F387096

General Info

Members Datasets Scaffolds Average Seq Length
285 143 285 331

Family's Representative Sequence

Representative Sequence 3300049742|Ga0501080_0107203|Ga0501080_0107203_247_1362
Length 371
Sequence VVNKPTDQMTNRLIDQVEMSETVQSPKIRLTSMAACAGCAAKLKAETLAELLKPLQGIFDPIDTPDLLVGLGQPDDAAVWRLDDDRALVVTTDFFTPVVDDPFDFGSIAAANAISDVYAMGGKPFLALNIATLPNDLPPEIGAAILRGGAEKAKEAGVVVAGGHTIQDKEPKYGLVVIGFVDPRKAISKQGARAGDVLFLTKPLGFGVTNTAVKRGIASAQHEAEVVSWMRRLNKSASELAQRFELRGGTDVTGFGLMGHGWEMAKGAGVQLRIDYNAVPFTSGARQYGEQGAFPGGSLDNRKFYGPHVVFEGDYQPWEQTLLFDAQTSGGLLLAVPAARAAEFAAEAQRAEQPAWRIGEVVAGSGILVHR

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
71 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
74 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
75 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
78 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
79 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
80 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
81 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
82 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
83 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
84 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
85 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
86 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
87 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
88 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
89 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
90 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
91 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
93 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
94 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
95 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
96 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
99 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
100 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
101 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
102 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
103 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
104 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
105 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
106 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
107 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
108 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
109 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
110 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
113 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
114 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
123 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
124 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
125 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
126 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
127 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
128 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
129 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
130 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
133 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
134 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
135 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
136 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
137 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
138 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
141 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
142 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
143 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.05
Nodule 0
Rhizoplane 1.4
Rhizosphere 96.14
Stem 0
Stem Tuber 0
Unclassified 1.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000234 3300003203 Bacteria 24700
2 Ga0065712_10068906 3300005290 Bacteria 8603
3 Ga0065715_10205197 3300005293 Bacteria 1336
4 Ga0065707_10088744 3300005295 Bacteria 4565
5 Ga0065707_10095461 3300005295 Bacteria 3376
6 Ga0065707_10125271 3300005295 Bacteria 2027
7 Ga0070658_10040788 3300005327 Bacteria 3745
8 Ga0070676_10144771 3300005328 Bacteria 1516
9 Ga0070690_100079198 3300005330 Bacteria 2148
10 Ga0070670_100051619 3300005331 Bacteria 3531
11 Ga0070670_100206603 3300005331 Bacteria 1707
12 Ga0068869_100074964 3300005334 Bacteria 2513
13 Ga0070666_10178921 3300005335 Bacteria 1487
14 Ga0070680_100170200 3300005336 Bacteria 1833
15 Ga0070689_100079073 3300005340 Bacteria 2579
16 Ga0070689_100174988 3300005340 Bacteria 1740
17 Ga0070689_100202414 3300005340 Bacteria 1622
18 Ga0070689_100288725 3300005340 Bacteria 1363
19 Ga0070675_100007475 3300005354 Bacteria 8441
20 Ga0070675_100034782 3300005354 Bacteria 4090
21 Ga0070675_100041772 3300005354 Bacteria 3746
22 Ga0070671_100083090 3300005355 Bacteria 2678
23 Ga0070673_100004187 3300005364 Bacteria 9097
24 Ga0070673_100082295 3300005364 Bacteria 2613
25 Ga0070688_100013088 3300005365 Bacteria 4669
26 Ga0070688_100078422 3300005365 Bacteria 2131
27 Ga0070667_100256041 3300005367 Bacteria 1566
28 Ga0070701_10090038 3300005438 Bacteria 1679
29 Ga0070681_10144231 3300005458 Bacteria 2311
30 Ga0070685_10026376 3300005466 Bacteria 3202
31 Ga0070685_10085363 3300005466 Bacteria 1901
32 Ga0070706_100074627 3300005467 Bacteria 3139
33 Ga0070698_100099034 3300005471 Bacteria 2889
34 Ga0070699_100018683 3300005518 Bacteria 5952
35 Ga0070699_100036152 3300005518 Bacteria 4272
36 Ga0070699_100061110 3300005518 Bacteria 3265
37 Ga0070672_100088432 3300005543 Bacteria 2495
38 Ga0070686_100017288 3300005544 Bacteria 4212
39 Ga0070686_100122911 3300005544 Bacteria 1784
40 Ga0070695_100272208 3300005545 Bacteria 1241
41 Ga0070704_100450686 3300005549 Bacteria 1108
42 Ga0068855_100016439 3300005563 Bacteria 8895
43 Ga0070664_100136404 3300005564 Bacteria 2158
44 Ga0068856_100163226 3300005614 Bacteria 2239
45 Ga0068859_100022456 3300005617 Bacteria 6326
46 Ga0068861_100371825 3300005719 Unclassified 1260
47 Ga0068870_10026219 3300005840 Bacteria 2904
48 Ga0068858_100019835 3300005842 Bacteria 6286
49 Ga0068860_100005742 3300005843 Bacteria 12515
50 Ga0068862_100226172 3300005844 Bacteria 1696
51 Ga0081539_10000512 3300005985 Bacteria 80576
52 Ga0075367_10101353 3300006178 Bacteria 1760
53 Ga0075366_10001732 3300006195 Bacteria 10970
54 Ga0068871_100002412 3300006358 Bacteria 12753
55 Ga0075428_100101396 3300006844 Bacteria 3138
56 Ga0075428_100120700 3300006844 Bacteria 2854
57 Ga0075428_100149115 3300006844 Bacteria 2541
58 Ga0075428_100253621 3300006844 Bacteria 1895
59 Ga0075430_100004389 3300006846 Bacteria 11907
60 Ga0075430_100026750 3300006846 Bacteria 4906
61 Ga0075431_100029574 3300006847 Bacteria 5640
62 Ga0075431_100127442 3300006847 Bacteria 2626
63 Ga0075431_100144679 3300006847 Bacteria 2450
64 Ga0075431_100195599 3300006847 Bacteria 2070
65 Ga0075433_10023703 3300006852 Bacteria 5169
66 Ga0075433_10026192 3300006852 Unclassified 4934
67 Ga0075433_10119146 3300006852 Bacteria 2343
68 Ga0075433_10177244 3300006852 Bacteria 1897
69 Ga0075434_100045701 3300006871 Bacteria 4344
70 Ga0075434_100058712 3300006871 Bacteria 3824
71 Ga0075434_100291180 3300006871 Bacteria 1653
72 Ga0075429_100066845 3300006880 Bacteria 3129
73 Ga0075429_100249265 3300006880 Bacteria 1555
74 Ga0097620_100022457 3300006931 Bacteria 6326
75 Ga0097620_100556105 3300006931 Unclassified 1242
76 Ga0111539_10001724 3300009094 Bacteria 29113
77 Ga0111539_10001913 3300009094 Bacteria 27727
78 Ga0111539_10005748 3300009094 Bacteria 16038
79 Ga0111539_10256815 3300009094 Bacteria 2035
80 Ga0111539_10317964 3300009094 Bacteria 1812
81 Ga0114129_10003064 3300009147 Bacteria 23441
82 Ga0114129_10010331 3300009147 Bacteria 13317
83 Ga0114129_10049118 3300009147 Bacteria 5930
84 Ga0114129_10098811 3300009147 Bacteria 4040
85 Ga0114129_10165351 3300009147 Bacteria 3020
86 Ga0114129_10266481 3300009147 Bacteria 2293
87 Ga0105243_10208433 3300009148 Unclassified 1719
88 Ga0105248_10188626 3300009177 Bacteria 2323
89 Ga0105238_10000300 3300009551 Bacteria 54195
90 Ga0157370_10019683 3300013104 Bacteria 6760
91 Ga0213876_10028481 3300021384 Bacteria 2946
92 Ga0207684_10187850 3300025910 Bacteria 1782
93 Ga0207694_10031348 3300025924 Unclassified 4060
94 Ga0207650_10161694 3300025925 Bacteria 1774
95 Ga0207659_10000536 3300025926 Bacteria 22653
96 Ga0207659_10007200 3300025926 Bacteria 6833
97 Ga0207709_10112808 3300025935 Bacteria 1821
98 Ga0207670_10031306 3300025936 Bacteria 3408
99 Ga0207670_10075433 3300025936 Bacteria 2344
100 Ga0207670_10146610 3300025936 Bacteria 1746
101 Ga0207691_10118340 3300025940 Bacteria 2350
102 Ga0207651_10007757 3300025960 Bacteria 5737
103 Ga0207651_10015463 3300025960 Bacteria 4435
104 Ga0207712_10097471 3300025961 Unclassified 2178
105 Ga0207658_10221291 3300025986 Bacteria 1593
106 Ga0207703_10088224 3300026035 Bacteria 2603
107 Ga0207702_10188694 3300026078 Bacteria 1903
108 Ga0207674_10009701 3300026116 Bacteria 10973
109 Ga0207675_100089302 3300026118 Bacteria 2896
110 Ga0209981_1007157 3300027378 Bacteria 1502
111 Ga0207428_10001320 3300027907 Bacteria 26408
112 Ga0207428_10013750 3300027907 Bacteria 7056
113 Ga0207428_10018515 3300027907 Bacteria 5946
114 Ga0207428_10203416 3300027907 Bacteria 1490
115 Ga0268265_10344027 3300028380 Bacteria 1359
116 Ga0268264_10020988 3300028381 Bacteria 5336
117 Ga0265326_10030535 3300028558 Bacteria 1535
118 Ga0265334_10021314 3300028573 Bacteria 2647
119 Ga0265318_10016175 3300028577 Bacteria 3086
120 Ga0265318_10040544 3300028577 Bacteria 1772
121 Ga0265338_10004569 3300028800 Bacteria 18625
122 Ga0265338_10029955 3300028800 Bacteria 5380
123 Ga0265328_10021844 3300031239 Bacteria 2439
124 Ga0265320_10029052 3300031240 Bacteria 2865
125 Ga0265320_10042007 3300031240 Bacteria 2271
126 Ga0265325_10037210 3300031241 Bacteria 2573
127 Ga0265340_10000496 3300031247 Bacteria 21514
128 Ga0265339_10078116 3300031249 Bacteria 1753
129 Ga0265331_10008990 3300031250 Bacteria 5645
130 Ga0265316_10012384 3300031344 Bacteria 7653
131 Ga0316575_10002821 3300031665 Bacteria 5886
132 Ga0316579_10026493 3300031691 Bacteria 2626
133 Ga0316579_10050970 3300031691 Bacteria 1936
134 Ga0265314_10006268 3300031711 Bacteria 10551
135 Ga0265342_10046192 3300031712 Bacteria 2618
136 Ga0316578_10030454 3300031728 Bacteria 3068
137 Ga0316578_10092165 3300031728 Bacteria 1811
138 Ga0316578_10115259 3300031728 Bacteria 1614
139 Ga0316578_10221314 3300031728 Bacteria 1138
140 Ga0316577_10003013 3300031733 Bacteria 8440
141 Ga0316577_10024483 3300031733 Bacteria 3357
142 Ga0316577_10102593 3300031733 Bacteria 1604
143 Ga0316577_10155635 3300031733 Bacteria 1289
144 Ga0307416_100073423 3300032002 Bacteria 2852
145 Ga0316593_10017528 3300032168 Bacteria 2186
146 Ga0373930_0027576 3300034816 Bacteria 1152
147 Ga0373936_0103805 3300035113 Bacteria 1201
148 Ga0316574_0009212 3300035398 Bacteria 5521
149 Ga0316582_0002884 3300036647 Bacteria 8250
150 Ga0316582_0007180 3300036647 Bacteria 5921
151 Ga0316582_0049237 3300036647 Bacteria 2666
152 Ga0316582_0070755 3300036647 Bacteria 2258
153 Ga0316582_0238960 3300036647 Bacteria 1244
154 Ga0316582_0274706 3300036647 Bacteria 1156
155 Ga0316584_0002393 3300036712 Bacteria 11848
156 Ga0316584_0016407 3300036712 Bacteria 5310
157 Ga0316584_0037363 3300036712 Unclassified 3608
158 Ga0316584_0090325 3300036712 Bacteria 2293
159 Ga0316584_0161364 3300036712 Bacteria 1665
160 Ga0316584_0319508 3300036712 Bacteria 1120
161 Ga0395905_0000034 3300037471 Bacteria 275823
162 Ga0316581_0009211 3300037588 Bacteria 2709
163 Ga0400489_15085 3300039093 Bacteria 1565
164 Ga0400489_40586 3300039093 Bacteria 10297
165 Ga0436365_1336268 3300039437 Bacteria 2818
166 Ga0451577_0000014 3300042876 Bacteria 546755
167 Ga0451577_0000047 3300042876 Bacteria 312768
168 Ga0451577_0000106 3300042876 Bacteria 184359
169 Ga0451577_0002199 3300042876 Bacteria 23762
170 Ga0451577_0006364 3300042876 Bacteria 11794
171 Ga0451577_0013285 3300042876 Bacteria 7714
172 Ga0451577_0068579 3300042876 Bacteria 3163
173 Ga0451577_0069351 3300042876 Bacteria 3144
174 Ga0451577_0076343 3300042876 Bacteria 2987
175 Ga0451577_0115976 3300042876 Bacteria 2398
176 Ga0451577_0226944 3300042876 Bacteria 1688
177 Ga0451577_0231461 3300042876 Bacteria 1671
178 Ga0451577_0259389 3300042876 Unclassified 1574
179 Ga0453683_0000266 3300044673 Bacteria 68566
180 Ga0453683_0001278 3300044673 Bacteria 22307
181 Ga0453683_0017518 3300044673 Bacteria 4612
182 Ga0453683_0047395 3300044673 Bacteria 2695
183 Ga0453684_0000611 3300044712 Bacteria 131332
184 Ga0453684_0000980 3300044712 Bacteria 93444
185 Ga0453684_0001289 3300044712 Bacteria 74584
186 Ga0453684_0002065 3300044712 Bacteria 51053
187 Ga0453684_0002223 3300044712 Bacteria 48145
188 Ga0453684_0004667 3300044712 Bacteria 28432
189 Ga0453684_0004901 3300044712 Bacteria 27401
190 Ga0453684_0005752 3300044712 Bacteria 24219
191 Ga0453684_0008046 3300044712 Bacteria 19078
192 Ga0453684_0008610 3300044712 Bacteria 18189
193 Ga0453684_0016064 3300044712 Bacteria 11752
194 Ga0453684_0056728 3300044712 Bacteria 5077
195 Ga0453684_0061793 3300044712 Bacteria 4805
196 Ga0453684_0073930 3300044712 Bacteria 4294
197 Ga0453684_0092291 3300044712 Bacteria 3733
198 Ga0453684_0149860 3300044712 Bacteria 2773
199 Ga0453684_0219430 3300044712 Bacteria 2204
200 Ga0453684_0233788 3300044712 Bacteria 2120
201 Ga0453684_0253079 3300044712 Unclassified 2022
202 Ga0453684_0327587 3300044712 Unclassified 1733
203 Ga0453684_0498900 3300044712 Unclassified 1348
204 Ga0453684_0559062 3300044712 Bacteria 1259
205 Ga0453684_0567272 3300044712 Bacteria 1248
206 Ga0453684_0654994 3300044712 Unclassified 1145
207 Ga0453684_0668192 3300044712 Bacteria 1132
208 Ga0451576_0000189 3300045051 Bacteria 155001
209 Ga0451576_0000817 3300045051 Bacteria 60779
210 Ga0451576_0002574 3300045051 Bacteria 26714
211 Ga0451576_0005639 3300045051 Bacteria 15627
212 Ga0451576_0008801 3300045051 Bacteria 11803
213 Ga0451576_0010194 3300045051 Bacteria 10804
214 Ga0451576_0014859 3300045051 Bacteria 8651
215 Ga0451576_0043344 3300045051 Bacteria 4749
216 Ga0451576_0137289 3300045051 Bacteria 2550
217 Ga0451576_0153697 3300045051 Bacteria 2400
218 Ga0451576_0176205 3300045051 Bacteria 2232
219 Ga0451576_0203740 3300045051 Bacteria 2066
220 Ga0451576_0247365 3300045051 Bacteria 1863
221 Ga0451576_0291157 3300045051 Bacteria 1707
222 Ga0495639_0089176 3300046475 Bacteria 1445
223 Ga0495640_0057187 3300046533 Bacteria 2663
224 Ga0495586_0072834 3300046535 Bacteria 1879
225 Ga0495621_0029610 3300046539 Bacteria 1867
226 Ga0495656_0012688 3300046615 Bacteria 3116
227 Ga0495636_0009077 3300047318 Bacteria 3910
228 Ga0496102_0104300 3300048905 Bacteria 2637
229 Ga0496104_0122393 3300048907 Unclassified 2497
230 Ga0496104_0319665 3300048907 Bacteria 1465
231 Ga0496109_0006188 3300048912 Bacteria 10061
232 Ga0501034_0001918 3300049571 Bacteria 26321
233 Ga0501034_0007634 3300049571 Bacteria 11505
234 Ga0501036_0088740 3300049572 Bacteria 2613
235 Ga0501037_0031594 3300049573 Bacteria 3910
236 Ga0501038_0121918 3300049574 Bacteria 2149
237 Ga0501039_0240822 3300049575 Bacteria 1422
238 Ga0501040_0040606 3300049576 Bacteria 3166
239 Ga0501041_0034338 3300049577 Bacteria 3070
240 Ga0501048_0152162 3300049582 Bacteria 1637
241 Ga0501068_0008651 3300049584 Bacteria 5674
242 Ga0501072_0037121 3300049588 Bacteria 3822
243 Ga0501072_0151794 3300049588 Bacteria 1847
244 Ga0501073_0021026 3300049589 Bacteria 4708
245 Ga0501074_0094123 3300049590 Bacteria 2146
246 Ga0501074_0105366 3300049590 Bacteria 2019
247 Ga0501075_0001032 3300049591 Bacteria 17863
248 Ga0501075_0005914 3300049591 Bacteria 8370
249 Ga0501075_0057989 3300049591 Bacteria 2916
250 Ga0501077_0000106 3300049593 Bacteria 44096
251 Ga0501077_0120391 3300049593 Bacteria 1663
252 Ga0501077_0254158 3300049593 Unclassified 1118
253 Ga0501079_0019924 3300049741 Bacteria 5124
254 Ga0501080_0003125 3300049742 Bacteria 14599
255 Ga0501080_0107203 3300049742 Bacteria 2589
256 Ga0501080_0154310 3300049742 Bacteria 2121
257 Ga0501081_0008664 3300049743 Bacteria 6609
258 Ga0501044_0056432 3300049823 Bacteria 4033
259 Ga0501045_0262214 3300049824 Bacteria 1286
260 nmdc:mga05p37_145836_c1 3300050507 Bacteria 2899
261 nmdc:mga05p37_15306_c1 3300050507 Bacteria 9215
262 nmdc:mga05p37_31792_c1 3300050507 Bacteria 6449
263 nmdc:mga05p37_34061_c1 3300050507 Bacteria 6239
264 nmdc:mga05p37_56412_c1 3300050507 Bacteria 4837
265 nmdc:mga09592_39610_c1 3300050508 Bacteria 3959
266 nmdc:mga0qj67_1311_c1 3300050509 Bacteria 17454
267 nmdc:mga0qj67_75894_c1 3300050509 Bacteria 2687
268 nmdc:mga06r32_101660_c1 3300050510 Bacteria 2822
269 nmdc:mga06r32_172680_c1 3300050510 Bacteria 2146
270 nmdc:mga06r32_61559_c1 3300050510 Bacteria 3613
271 nmdc:mga08y16_1791_c1 3300050511 Bacteria 21772
272 nmdc:mga08y16_20755_c1 3300050511 Bacteria 6935
273 nmdc:mga08y16_267029_c1 3300050511 Bacteria 1767
274 nmdc:mga08y16_467_c1 3300050511 Bacteria 37584
275 nmdc:mga0n895_67545_c1 3300050512 Bacteria 3540
276 nmdc:mga0a205_128451_c1 3300050515 Bacteria 2434
277 Ga0500616_0049866 3300053153 Bacteria 2213
278 Ga0501084_0014858 3300054114 Bacteria 6456
279 Ga0501084_0061025 3300054114 Bacteria 3156
280 Ga0501084_0074976 3300054114 Bacteria 2834
281 Ga0501084_0114984 3300054114 Bacteria 2262
282 Ga0501082_0000833 3300060353 Bacteria 27114
283 Ga0501082_0057335 3300060353 Bacteria 3356
284 Ga0530510_0060475 3300061734 Bacteria 2742
285 Ga0530510_0061148 3300061734 Bacteria 2727

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_0068579 Ga0451577_0068579_812_1735 276
2 3300044712 Ga0453684_0149860 Ga0453684_0149860_1069_1959 276
3 3300044712 Ga0453684_0092291 Ga0453684_0092291_929_1819 281
4 3300042876 Ga0451577_0000014 Ga0451577_0000014_402774_403739 282
5 3300042876 Ga0451577_0013285 Ga0451577_0013285_2598_3563 282
6 3300044712 Ga0453684_0016064 Ga0453684_0016064_4847_5812 282
7 3300044712 Ga0453684_0668192 Ga0453684_0668192_126_1091 282
8 3300045051 Ga0451576_0137289 Ga0451576_0137289_1443_2408 282
9 3300045051 Ga0451576_0153697 Ga0451576_0153697_157_1089 282
10 3300044673 Ga0453683_0017518 Ga0453683_0017518_395_1348 286
11 3300044712 Ga0453684_0233788 Ga0453684_0233788_1105_2022 286
12 3300045051 Ga0451576_0008801 Ga0451576_0008801_5759_6712 286
13 3300042876 Ga0451577_0076343 Ga0451577_0076343_931_1845 289
14 3300044712 Ga0453684_0004667 Ga0453684_0004667_20372_21259 293
15 3300049572 Ga0501036_0088740 Ga0501036_0088740_1229_2119 293
16 3300049577 Ga0501041_0034338 Ga0501041_0034338_275_1165 293
17 3300049582 Ga0501048_0152162 Ga0501048_0152162_18_908 293
18 3300054114 Ga0501084_0114984 Ga0501084_0114984_176_1066 293
19 3300044712 Ga0453684_0002065 Ga0453684_0002065_26375_27265 294
20 3300044712 Ga0453684_0056728 Ga0453684_0056728_163_1053 294
21 3300044712 Ga0453684_0567272 Ga0453684_0567272_22_912 294
22 3300045051 Ga0451576_0176205 Ga0451576_0176205_739_1629 294
23 3300045051 Ga0451576_0247365 Ga0451576_0247365_823_1713 294
24 3300036647 Ga0316582_0070755 Ga0316582_0070755_421_1395 297
25 3300039093 Ga0400489_15085 Ga0400489_15085_318_1268 297
26 3300005295 Ga0065707_10095461 Ga0065707_100954613 301
27 3300005719 Ga0068861_100371825 Ga0068861_1003718251 301
28 3300009147 Ga0114129_10010331 Ga0114129_100103317 301
29 3300025961 Ga0207712_10097471 Ga0207712_100974712 301
30 3300027378 Ga0209981_1007157 Ga0209981_10071572 301
31 3300032002 Ga0307416_100073423 Ga0307416_1000734232 301
32 3300036647 Ga0316582_0238960 Ga0316582_0238960_283_1233 301
33 3300044673 Ga0453683_0047395 Ga0453683_0047395_234_1145 301
34 3300044712 Ga0453684_0559062 Ga0453684_0559062_284_1192 301
35 3300045051 Ga0451576_0000817 Ga0451576_0000817_7500_8408 301
36 3300049588 Ga0501072_0151794 Ga0501072_0151794_633_1544 301
37 3300049590 Ga0501074_0105366 Ga0501074_0105366_670_1581 301
38 3300049591 Ga0501075_0005914 Ga0501075_0005914_268_1179 301
39 3300049593 Ga0501077_0254158 Ga0501077_0254158_72_983 301
40 3300049742 Ga0501080_0154310 Ga0501080_0154310_391_1302 301
41 3300050509 nmdc:mga0qj67_75894_c1 nmdc:mga0qj67_75894_c1_1609_2517 301
42 3300054114 Ga0501084_0061025 Ga0501084_0061025_2220_3131 301
43 3300005295 Ga0065707_10088744 Ga0065707_100887442 302
44 3300005471 Ga0070698_100099034 Ga0070698_1000990342 302
45 3300005518 Ga0070699_100018683 Ga0070699_1000186836 302
46 3300006852 Ga0075433_10026192 Ga0075433_100261924 302
47 3300006871 Ga0075434_100058712 Ga0075434_1000587122 302
48 3300025936 Ga0207670_10031306 Ga0207670_100313062 302
49 3300031728 Ga0316578_10115259 Ga0316578_101152592 302
50 3300031733 Ga0316577_10155635 Ga0316577_101556351 302
51 3300044712 Ga0453684_0253079 Ga0453684_0253079_229_1140 302
52 3300044712 Ga0453684_0327587 Ga0453684_0327587_628_1542 302
53 3300044712 Ga0453684_0498900 Ga0453684_0498900_368_1282 302
54 3300044712 Ga0453684_0654994 Ga0453684_0654994_135_1049 302
55 3300050507 nmdc:mga05p37_56412_c1 nmdc:mga05p37_56412_c1_2467_3381 302
56 3300050512 nmdc:mga0n895_67545_c1 nmdc:mga0n895_67545_c1_631_1545 302
57 3300005518 Ga0070699_100036152 Ga0070699_1000361521 303
58 3300005545 Ga0070695_100272208 Ga0070695_1002722081 303
59 3300009148 Ga0105243_10208433 Ga0105243_102084332 303
60 3300031691 Ga0316579_10026493 Ga0316579_100264932 303
61 3300042876 Ga0451577_0000047 Ga0451577_0000047_58556_59494 303
62 3300044712 Ga0453684_0000611 Ga0453684_0000611_71839_72777 303
63 3300044712 Ga0453684_0073930 Ga0453684_0073930_1367_2338 303
64 3300045051 Ga0451576_0000189 Ga0451576_0000189_26260_27177 303
65 3300042876 Ga0451577_0002199 Ga0451577_0002199_20545_21543 304
66 3300044712 Ga0453684_0004901 Ga0453684_0004901_1847_2845 304
67 3300045051 Ga0451576_0002574 Ga0451576_0002574_24557_25555 304
68 3300006844 Ga0075428_100120700 Ga0075428_1001207002 306
69 3300042876 Ga0451577_0226944 Ga0451577_0226944_425_1387 306
70 3300044673 Ga0453683_0001278 Ga0453683_0001278_18647_19579 306
71 3300005340 Ga0070689_100202414 Ga0070689_1002024142 307
72 3300005466 Ga0070685_10085363 Ga0070685_100853633 307
73 3300026116 Ga0207674_10009701 Ga0207674_100097014 307
74 3300045051 Ga0451576_0043344 Ga0451576_0043344_1043_1984 307
75 3300046475 Ga0495639_0089176 Ga0495639_0089176_107_1048 307
76 3300046535 Ga0495586_0072834 Ga0495586_0072834_532_1473 307
77 3300006931 Ga0097620_100556105 Ga0097620_1005561051 308
78 3300031733 Ga0316577_10102593 Ga0316577_101025932 308
79 3300036712 Ga0316584_0037363 Ga0316584_0037363_2516_3460 308
80 3300036712 Ga0316584_0090325 Ga0316584_0090325_123_1064 308
81 3300047318 Ga0495636_0009077 Ga0495636_0009077_1207_2151 308
82 3300005617 Ga0068859_100022456 Ga0068859_1000224568 309
83 3300006931 Ga0097620_100022457 Ga0097620_1000224571 309
84 3300036647 Ga0316582_0049237 Ga0316582_0049237_416_1378 309
85 3300042876 Ga0451577_0115976 Ga0451577_0115976_1114_2139 309
86 3300044712 Ga0453684_0005752 Ga0453684_0005752_1844_2869 309
87 3300045051 Ga0451576_0203740 Ga0451576_0203740_954_1979 309
88 3300031733 Ga0316577_10024483 Ga0316577_100244832 310
89 3300036712 Ga0316584_0016407 Ga0316584_0016407_478_1467 310
90 3300005467 Ga0070706_100074627 Ga0070706_1000746273 311
91 3300025910 Ga0207684_10187850 Ga0207684_101878502 311
92 3300028558 Ga0265326_10030535 Ga0265326_100305352 311
93 3300028573 Ga0265334_10021314 Ga0265334_100213142 311
94 3300028577 Ga0265318_10016175 Ga0265318_100161752 311
95 3300028800 Ga0265338_10029955 Ga0265338_100299555 311
96 3300031239 Ga0265328_10021844 Ga0265328_100218442 311
97 3300031240 Ga0265320_10042007 Ga0265320_100420072 311
98 3300031247 Ga0265340_10000496 Ga0265340_100004962 311
99 3300031250 Ga0265331_10008990 Ga0265331_100089902 311
100 3300031665 Ga0316575_10002821 Ga0316575_100028213 311
101 3300035113 Ga0373936_0103805 Ga0373936_0103805_245_1183 311
102 3300036647 Ga0316582_0274706 Ga0316582_0274706_97_1050 311
103 3300042876 Ga0451577_0259389 Ga0451577_0259389_350_1300 311
104 3300044712 Ga0453684_0002223 Ga0453684_0002223_11793_12743 311
105 3300044712 Ga0453684_0008046 Ga0453684_0008046_2864_3838 311
106 3300045051 Ga0451576_0014859 Ga0451576_0014859_769_1725 311
107 3300042876 Ga0451577_0006364 Ga0451577_0006364_4953_5918 313
108 3300044673 Ga0453683_0000266 Ga0453683_0000266_46989_47954 313
109 3300044712 Ga0453684_0001289 Ga0453684_0001289_57570_58535 313
110 3300044712 Ga0453684_0061793 Ga0453684_0061793_3764_4726 313
111 3300044712 Ga0453684_0219430 Ga0453684_0219430_758_1717 313
112 3300045051 Ga0451576_0005639 Ga0451576_0005639_11400_12365 313
113 3300048907 Ga0496104_0319665 Ga0496104_0319665_199_1170 313
114 3300061734 Ga0530510_0061148 Ga0530510_0061148_569_1528 313
115 3300025935 Ga0207709_10112808 Ga0207709_101128083 315
116 3300031728 Ga0316578_10030454 Ga0316578_100304544 315
117 3300031728 Ga0316578_10092165 Ga0316578_100921652 315
118 3300031728 Ga0316578_10221314 Ga0316578_102213141 315
119 3300032168 Ga0316593_10017528 Ga0316593_100175281 315
120 3300035398 Ga0316574_0009212 Ga0316574_0009212_3548_4519 315
121 3300036647 Ga0316582_0002884 Ga0316582_0002884_3564_4526 315
122 3300036647 Ga0316582_0007180 Ga0316582_0007180_2143_3114 315
123 3300036712 Ga0316584_0161364 Ga0316584_0161364_553_1524 315
124 3300036712 Ga0316584_0319508 Ga0316584_0319508_68_1030 315
125 3300037588 Ga0316581_0009211 Ga0316581_0009211_460_1425 315
126 3300042876 Ga0451577_0231461 Ga0451577_0231461_19_987 315
127 3300044712 Ga0453684_0008610 Ga0453684_0008610_16498_17463 316
128 3300045051 Ga0451576_0010194 Ga0451576_0010194_8014_8982 316
129 3300006847 Ga0075431_100195599 Ga0075431_1001955992 319
130 3300028800 Ga0265338_10004569 Ga0265338_1000456917 319
131 3300031344 Ga0265316_10012384 Ga0265316_100123846 319
132 3300031691 Ga0316579_10050970 Ga0316579_100509701 319
133 3300050510 nmdc:mga06r32_172680_c1 nmdc:mga06r32_172680_c1_32_1087 319
134 3300031733 Ga0316577_10003013 Ga0316577_100030136 320
135 3300036712 Ga0316584_0002393 Ga0316584_0002393_331_1323 320
136 3300039093 Ga0400489_40586 Ga0400489_40586_3041_4033 320
137 3300042876 Ga0451577_0000106 Ga0451577_0000106_179986_181047 321
138 3300042876 Ga0451577_0069351 Ga0451577_0069351_954_2015 321
139 3300044712 Ga0453684_0000980 Ga0453684_0000980_89844_90905 321
140 3300045051 Ga0451576_0291157 Ga0451576_0291157_445_1506 321
141 3300005458 Ga0070681_10144231 Ga0070681_101442311 322
142 3300005844 Ga0068862_100226172 Ga0068862_1002261722 322
143 3300028380 Ga0268265_10344027 Ga0268265_103440272 322
144 3300034816 Ga0373930_0027576 Ga0373930_0027576_60_1109 322
145 3300048905 Ga0496102_0104300 Ga0496102_0104300_1451_2500 322
146 3300005334 Ga0068869_100074964 Ga0068869_1000749642 324
147 3300009094 Ga0111539_10005748 Ga0111539_1000574815 324
148 3300009147 Ga0114129_10098811 Ga0114129_100988113 324
149 3300050507 nmdc:mga05p37_31792_c1 nmdc:mga05p37_31792_c1_1479_2453 324
150 3300050511 nmdc:mga08y16_20755_c1 nmdc:mga08y16_20755_c1_5662_6636 324
151 3300006846 Ga0075430_100004389 Ga0075430_1000043899 327
152 3300006847 Ga0075431_100029574 Ga0075431_1000295742 327
153 3300006880 Ga0075429_100249265 Ga0075429_1002492652 327
154 3300009147 Ga0114129_10003064 Ga0114129_1000306413 327
155 3300050507 nmdc:mga05p37_15306_c1 nmdc:mga05p37_15306_c1_4105_5154 327
156 3300050509 nmdc:mga0qj67_1311_c1 nmdc:mga0qj67_1311_c1_15709_16758 327
157 3300049589 Ga0501073_0021026 Ga0501073_0021026_48_1067 329
158 3300005331 Ga0070670_100051619 Ga0070670_1000516193 330
159 3300005564 Ga0070664_100136404 Ga0070664_1001364043 330
160 3300025925 Ga0207650_10161694 Ga0207650_101616943 330
161 3300053153 Ga0500616_0049866 Ga0500616_0049866_499_1566 332
162 3300037471 Ga0395905_0000034 Ga0395905_0000034_174993_176030 338
163 3300021384 Ga0213876_10028481 Ga0213876_100284813 339
164 3300028577 Ga0265318_10040544 Ga0265318_100405442 339
165 3300031240 Ga0265320_10029052 Ga0265320_100290523 339
166 3300031249 Ga0265339_10078116 Ga0265339_100781162 339
167 3300031711 Ga0265314_10006268 Ga0265314_100062686 339
168 3300031712 Ga0265342_10046192 Ga0265342_100461922 339
169 3300039437 Ga0436365_1336268 Ga0436365_1336268_465_1496 339
170 3300005293 Ga0065715_10205197 Ga0065715_102051972 340
171 3300049571 Ga0501034_0001918 Ga0501034_0001918_9623_10672 340
172 3300005614 Ga0068856_100163226 Ga0068856_1001632262 341
173 3300009551 Ga0105238_10000300 Ga0105238_1000030024 341
174 3300025924 Ga0207694_10031348 Ga0207694_100313483 341
175 3300026078 Ga0207702_10188694 Ga0207702_101886942 341
176 3300048907 Ga0496104_0122393 Ga0496104_0122393_35_1093 341
177 3300049571 Ga0501034_0007634 Ga0501034_0007634_8892_9947 341
178 3300049823 Ga0501044_0056432 Ga0501044_0056432_2375_3430 341
179 3300005438 Ga0070701_10090038 Ga0070701_100900382 342
180 3300049573 Ga0501037_0031594 Ga0501037_0031594_303_1394 342
181 3300049574 Ga0501038_0121918 Ga0501038_0121918_533_1624 342
182 3300049742 Ga0501080_0107203 Ga0501080_0107203_247_1362 342
183 3300054114 Ga0501084_0074976 Ga0501084_0074976_216_1277 342
184 3300005328 Ga0070676_10144771 Ga0070676_101447711 344
185 3300005330 Ga0070690_100079198 Ga0070690_1000791981 344
186 3300005335 Ga0070666_10178921 Ga0070666_101789211 344
187 3300005340 Ga0070689_100174988 Ga0070689_1001749883 344
188 3300005354 Ga0070675_100034782 Ga0070675_1000347822 344
189 3300005364 Ga0070673_100082295 Ga0070673_1000822953 344
190 3300005365 Ga0070688_100013088 Ga0070688_1000130882 344
191 3300005367 Ga0070667_100256041 Ga0070667_1002560413 344
192 3300005466 Ga0070685_10026376 Ga0070685_100263762 344
193 3300005543 Ga0070672_100088432 Ga0070672_1000884322 344
194 3300005544 Ga0070686_100017288 Ga0070686_1000172884 344
195 3300005549 Ga0070704_100450686 Ga0070704_1004506861 344
196 3300006852 Ga0075433_10023703 Ga0075433_100237033 344
197 3300006871 Ga0075434_100291180 Ga0075434_1002911802 344
198 3300009147 Ga0114129_10266481 Ga0114129_102664812 344
199 3300025926 Ga0207659_10007200 Ga0207659_100072003 344
200 3300025936 Ga0207670_10146610 Ga0207670_101466103 344
201 3300025940 Ga0207691_10118340 Ga0207691_101183403 344
202 3300025960 Ga0207651_10015463 Ga0207651_100154633 344
203 3300025986 Ga0207658_10221291 Ga0207658_102212913 344
204 3300050507 nmdc:mga05p37_145836_c1 nmdc:mga05p37_145836_c1_505_1563 344
205 3300005327 Ga0070658_10040788 Ga0070658_100407881 345
206 3300005331 Ga0070670_100206603 Ga0070670_1002066032 345
207 3300005355 Ga0070671_100083090 Ga0070671_1000830903 345
208 3300005340 Ga0070689_100288725 Ga0070689_1002887251 346
209 3300005563 Ga0068855_100016439 Ga0068855_1000164396 346
210 3300005842 Ga0068858_100019835 Ga0068858_1000198351 346
211 3300006178 Ga0075367_10101353 Ga0075367_101013532 346
212 3300006195 Ga0075366_10001732 Ga0075366_100017326 346
213 3300006358 Ga0068871_100002412 Ga0068871_10000241213 346
214 3300006852 Ga0075433_10177244 Ga0075433_101772442 346
215 3300009094 Ga0111539_10001724 Ga0111539_100017241 346
216 3300013104 Ga0157370_10019683 Ga0157370_100196833 346
217 3300027907 Ga0207428_10018515 Ga0207428_100185153 346
218 3300049575 Ga0501039_0240822 Ga0501039_0240822_157_1206 346
219 3300049584 Ga0501068_0008651 Ga0501068_0008651_995_2077 346
220 3300049591 Ga0501075_0001032 Ga0501075_0001032_7357_8439 346
221 3300049593 Ga0501077_0000106 Ga0501077_0000106_24469_25551 346
222 3300049593 Ga0501077_0120391 Ga0501077_0120391_463_1512 346
223 3300049742 Ga0501080_0003125 Ga0501080_0003125_4416_5498 346
224 3300050510 nmdc:mga06r32_61559_c1 nmdc:mga06r32_61559_c1_2423_3472 346
225 3300050511 nmdc:mga08y16_467_c1 nmdc:mga08y16_467_c1_1094_2134 346
226 3300060353 Ga0501082_0000833 Ga0501082_0000833_17134_18216 346
227 3300005290 Ga0065712_10068906 Ga0065712_100689069 347
228 3300005295 Ga0065707_10125271 Ga0065707_101252713 347
229 3300005336 Ga0070680_100170200 Ga0070680_1001702001 347
230 3300005340 Ga0070689_100079073 Ga0070689_1000790733 347
231 3300005354 Ga0070675_100041772 Ga0070675_1000417723 347
232 3300005365 Ga0070688_100078422 Ga0070688_1000784223 347
233 3300005840 Ga0068870_10026219 Ga0068870_100262193 347
234 3300006844 Ga0075428_100101396 Ga0075428_1001013964 347
235 3300006844 Ga0075428_100149115 Ga0075428_1001491152 347
236 3300006852 Ga0075433_10119146 Ga0075433_101191462 347
237 3300006871 Ga0075434_100045701 Ga0075434_1000457014 347
238 3300009094 Ga0111539_10001913 Ga0111539_1000191321 347
239 3300009094 Ga0111539_10317964 Ga0111539_103179642 347
240 3300025936 Ga0207670_10075433 Ga0207670_100754333 347
241 3300026118 Ga0207675_100089302 Ga0207675_1000893023 347
242 3300027907 Ga0207428_10001320 Ga0207428_1000132019 347
243 3300027907 Ga0207428_10203416 Ga0207428_102034161 347
244 3300048912 Ga0496109_0006188 Ga0496109_0006188_389_1432 347
245 3300050511 nmdc:mga08y16_1791_c1 nmdc:mga08y16_1791_c1_1870_2913 347
246 3300050511 nmdc:mga08y16_267029_c1 nmdc:mga08y16_267029_c1_292_1335 347
247 3300005843 Ga0068860_100005742 Ga0068860_1000057423 349
248 3300009177 Ga0105248_10188626 Ga0105248_101886262 349
249 3300026035 Ga0207703_10088224 Ga0207703_100882242 349
250 3300028381 Ga0268264_10020988 Ga0268264_100209883 349
251 3300031241 Ga0265325_10037210 Ga0265325_100372102 349
252 3300005354 Ga0070675_100007475 Ga0070675_1000074755 351
253 3300005364 Ga0070673_100004187 Ga0070673_1000041875 351
254 3300005544 Ga0070686_100122911 Ga0070686_1001229111 351
255 3300006844 Ga0075428_100253621 Ga0075428_1002536212 351
256 3300006846 Ga0075430_100026750 Ga0075430_1000267504 351
257 3300006847 Ga0075431_100127442 Ga0075431_1001274421 351
258 3300009147 Ga0114129_10165351 Ga0114129_101653512 351
259 3300025926 Ga0207659_10000536 Ga0207659_100005362 351
260 3300025960 Ga0207651_10007757 Ga0207651_100077576 351
261 3300027907 Ga0207428_10013750 Ga0207428_100137504 351
262 3300046539 Ga0495621_0029610 Ga0495621_0029610_689_1744 351
263 3300046615 Ga0495656_0012688 Ga0495656_0012688_1798_2853 351
264 3300050507 nmdc:mga05p37_34061_c1 nmdc:mga05p37_34061_c1_2285_3340 351
265 3300050508 nmdc:mga09592_39610_c1 nmdc:mga09592_39610_c1_1794_2849 351
266 3300050510 nmdc:mga06r32_101660_c1 nmdc:mga06r32_101660_c1_606_1661 351
267 3300003203 JGI25406J46586_10000234 JGI25406J46586_1000023420 352
268 3300005518 Ga0070699_100061110 Ga0070699_1000611102 352
269 3300005985 Ga0081539_10000512 Ga0081539_1000051235 352
270 3300006847 Ga0075431_100144679 Ga0075431_1001446793 352
271 3300006880 Ga0075429_100066845 Ga0075429_1000668453 352
272 3300009094 Ga0111539_10256815 Ga0111539_102568151 352
273 3300009147 Ga0114129_10049118 Ga0114129_100491183 352
274 3300046533 Ga0495640_0057187 Ga0495640_0057187_1306_2592 352
275 3300049576 Ga0501040_0040606 Ga0501040_0040606_844_1929 352
276 3300049588 Ga0501072_0037121 Ga0501072_0037121_2601_3686 352
277 3300049590 Ga0501074_0094123 Ga0501074_0094123_1000_2085 352
278 3300049591 Ga0501075_0057989 Ga0501075_0057989_1604_2689 352
279 3300049741 Ga0501079_0019924 Ga0501079_0019924_1396_2481 352
280 3300049743 Ga0501081_0008664 Ga0501081_0008664_2943_4028 352
281 3300049824 Ga0501045_0262214 Ga0501045_0262214_149_1234 352
282 3300050515 nmdc:mga0a205_128451_c1 nmdc:mga0a205_128451_c1_302_1360 352
283 3300054114 Ga0501084_0014858 Ga0501084_0014858_3109_4194 352
284 3300060353 Ga0501082_0057335 Ga0501082_0057335_1556_2641 352
285 3300061734 Ga0530510_0060475 Ga0530510_0060475_1463_2548 352

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00586

AIRS

AIR synthase related protein, N-terminal domain

74

181

0.97

PF02769

AIRS_C

AIR synthase related protein, C-terminal domain

193

370

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3u0o-assembly1.cif.gz_A the crystal structure of selenophosphate synthetase from e. coli 0.954 39 351
2zau-assembly1.cif.gz_B-2 crystal structure of an n-terminally truncated selenophosphate synthetase from aquifex aeolicus 0.9401 56 352
2zau-assembly1.cif.gz_A-2 crystal structure of an n-terminally truncated selenophosphate synthetase from aquifex aeolicus 0.9398 55 352
2zod-assembly1.cif.gz_B crystal structure of selenophosphate synthetase from aquifex aeolicus 0.9391 12 352
2yye-assembly1.cif.gz_A crystal structure of selenophosphate synthetase from aquifex aeolicus complexed with ampcpp 0.939 11 352
ID Description Score Start End Superfamily
3u0oA01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.9485 39 168 3.30.1330.10
af_Q7XTY9_163_289_2.60.40.200 Mainly Beta;Sandwich;Immunoglobulin-like;Superoxide dismutase, copper/zinc binding domain 0.9409 57 72 2.60.40.200
af_A0A0R0FXZ2_44_301_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9303 57 70 2.130.10.10
3u0oB02 Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain 0.9279 173 352 3.90.650.10
2yydA02 Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain 0.922 170 352 3.90.650.10
ID Description Score Start End GO Terms
AF-A0A2M8EFB7-F1-model_v4 Selenide, water dikinase SelD 0.9869 96 352 GO:0004756
GO:0005524
GO:0005737
GO:0016260
AF-A0A529IV71-F1-model_v4 deleted 0.9865 45 352
AF-A0A259PD58-F1-model_v4 Selenide, water dikinase SelD 0.9863 68 352 GO:0004756
GO:0005524
GO:0005737
GO:0016260
AF-C0AQN0-F1-model_v4 deleted 0.9862 76 160
AF-A0A1J5PP33-F1-model_v4 Selenide, water dikinase (EC 2.7.9.3) 0.9833 179 352 GO:0004756
GO:0005524
GO:0005737
GO:0016260

Feature Viewer

pLDDT pTM Quality
90.47 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map