F387090

General Info

Members Datasets Scaffolds Average Seq Length
285 213 570 127

Family's Representative Sequence

Representative Sequence 3300049592|Ga0501076_0803697|Ga0501076_0803697_51_476
Length 141
Sequence MFGVTVRDHVMIAHSFEGEVFGPAQRLHGATFVVDASFRRAELDPDGIVVDIALATGQLAAVLGDLNLRNLDDEPAFSGQNTTTEVLARVIADRLADRARAGDLGPGGRQLAGITVTLHESHVAWASYEWRSPVARDERAL

Samples

Sample ID Description Type Environment
1 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
69 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
70 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
71 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
72 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
73 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
76 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
77 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
80 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
81 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
82 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
83 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
84 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
85 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
86 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
87 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
89 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
90 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
97 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
98 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
99 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
100 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
101 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
102 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
103 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
104 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
105 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
106 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
107 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
108 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
109 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
110 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
111 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
112 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
115 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
116 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
117 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
118 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
119 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
120 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
121 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
122 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
123 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
124 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
125 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
126 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
127 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
128 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
129 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
130 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
131 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
132 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
133 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
134 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
135 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
136 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
137 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
138 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
139 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
140 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
141 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
142 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
143 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
144 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
145 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
146 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
147 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
148 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
149 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
150 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
151 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
152 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
153 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
154 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
155 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
156 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
157 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
158 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
161 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
162 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
165 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
166 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
167 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
189 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
190 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
193 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
194 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
195 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
200 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
201 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
202 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
203 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
204 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
205 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
208 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
209 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
210 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
211 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
212 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
213 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.84
Metatranscriptomes 1.75
Isolates 1.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.75
Nodule 0
Rhizoplane 3.51
Rhizosphere 94.39
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501076_0803697 3300049592 Bacteria 776
2 Ga0065715_11006976 3300005293 Bacteria 543
3 Ga0070658_10877359 3300005327 Bacteria 780
4 Ga0068869_100472143 3300005334 Bacteria 1043
5 Ga0070680_100208489 3300005336 Bacteria 1648
6 Ga0070682_100125694 3300005337 Bacteria 1728
7 Ga0070660_100144420 3300005339 Bacteria 1911
8 Ga0070687_100172449 3300005343 Bacteria 1289
9 Ga0070661_100115106 3300005344 Bacteria 2011
10 Ga0070692_10713734 3300005345 Bacteria 676
11 Ga0070668_100481506 3300005347 Bacteria 1072
12 Ga0070688_100297808 3300005365 Bacteria 1165
13 Ga0070659_100079855 3300005366 Bacteria 2611
14 Ga0070667_100346066 3300005367 Bacteria 1345
15 Ga0070667_100379573 3300005367 Bacteria 1284
16 Ga0070713_100295539 3300005436 Bacteria 1490
17 Ga0070713_100341124 3300005436 Bacteria 1388
18 Ga0070700_101376795 3300005441 Bacteria 596
19 Ga0070694_101758319 3300005444 Bacteria 528
20 Ga0070681_10062624 3300005458 Bacteria 3693
21 Ga0068867_100775386 3300005459 Bacteria 853
22 Ga0070685_10127212 3300005466 Bacteria 1589
23 Ga0070684_100472442 3300005535 Bacteria 1160
24 Ga0070672_100608002 3300005543 Bacteria 953
25 Ga0070696_100531452 3300005546 Bacteria 940
26 Ga0070693_100457461 3300005547 Bacteria 897
27 Ga0070664_100266192 3300005564 Bacteria 1543
28 Ga0068857_100078020 3300005577 Bacteria 2956
29 Ga0068857_100288156 3300005577 Bacteria 1511
30 Ga0068856_100831154 3300005614 Bacteria 943
31 Ga0070702_100443815 3300005615 Bacteria 940
32 Ga0075370_10095905 3300006353 Bacteria 1713
33 Ga0075370_10650560 3300006353 Bacteria 640
34 Ga0075370_10758861 3300006353 Bacteria 591
35 Ga0068865_100301219 3300006881 Bacteria 1283
36 Ga0105245_10996341 3300009098 Bacteria 882
37 Ga0114129_12406900 3300009147 Bacteria 631
38 Ga0105248_10742600 3300009177 Bacteria 1107
39 Ga0105248_11803682 3300009177 Bacteria 694
40 Ga0105237_10057004 3300009545 Bacteria 3910
41 Ga0105238_11459252 3300009551 Bacteria 712
42 Ga0105246_10812279 3300011119 Bacteria 831
43 Ga0157370_10249985 3300013104 Bacteria 1640
44 Ga0157369_10701649 3300013105 Bacteria 1042
45 Ga0157374_12136707 3300013296 Bacteria 587
46 Ga0163162_11021007 3300013306 Bacteria 935
47 Ga0157372_10190894 3300013307 Bacteria 2373
48 Ga0157372_11066212 3300013307 Bacteria 935
49 Ga0157372_13230831 3300013307 Bacteria 520
50 Ga0157375_10144375 3300013308 Bacteria 2510
51 Ga0157377_10105449 3300014745 Bacteria 1687
52 Ga0157377_11298491 3300014745 Bacteria 569
53 Ga0157379_10380751 3300014968 Bacteria 1295
54 Ga0157376_11468120 3300014969 Bacteria 714
55 Ga0197907_10669869 3300020069 Bacteria 1066
56 Ga0206356_10360664 3300020070 Bacteria 1058
57 Ga0206353_11520848 3300020082 Bacteria 971
58 Ga0224712_10102897 3300022467 Bacteria 1214
59 Ga0224712_10325095 3300022467 Bacteria 723
60 Ga0207643_10152189 3300025908 Bacteria 1387
61 Ga0207693_10309463 3300025915 Bacteria 1237
62 Ga0207649_10033829 3300025920 Bacteria 3057
63 Ga0207652_10098216 3300025921 Bacteria 2582
64 Ga0207681_11120935 3300025923 Bacteria 661
65 Ga0207700_10221548 3300025928 Bacteria 1604
66 Ga0207700_10275425 3300025928 Bacteria 1446
67 Ga0207709_10238744 3300025935 Bacteria 1321
68 Ga0207689_10716425 3300025942 Bacteria 844
69 Ga0207661_10203484 3300025944 Bacteria 1741
70 Ga0207668_10391203 3300025972 Bacteria 1173
71 Ga0207658_11785539 3300025986 Bacteria 561
72 Ga0207639_11171307 3300026041 Bacteria 721
73 Ga0207708_11064883 3300026075 Bacteria 704
74 Ga0207702_10579336 3300026078 Bacteria 1100
75 Ga0207648_10201236 3300026089 Bacteria 1766
76 Ga0207674_10057366 3300026116 Bacteria 3947
77 Ga0207674_10203697 3300026116 Bacteria 1928
78 Ga0207675_100955106 3300026118 Bacteria 875
79 Ga0207675_100989517 3300026118 Bacteria 859
80 Ga0207683_10354656 3300026121 Bacteria 1347
81 Ga0307405_10605456 3300031731 Bacteria 895
82 Ga0307405_11647423 3300031731 Bacteria 567
83 Ga0307413_10161134 3300031824 Bacteria 1576
84 Ga0307410_10131537 3300031852 Bacteria 1839
85 Ga0307410_12035459 3300031852 Bacteria 513
86 Ga0326468_10047059 3300031889 Bacteria 639
87 Ga0307406_10311179 3300031901 Bacteria 1214
88 Ga0307407_10174025 3300031903 Bacteria 1421
89 Ga0307409_100307401 3300031995 Bacteria 1478
90 Ga0307409_100377459 3300031995 Bacteria 1347
91 Ga0307409_100379783 3300031995 Bacteria 1343
92 Ga0307409_100483668 3300031995 Bacteria 1202
93 Ga0307416_100649097 3300032002 Bacteria 1140
94 Ga0307414_11749251 3300032004 Bacteria 580
95 Ga0307411_10547380 3300032005 Bacteria 987
96 Ga0307415_100162177 3300032126 Bacteria 1734
97 Ga0307415_100595473 3300032126 Bacteria 983
98 Ga0307415_100648741 3300032126 Bacteria 946
99 Ga0373926_0001790 3300035083 Bacteria 6673
100 Ga0373923_0012088 3300035111 Bacteria 3182
101 Ga0373936_0002102 3300035113 Bacteria 7395
102 Ga0373945_0001400 3300035116 Bacteria 7324
103 Ga0373953_0053324 3300035117 Bacteria 1639
104 Ga0373946_0008108 3300035171 Bacteria 3856
105 Ga0373955_0070404 3300035172 Bacteria 1954
106 Ga0373924_0026852 3300035410 Bacteria 2286
107 Ga0373935_0071766 3300035692 Bacteria 2234
108 Ga0373927_0165862 3300035695 Bacteria 1447
109 Ga0373933_0347350 3300035724 Bacteria 963
110 Ga0373937_0109177 3300036401 Bacteria 2572
111 Ga0373925_0245302 3300037068 Bacteria 1435
112 Ga0395900_1026296 3300037418 Bacteria 744
113 Ga0395898_0519188 3300037466 Bacteria 1132
114 Ga0395905_0115479 3300037471 Bacteria 2523
115 Ga0395901_0452783 3300038443 Bacteria 1312
116 Ga0439465_0059711 3300041413 Bacteria 1262
117 Ga0439445_0144155 3300042004 Bacteria 691
118 Ga0439432_013565 3300042006 Bacteria 2770
119 Ga0439446_0213548 3300042156 Bacteria 655
120 Ga0439446_0332598 3300042156 Bacteria 538
121 Ga0439434_0249441 3300042435 Bacteria 607
122 Ga0466965_0080055 3300044683 Bacteria 1651
123 Ga0466965_0281173 3300044683 Bacteria 899
124 Ga0466965_0493435 3300044683 Bacteria 686
125 Ga0466966_0245838 3300044684 Bacteria 1078
126 Ga0466966_0600938 3300044684 Bacteria 662
127 Ga0466961_0043936 3300044693 Bacteria 2861
128 Ga0466961_0052295 3300044693 Bacteria 2607
129 Ga0466961_0256440 3300044693 Bacteria 1073
130 Ga0466961_0585994 3300044693 Bacteria 671
131 Ga0466963_0058234 3300044694 Bacteria 2575
132 Ga0466963_0115366 3300044694 Bacteria 1846
133 Ga0466963_0182554 3300044694 Bacteria 1465
134 Ga0466963_0244368 3300044694 Bacteria 1259
135 Ga0466963_0640315 3300044694 Bacteria 750
136 Ga0466963_0989998 3300044694 Bacteria 592
137 Ga0466964_0387421 3300044706 Bacteria 727
138 Ga0466971_0166764 3300044719 Bacteria 1032
139 Ga0466971_0314954 3300044719 Bacteria 753
140 Ga0466971_0356864 3300044719 Bacteria 708
141 Ga0466968_0399375 3300044735 Bacteria 674
142 Ga0466970_0155936 3300044765 Bacteria 1262
143 Ga0466970_0190870 3300044765 Bacteria 1138
144 Ga0466957_0287589 3300044842 Bacteria 1102
145 Ga0466957_0678262 3300044842 Bacteria 726
146 Ga0466960_0032936 3300044901 Bacteria 2404
147 Ga0466960_0205585 3300044901 Bacteria 1078
148 Ga0466960_0416941 3300044901 Bacteria 776
149 Ga0466960_0877244 3300044901 Bacteria 546
150 Ga0466959_0065943 3300045049 Bacteria 2627
151 Ga0466959_0218258 3300045049 Bacteria 1323
152 Ga0466959_0909333 3300045049 Bacteria 587
153 Ga0466959_0915947 3300045049 Bacteria 585
154 Ga0466958_0176554 3300045836 Bacteria 1354
155 Ga0466958_0344657 3300045836 Bacteria 959
156 Ga0466958_0386672 3300045836 Bacteria 902
157 Ga0466967_0248305 3300045976 Bacteria 1699
158 Ga0466967_0420323 3300045976 Bacteria 1303
159 Ga0495627_196467 3300046453 Bacteria 556
160 Ga0495592_0016287 3300046454 Bacteria 5640
161 Ga0495629_0365137 3300046459 Bacteria 983
162 Ga0495641_0006139 3300046461 Bacteria 7865
163 Ga0495641_0138250 3300046461 Bacteria 1088
164 Ga0495651_0018240 3300046462 Bacteria 5434
165 Ga0495651_0389538 3300046462 Bacteria 912
166 Ga0495653_0000807 3300046463 Bacteria 24078
167 Ga0495582_0150387 3300046473 Bacteria 1321
168 Ga0495639_0061528 3300046475 Bacteria 1721
169 Ga0495662_0101706 3300046476 Bacteria 1405
170 Ga0495664_0002167 3300046477 Bacteria 10517
171 Ga0495584_0033200 3300046491 Bacteria 2611
172 Ga0495585_0009173 3300046492 Bacteria 5953
173 Ga0495607_0006886 3300046501 Bacteria 7928
174 Ga0495616_0091995 3300046513 Bacteria 1434
175 Ga0495618_0171466 3300046514 Bacteria 1380
176 Ga0495628_0083086 3300046516 Bacteria 2487
177 Ga0495628_0399912 3300046516 Unclassified 1003
178 Ga0495637_0062345 3300046520 Bacteria 1526
179 Ga0495644_0000714 3300046523 Bacteria 13755
180 Ga0495666_0008024 3300046526 Bacteria 5289
181 Ga0495652_0044889 3300046529 Bacteria 3803
182 Ga0495665_0008818 3300046531 Bacteria 5473
183 Ga0495640_0088160 3300046533 Bacteria 2051
184 Ga0495587_0010147 3300046536 Bacteria 6008
185 Ga0495609_0119394 3300046538 Bacteria 1134
186 Ga0495645_0177187 3300046543 Bacteria 1463
187 Ga0495622_0055824 3300046557 Bacteria 1831
188 Ga0495667_0020592 3300046559 Bacteria 4449
189 Ga0495656_0000709 3300046615 Bacteria 10747
190 Ga0495634_0086484 3300046642 Bacteria 2042
191 Ga0495611_0014853 3300046648 Bacteria 3328
192 Ga0495635_0054548 3300046663 Bacteria 2753
193 Ga0495659_0014927 3300046664 Bacteria 2548
194 Ga0495661_0202501 3300046665 Bacteria 1038
195 Ga0495588_0018353 3300046674 Bacteria 3410
196 Ga0495657_0037269 3300046675 Bacteria 3353
197 Ga0495599_0033297 3300046678 Bacteria 3238
198 Ga0495646_0127577 3300046680 Bacteria 1434
199 Ga0495647_0002492 3300046681 Bacteria 5828
200 Ga0495658_0003202 3300046683 Bacteria 8153
201 Ga0495658_0520334 3300046683 Bacteria 761
202 Ga0495613_0143255 3300046689 Bacteria 1706
203 Ga0495624_0015213 3300046690 Bacteria 5203
204 Ga0495670_0002893 3300046691 Bacteria 8456
205 Ga0495589_0153962 3300046794 Bacteria 1097
206 Ga0495600_0000758 3300046809 Bacteria 17034
207 Ga0495604_0225491 3300047317 Bacteria 1288
208 Ga0495674_0266928 3300047319 Bacteria 1405
209 Ga0495674_0493159 3300047319 Bacteria 980
210 Ga0495676_0216117 3300047321 Bacteria 1323
211 Ga0495680_0039588 3300047322 Bacteria 3758
212 Ga0495680_0227861 3300047322 Bacteria 1328
213 Ga0495681_0085945 3300047470 Bacteria 1396
214 Ga0495684_0031344 3300047471 Bacteria 4081
215 Ga0495593_0008526 3300047673 Bacteria 5958
216 Ga0495602_0371131 3300048088 Bacteria 1027
217 Ga0495614_0084939 3300048089 Bacteria 1373
218 Ga0495626_0158544 3300048091 Bacteria 950
219 Ga0496101_1528096 3300048904 Bacteria 519
220 Ga0496102_0646512 3300048905 Bacteria 981
221 Ga0496102_1740463 3300048905 Bacteria 541
222 Ga0496109_0755267 3300048912 Bacteria 910
223 Ga0496112_0264275 3300048915 Bacteria 1670
224 Ga0496112_0281901 3300048915 Bacteria 1609
225 Ga0496113_0041694 3300048916 Bacteria 3388
226 Ga0496114_0061516 3300048917 Bacteria 3141
227 Ga0496114_0076454 3300048917 Bacteria 2821
228 Ga0496115_1432103 3300048918 Bacteria 509
229 Ga0501031_0154594 3300049568 Bacteria 1499
230 Ga0501033_0148553 3300049570 Bacteria 1692
231 Ga0501033_0318734 3300049570 Bacteria 1092
232 Ga0501036_0333272 3300049572 Bacteria 1268
233 Ga0501037_0966979 3300049573 Bacteria 556
234 Ga0501039_0032831 3300049575 Bacteria 4004
235 Ga0501040_0100208 3300049576 Bacteria 2019
236 Ga0501040_0302654 3300049576 Bacteria 1143
237 Ga0501041_0007821 3300049577 Bacteria 6282
238 Ga0501041_0947188 3300049577 Bacteria 553
239 Ga0501042_0008087 3300049578 Bacteria 6922
240 Ga0501042_0020503 3300049578 Bacteria 4601
241 Ga0501042_1437598 3300049578 Bacteria 503
242 Ga0501043_0802537 3300049579 Bacteria 681
243 Ga0501046_0247333 3300049580 Bacteria 1314
244 Ga0501048_0059973 3300049582 Bacteria 2696
245 Ga0501048_0197351 3300049582 Bacteria 1426
246 Ga0501068_0337698 3300049584 Bacteria 967
247 Ga0501068_0479210 3300049584 Bacteria 806
248 Ga0501070_0203447 3300049586 Bacteria 1626
249 Ga0501071_0038034 3300049587 Bacteria 3438
250 Ga0501071_0314943 3300049587 Bacteria 1187
251 Ga0501072_0020485 3300049588 Bacteria 5125
252 Ga0501072_0077234 3300049588 Bacteria 2636
253 Ga0501073_0324942 3300049589 Bacteria 1062
254 Ga0501074_0099967 3300049590 Bacteria 2076
255 Ga0501076_0003664 3300049592 Bacteria 10799
256 Ga0501077_0028332 3300049593 Bacteria 3560
257 Ga0501079_0171074 3300049741 Bacteria 1694
258 Ga0501079_0676229 3300049741 Bacteria 813
259 Ga0501081_0033092 3300049743 Bacteria 3510
260 Ga0501081_0036472 3300049743 Bacteria 3353
261 Ga0501083_0381041 3300049744 Bacteria 917
262 Ga0501083_0579576 3300049744 Bacteria 730
263 Ga0501035_0376079 3300049822 Bacteria 1185
264 Ga0501044_0675647 3300049823 Bacteria 920
265 Ga0501045_0001304 3300049824 Bacteria 16553
266 Ga0501045_0441601 3300049824 Bacteria 967
267 nmdc:mga0yw44_179255_c1 3300050492 Bacteria 1394
268 nmdc:mga07m45_461032_c1 3300050496 Bacteria 737
269 nmdc:mga0n895_451834_c1 3300050512 Bacteria 1297
270 Ga0495601_0176509 3300053077 Bacteria 1396
271 Ga0495612_0016249 3300053078 Bacteria 2982
272 Ga0495595_0006116 3300053084 Bacteria 4890
273 Ga0495595_0318877 3300053084 Bacteria 783
274 Ga0495619_0087149 3300053085 Bacteria 2110
275 Ga0495619_0153022 3300053085 Bacteria 1591
276 Ga0501084_0025480 3300054114 Bacteria 4935
277 Ga0501084_0196635 3300054114 Bacteria 1701
278 Ga0501082_0041004 3300060353 Bacteria 3991
279 Ga0501082_0062987 3300060353 Bacteria 3193
280 Ga0466962_0219977 3300061719 Bacteria 930
281 Ga0530510_0005643 3300061734 Bacteria 8674
282 2676480828 2675903059 Bacteria 8644972
283 2812375326 2811994882 Bacteria 4688362
284 2819692943 2818991462 Bacteria 4320267
285 2819727354 2818991469 Bacteria 4644110
286 Ga0501076_0803697
287 Ga0065715_11006976
288 Ga0070658_10877359
289 Ga0068869_100472143
290 Ga0070680_100208489
291 Ga0070682_100125694
292 Ga0070660_100144420
293 Ga0070687_100172449
294 Ga0070661_100115106
295 Ga0070692_10713734
296 Ga0070668_100481506
297 Ga0070688_100297808
298 Ga0070659_100079855
299 Ga0070667_100346066
300 Ga0070667_100379573
301 Ga0070713_100295539
302 Ga0070713_100341124
303 Ga0070700_101376795
304 Ga0070694_101758319
305 Ga0070681_10062624
306 Ga0068867_100775386
307 Ga0070685_10127212
308 Ga0070684_100472442
309 Ga0070672_100608002
310 Ga0070696_100531452
311 Ga0070693_100457461
312 Ga0070664_100266192
313 Ga0068857_100078020
314 Ga0068857_100288156
315 Ga0068856_100831154
316 Ga0070702_100443815
317 Ga0075370_10095905
318 Ga0075370_10650560
319 Ga0075370_10758861
320 Ga0068865_100301219
321 Ga0105245_10996341
322 Ga0114129_12406900
323 Ga0105248_10742600
324 Ga0105248_11803682
325 Ga0105237_10057004
326 Ga0105238_11459252
327 Ga0105246_10812279
328 Ga0157370_10249985
329 Ga0157369_10701649
330 Ga0157374_12136707
331 Ga0163162_11021007
332 Ga0157372_10190894
333 Ga0157372_11066212
334 Ga0157372_13230831
335 Ga0157375_10144375
336 Ga0157377_10105449
337 Ga0157377_11298491
338 Ga0157379_10380751
339 Ga0157376_11468120
340 Ga0197907_10669869
341 Ga0206356_10360664
342 Ga0206353_11520848
343 Ga0224712_10102897
344 Ga0224712_10325095
345 Ga0207643_10152189
346 Ga0207693_10309463
347 Ga0207649_10033829
348 Ga0207652_10098216
349 Ga0207681_11120935
350 Ga0207700_10221548
351 Ga0207700_10275425
352 Ga0207709_10238744
353 Ga0207689_10716425
354 Ga0207661_10203484
355 Ga0207668_10391203
356 Ga0207658_11785539
357 Ga0207639_11171307
358 Ga0207708_11064883
359 Ga0207702_10579336
360 Ga0207648_10201236
361 Ga0207674_10057366
362 Ga0207674_10203697
363 Ga0207675_100955106
364 Ga0207675_100989517
365 Ga0207683_10354656
366 Ga0307405_10605456
367 Ga0307405_11647423
368 Ga0307413_10161134
369 Ga0307410_10131537
370 Ga0307410_12035459
371 Ga0326468_10047059
372 Ga0307406_10311179
373 Ga0307407_10174025
374 Ga0307409_100307401
375 Ga0307409_100377459
376 Ga0307409_100379783
377 Ga0307409_100483668
378 Ga0307416_100649097
379 Ga0307414_11749251
380 Ga0307411_10547380
381 Ga0307415_100162177
382 Ga0307415_100595473
383 Ga0307415_100648741
384 Ga0373926_0001790
385 Ga0373923_0012088
386 Ga0373936_0002102
387 Ga0373945_0001400
388 Ga0373953_0053324
389 Ga0373946_0008108
390 Ga0373955_0070404
391 Ga0373924_0026852
392 Ga0373935_0071766
393 Ga0373927_0165862
394 Ga0373933_0347350
395 Ga0373937_0109177
396 Ga0373925_0245302
397 Ga0395900_1026296
398 Ga0395898_0519188
399 Ga0395905_0115479
400 Ga0395901_0452783
401 Ga0439465_0059711
402 Ga0439445_0144155
403 Ga0439432_013565
404 Ga0439446_0213548
405 Ga0439446_0332598
406 Ga0439434_0249441
407 Ga0466965_0080055
408 Ga0466965_0281173
409 Ga0466965_0493435
410 Ga0466966_0245838
411 Ga0466966_0600938
412 Ga0466961_0043936
413 Ga0466961_0052295
414 Ga0466961_0256440
415 Ga0466961_0585994
416 Ga0466963_0058234
417 Ga0466963_0115366
418 Ga0466963_0182554
419 Ga0466963_0244368
420 Ga0466963_0640315
421 Ga0466963_0989998
422 Ga0466964_0387421
423 Ga0466971_0166764
424 Ga0466971_0314954
425 Ga0466971_0356864
426 Ga0466968_0399375
427 Ga0466970_0155936
428 Ga0466970_0190870
429 Ga0466957_0287589
430 Ga0466957_0678262
431 Ga0466960_0032936
432 Ga0466960_0205585
433 Ga0466960_0416941
434 Ga0466960_0877244
435 Ga0466959_0065943
436 Ga0466959_0218258
437 Ga0466959_0909333
438 Ga0466959_0915947
439 Ga0466958_0176554
440 Ga0466958_0344657
441 Ga0466958_0386672
442 Ga0466967_0248305
443 Ga0466967_0420323
444 Ga0495627_196467
445 Ga0495592_0016287
446 Ga0495629_0365137
447 Ga0495641_0006139
448 Ga0495641_0138250
449 Ga0495651_0018240
450 Ga0495651_0389538
451 Ga0495653_0000807
452 Ga0495582_0150387
453 Ga0495639_0061528
454 Ga0495662_0101706
455 Ga0495664_0002167
456 Ga0495584_0033200
457 Ga0495585_0009173
458 Ga0495607_0006886
459 Ga0495616_0091995
460 Ga0495618_0171466
461 Ga0495628_0083086
462 Ga0495628_0399912
463 Ga0495637_0062345
464 Ga0495644_0000714
465 Ga0495666_0008024
466 Ga0495652_0044889
467 Ga0495665_0008818
468 Ga0495640_0088160
469 Ga0495587_0010147
470 Ga0495609_0119394
471 Ga0495645_0177187
472 Ga0495622_0055824
473 Ga0495667_0020592
474 Ga0495656_0000709
475 Ga0495634_0086484
476 Ga0495611_0014853
477 Ga0495635_0054548
478 Ga0495659_0014927
479 Ga0495661_0202501
480 Ga0495588_0018353
481 Ga0495657_0037269
482 Ga0495599_0033297
483 Ga0495646_0127577
484 Ga0495647_0002492
485 Ga0495658_0003202
486 Ga0495658_0520334
487 Ga0495613_0143255
488 Ga0495624_0015213
489 Ga0495670_0002893
490 Ga0495589_0153962
491 Ga0495600_0000758
492 Ga0495604_0225491
493 Ga0495674_0266928
494 Ga0495674_0493159
495 Ga0495676_0216117
496 Ga0495680_0039588
497 Ga0495680_0227861
498 Ga0495681_0085945
499 Ga0495684_0031344
500 Ga0495593_0008526
501 Ga0495602_0371131
502 Ga0495614_0084939
503 Ga0495626_0158544
504 Ga0496101_1528096
505 Ga0496102_0646512
506 Ga0496102_1740463
507 Ga0496109_0755267
508 Ga0496112_0264275
509 Ga0496112_0281901
510 Ga0496113_0041694
511 Ga0496114_0061516
512 Ga0496114_0076454
513 Ga0496115_1432103
514 Ga0501031_0154594
515 Ga0501033_0148553
516 Ga0501033_0318734
517 Ga0501036_0333272
518 Ga0501037_0966979
519 Ga0501039_0032831
520 Ga0501040_0100208
521 Ga0501040_0302654
522 Ga0501041_0007821
523 Ga0501041_0947188
524 Ga0501042_0008087
525 Ga0501042_0020503
526 Ga0501042_1437598
527 Ga0501043_0802537
528 Ga0501046_0247333
529 Ga0501048_0059973
530 Ga0501048_0197351
531 Ga0501068_0337698
532 Ga0501068_0479210
533 Ga0501070_0203447
534 Ga0501071_0038034
535 Ga0501071_0314943
536 Ga0501072_0020485
537 Ga0501072_0077234
538 Ga0501073_0324942
539 Ga0501074_0099967
540 Ga0501076_0003664
541 Ga0501077_0028332
542 Ga0501079_0171074
543 Ga0501079_0676229
544 Ga0501081_0033092
545 Ga0501081_0036472
546 Ga0501083_0381041
547 Ga0501083_0579576
548 Ga0501035_0376079
549 Ga0501044_0675647
550 Ga0501045_0001304
551 Ga0501045_0441601
552 nmdc:mga0yw44_179255_c1
553 nmdc:mga07m45_461032_c1
554 nmdc:mga0n895_451834_c1
555 Ga0495601_0176509
556 Ga0495612_0016249
557 Ga0495595_0006116
558 Ga0495595_0318877
559 Ga0495619_0087149
560 Ga0495619_0153022
561 Ga0501084_0025480
562 Ga0501084_0196635
563 Ga0501082_0041004
564 Ga0501082_0062987
565 Ga0466962_0219977
566 Ga0530510_0005643
567 2676480828
568 2812375326
569 2819692943
570 2819727354

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01242

PTPS

6-pyruvoyl tetrahydropterin synthase

3

131

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d7j-assembly1.cif.gz_D sco6650, a 6-pyruvoyltetrahydropterin synthase homolog from streptomyces coelicolor 0.9576 2 132
3d7j-assembly1.cif.gz_D sco6650, a 6-pyruvoyltetrahydropterin synthase homolog from streptomyces coelicolor 0.9437 2 132
2dtt-assembly1.cif.gz_A crystal structure of 6-pyruvoyl tetrahydrobiopterin synthase from pyrococcus horikoshii ot3 complexed with (1'r,2's)-biopterin 0.8597 2 130
3qn9-assembly1.cif.gz_A crystal structure of a 6-pyruvoyltetrahydropterin synthase homologue from esherichia coli 0.8551 2 128
4ntm-assembly1.cif.gz_C qued soaked with sepiapterin (selenomethionine substituted protein) 0.852 1 128
ID Description Score Start End Superfamily
3d7jC00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9664 2 132 3.30.479.10
3d7jC00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9452 2 132 3.30.479.10
4ntmA00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8511 1 128 3.30.479.10
4ntmA00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.83 1 128 3.30.479.10
af_Q2G1X5_11_135_3.30.479.10 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8126 2 130 3.30.479.10
ID Description Score Start End GO Terms
AF-A0A537RE69-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9715 2 131 GO:0070497
AF-A0A4U6R347-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9683 1 132 GO:0046872
GO:0070497
AF-A0A2N2S8J1-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9681 1 119 GO:0046872
GO:0070497
AF-A0A317FBX4-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9669 1 132 GO:0046872
GO:0070497
AF-A0A7D6C5J4-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9656 1 132 GO:0046872
GO:0070497

Map