 Bacteria 19062
209 Ga0501082_0300093 3300060353 Bacteria 1399
210 2508541011 2508501009 Bacteria 7784016
211 2511399979 2511231028 Bacteria 8046582
212 2513641536 2513237094 Bacteria 8789602
213 2513653892 2513237096 Bacteria 8722461
214 2513692965 2513237101 Bacteria 7952346
215 2513703999 2513237102 Bacteria 7703324
216 2513856326 2513237137 Bacteria 9558895
217 2513918232 2513237145 Bacteria 8979722
218 2514014922 2513237161 Bacteria 8871253
219 2517891538 2517572143 Bacteria 9484767
220 2524463710 2524023210 Bacteria 9029266
221 2524471090 2524023210 Bacteria 9029266
222 2524538697 2524023228 Bacteria 10118060
223 2528857567 2528768022 Bacteria 10457665
224 2617349928 2617270735 Bacteria 9163226
225 2671118691 2667528175 Bacteria 7532676
226 2793066901 2791355197 Bacteria 8420563
227 2838126684 2838122688 Bacteria 8803140
228 2841949135 2841941048 Bacteria 8688029
229 2841974095 2841966195 Bacteria 8673214
230 2874612289 2874604998 Bacteria 7834745
231 2874630717 2874628541 Bacteria 8630250
232 2885371647 2885366525 Bacteria 8326213
233 2885380395 2885374607 Bacteria 8927485
234 2885418388 2885409591 Bacteria 9235467
235 2889036562 2889033259 Bacteria 9099371
236 2903734206 2903727486 Bacteria 8281579
237 2904704755
238 2904705361
239 2906616713
240 2906628656 2906626472 Bacteria 8826946
241 2906639829 2906635258 Bacteria 8601019
242 2906667041 2906660503 Bacteria 8595048
243 2908741881 2908739725 Bacteria 8628932
244 2908782335 2908775508 Bacteria 8092255
245 2922431257
246 2932798618 2932794094 Bacteria 7915132
247 2932806490 2932801729 Bacteria 7987968
248 2932824516 2932818245 Bacteria 9955613
249 2935633855 2935630451 Bacteria 8169952
250 2935635901 2935630451 Bacteria 8169952
251 2935684391 2935675223 Bacteria 9928132
252 2935804871 2935801545 Bacteria 9301974
253 2935888671 2935883170 Bacteria 7964738
254 2935964859 2935959822 Bacteria 7869783
255 2941510842 2941507105 Bacteria 8166816
256 2941512532 2941507105 Bacteria 8166816
257 2941518226 2941515067 Bacteria 8166720
258 2941520233 2941515067 Bacteria 8166720
259 2941526903 2941523033 Bacteria 8169134
260 2941528371 2941523033 Bacteria 8169134
261 2941536533 2941531003 Bacteria 7653939
262 3005481054 3005474847 Bacteria 9259049
263 3005485247 3005483717 Bacteria 7877331
264 3005601022 3005594810 Bacteria 8716512
265 3005723790 3005718088 Bacteria 8283608
266 8002060638 8002060224 Bacteria 4026565
267 8002062242 8002060224 Bacteria 4026565
268 8006929576 8006926726 Bacteria 6749210
269 8006939657 8006933436 Bacteria 10410654
270 8006942967 8006933436 Bacteria 10410654
271 8006979406 8006973647 Bacteria 10679141
272 8006982687 8006973647 Bacteria 10679141
273 8006997276 8006994254 Bacteria 8309700
274 8019565549 8019555841 Bacteria 9642137
275 8019575645 8019565922 Bacteria 9639779
276 8019580387 8019576017 Bacteria 10049540
277 8019603228 8019597564 Bacteria 10041141
278 8019615303 8019608314 Bacteria 10042931
279 8019647931 8019638758 Bacteria 9062356
280 8019655295 8019648815 Bacteria 10014479
281 8019664109 8019659431 Bacteria 8577854
282 8056676802 8056673599 Bacteria 7871253
283 8056684954 8056681323 Bacteria 8472857
284 8056685696 8056681323 Bacteria 8472857
285 8056973354 8056967851 Bacteria 9038162
286 Ga0501035_0046979
287 JGI25153J46596_10000502
288 JGI25160J50197_1000344
289 JGI25160J50197_1004733
290 JGI25160J50197_1008646
291 Ga0055542_1007529
292 Ga0055526_1018034
293 Ga0055543_1001128
294 Ga0065165_1000054
295 Ga0065165_1002041
296 Ga0065165_1004508
297 Ga0070683_100310132
298 Ga0070667_100412229
299 Ga0070713_100090051
300 Ga0070713_100099432
301 Ga0068867_100105679
302 Ga0070665_100016709
303 Ga0068852_100038874
304 Ga0081455_10002908
305 Ga0081540_1004075
306 Ga0081540_1019967
307 Ga0081540_1031660
308 Ga0075365_10039057
309 Ga0075364_10179015
310 Ga0075369_10002752
311 Ga0075369_10008001
312 Ga0075366_10005937
313 Ga0075366_10149188
314 Ga0075370_10087169
315 Ga0105240_10000793
316 Ga0111539_10022931
317 Ga0114129_10499832
318 Ga0105241_10018954
319 Ga0105237_10000153
320 Ga0105237_10017760
321 Ga0105239_10036441
322 Ga0105239_10093102
323 Ga0105239_10258802
324 Ga0157373_10300131
325 Ga0157370_10073595
326 Ga0157369_10334977
327 Ga0163162_10406522
328 Ga0157380_10165623
329 Ga0157379_10047576
330 Ga0157379_10052795
331 Ga0163161_10151661
332 Ga0209148_1000239
333 Ga0209233_1000600
334 Ga0209233_1009105
335 Ga0209455_1002439
336 Ga0209564_1015186
337 Ga0209564_1015835
338 Ga0209758_1000806
339 Ga0209758_1001068
340 Ga0209256_1003643
341 Ga0207426_1000375
342 Ga0207426_1000467
343 Ga0207426_1000527
344 Ga0207426_1010975
345 Ga0207695_10000797
346 Ga0207695_10000830
347 Ga0207671_10001174
348 Ga0207671_10011775
349 Ga0207671_10126549
350 Ga0207711_10027057
351 Ga0207708_10139594
352 Ga0268266_10027915
353 Ga0265324_10041708
354 Ga0265328_10000043
355 Ga0265325_10002297
356 Ga0265327_10000002
357 Ga0265327_10051181
358 Ga0265342_10045125
359 Ga0307510_10064141
360 Ga0315911_1000002
361 Ga0373927_0180643
362 Ga0395900_0057908
363 Ga0395898_0148526
364 Ga0395898_0155733
365 Ga0395905_0366444
366 Ga0436364_0392793
367 Ga0395901_0514292
368 Ga0436360_1309131
369 Ga0436361_0132686
370 Ga0436363_0348235
371 Ga0439453_0006128
372 Ga0466963_0129812
373 Ga0495653_0077352
374 Ga0495650_0053640
375 Ga0495664_0017458
376 Ga0495648_0065224
377 Ga0495648_0073220
378 Ga0495587_0078931
379 Ga0495587_0122042
380 Ga0495609_0032316
381 Ga0495645_0178158
382 Ga0495635_0014160
383 Ga0495657_0022744
384 Ga0495599_0070765
385 Ga0495613_0118264
386 Ga0495624_0084992
387 Ga0495604_0031297
388 Ga0495604_0067253
389 Ga0495604_0076224
390 Ga0495604_0118523
391 Ga0495674_0159032
392 Ga0495674_0273922
393 Ga0495672_0042930
394 Ga0495672_0071734
395 Ga0495676_0025479
396 Ga0495675_0114242
397 Ga0495602_0114844
398 Ga0495602_0163660
399 Ga0496102_0087221
400 Ga0496104_0001655
401 Ga0496104_0062661
402 Ga0496105_0006734
403 Ga0496109_0030558
404 Ga0496109_0115361
405 Ga0496112_0008387
406 Ga0496114_0122999
407 Ga0496115_0113885
408 Ga0496118_0024750
409 Ga0496119_0067573
410 Ga0496119_0133310
411 Ga0496120_0015101
412 Ga0496122_0058464
413 Ga0496124_0127938
414 Ga0496125_0006808
415 Ga0496125_0050095
416 Ga0496126_0002472
417 Ga0496126_0006015
418 Ga0496126_0058290
419 Ga0495682_0026800
420 Ga0495682_0051886
421 Ga0501031_0103266
422 Ga0501031_0106871
423 Ga0501032_0032322
424 Ga0501032_0084316
425 Ga0501032_0229350
426 Ga0501033_0000674
427 Ga0501034_0058323
428 Ga0501034_0179592
429 Ga0501034_0188961
430 Ga0501034_0277900
431 Ga0501034_0422728
432 Ga0501036_0039149
433 Ga0501036_0155051
434 Ga0501036_0325306
435 Ga0501037_0002637
436 Ga0501037_0078565
437 Ga0501038_0000734
438 Ga0501038_0007103
439 Ga0501038_0078055
440 Ga0501038_0089231
441 Ga0501039_0105497
442 Ga0501039_0146056
443 Ga0501040_0005957
444 Ga0501042_0049685
445 Ga0501043_0002923
446 Ga0501043_0009885
447 Ga0501043_0021212
448 Ga0501046_0132666
449 Ga0501068_0094206
450 Ga0501070_0056862
451 Ga0501070_0223170
452 Ga0501073_0055431
453 Ga0501074_0006081
454 Ga0501077_0045550
455 Ga0501035_0001334
456 Ga0501035_0068669
457 Ga0501035_0089026
458 Ga0501035_0271001
459 Ga0501044_0040327
460 Ga0501044_0234450
461 Ga0501045_0006283
462 nmdc:mga00v17_29615_c1
463 nmdc:mga0yw44_21036_c1
464 nmdc:mga0k408_13805_c1
465 nmdc:mga07m45_15067_c1
466 nmdc:mga07m45_47646_c1
467 nmdc:mga08y16_525013_c1
468 nmdc:mga0sz30_3128_c1
469 nmdc:mga0sz30_5801_c1
470 Ga0495601_0002800
471 Ga0495601_0036166
472 Ga0495612_0008841
473 Ga0495612_0067203
474 Ga0495595_0002902
475 Ga0500578_0062192
476 Ga0500578_0220485
477 Ga0500643_000095
478 Ga0500641_0008907
479 Ga0500562_004557
480 Ga0500592_005546
481 Ga0500595_035180
482 Ga0500595_038098
483 Ga0500614_008701
484 Ga0500642_0026610
485 Ga0500559_0012469
486 Ga0500568_0006229
487 Ga0500568_0023347
488 Ga0500616_0010100
489 Ga0500619_004398
490 Ga0500627_0001129
491 Ga0500633_0021839
492 Ga0500636_0000807
493 Ga0500601_000088
494 Ga0501082_0300093
495 2508541011
496 2511399979
497 2513641536
498 2513653892
499 2513692965
500 2513703999
501 2513856326
502 2513918232
503 2514014922
504 2517891538
505 2524463710
506 2524471090
507 2524538697
508 2528857567
509 2617349928
510 2671118691
511 2793066901
512 2838126684
513 2841949135
514 2841974095
515 2874612289
516 2874630717
517 2885371647
518 2885380395
519 2885418388
520 2889036562
521 2903734206
522 2904704755
523 2904705361
524 2906616713
525 2906628656
526 2906639829
527 2906667041
528 2908741881
529 2908782335
530 2922431257
531 2932798618
532 2932806490
533 2932824516
534 2935633855
535 2935635901
536 2935684391
537 2935804871
538 2935888671
539 2935964859
540 2941510842
541 2941512532
542 2941518226
543 2941520233
544 2941526903
545 2941528371
546 2941536533
547 3005481054
548 3005485247
549 3005601022
550 3005723790
551 8002060638
552 8002062242
553 8006929576
554 8006939657
555 8006942967
556 8006979406
557 8006982687
558 8006997276
559 8019565549
560 8019575645
561 8019580387
562 8019603228
563 8019615303
564 8019647931
565 8019655295
566 8019664109
567 8056676802
568 8056684954
569 8056685696
570 8056973354

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

183

238

0.97

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

8

187

0.92

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

184

310

0.9

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

9

190

0.88

PF04321

RmlD_sub_bind

RmlD substrate binding domain

6

183

0.84

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

8

140

0.81

PF07993

NAD_binding_4

Male sterility protein

71

228

0.76

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

9

182

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bi4-assembly2.cif.gz_B 2.9 angstrom resolution crystal structure of dtdp-glucose 4,6-dehydratase (rfbb) from bacillus anthracis str. ames in complex with nad. 0.9646 6 341
6bi4-assembly2.cif.gz_C 2.9 angstrom resolution crystal structure of dtdp-glucose 4,6-dehydratase (rfbb) from bacillus anthracis str. ames in complex with nad. 0.964 6 341
6bi4-assembly2.cif.gz_B 2.9 angstrom resolution crystal structure of dtdp-glucose 4,6-dehydratase (rfbb) from bacillus anthracis str. ames in complex with nad. 0.9554 6 341
6bi4-assembly2.cif.gz_C 2.9 angstrom resolution crystal structure of dtdp-glucose 4,6-dehydratase (rfbb) from bacillus anthracis str. ames in complex with nad. 0.9549 6 341
1g1a-assembly1.cif.gz_A the crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb)from salmonella enterica serovar typhimurium 0.942 7 348
ID Description Score Start End Superfamily
4egbB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9393 6 317 3.40.50.720
1bxkA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9358 6 321 3.40.50.720
4egbB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9349 6 317 3.40.50.720
1bxkA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9285 6 321 3.40.50.720
2p5yA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9098 7 255 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A662ZRW6-F1-model_v4 deleted 0.9902 176 333
AF-A0A444QZH8-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9876 158 324
AF-A0A7C3TH40-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9759 132 341
AF-A0A349Y3Z6-F1-model_v4 dTDP-glucose 4,6-dehydratase 0.9743 112 347
AF-A0A257JNA2-F1-model_v4 NAD(P)-binding domain-containing protein 0.9736 142 344

Map