F387059
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 285 | 204 | 260 | 436 |
Family's Representative Sequence
| Representative Sequence | 3300048917|Ga0496114_0066395|Ga0496114_0066395_1064_2704 |
| Length | 521 |
| Sequence | VVPWAADQEMPSAPGAVSRLVAGLRPVQQLSGGPQLGDVADEAGELPSPAVHRRDGDQLDEQPAPVALHRRQVGGLNAGRTASSAGRRTLYRMSTLAFVLGVLFMATGVAASIALHEVGHLVPAKRFGVRVTQYMVGFGPTMWSRTRGETEYGVKAVPLGGYIRMIGMFPPRPGDQPGTVRASSTGRFSQLVDEARAASLEEVRPGDERRVFYRLPVHQKVVVMLGGPTMNLLIGVVLLTLLVTVHGVATAQPGAVVASVSQCVVPVTKAGDATTCTDQPKTPALAAGILPGDRFVSIAGQPVDDTTDVGTLIRPRVGEAVPIVVERDGRKVTVTATPIRNIVPVLDDKGVPVTDADGTTQTTEAGFLGVRSSAPVAYEPQPVTAVPGMLWGYVSGTAQALVHVPQRMVGVGEATGGKYDSLVGKSVGDKLWFLVGLIAALNFMLFLFNLIPLLPLDGGHVAGALWEGTKRGLAKLRGRPDPGYVDVAKALPIAYTVSTVLLGASLLLIYADLVKPVNLGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221546 | Microbacterium sp. Root53 | Isolate | Unclassified |
| 2 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 3 | 2643221613 | Oerskovia sp. Root22 | Isolate | Unclassified |
| 4 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 5 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 6 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 7 | 2643221721 | Oerskovia sp. Root918 | Isolate | Unclassified |
| 8 | 2808606365 | Phycicoccus sp. SLBN-51 | Isolate | Unclassified |
| 9 | 2808606700 | Arthrobacter agilis UMCV2 | Isolate | Rhizosphere |
| 10 | 2811994882 | Terrabacter sp. SLBN-196 | Isolate | Unclassified |
| 11 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 12 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 13 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 14 | 2818991469 | Terrabacter lapilli 3265 | Isolate | Rhizosphere |
| 15 | 2839986021 | Cellulosimicrobium cellulans JZ5 | Isolate | Unclassified |
| 16 | 2848551377 | Brachybacterium saurashtrense DSM 23186 | Isolate | Unclassified |
| 17 | 2857479173 | Micrococcus sp. R-74225 | Isolate | Unclassified |
| 18 | 2857632687 | Micrococcus sp. R-73081 | Isolate | Unclassified |
| 19 | 2870801768 | Micrococcus endophyticus DSM 17945 | Isolate | Unclassified |
| 20 | 2870804320 | Micrococcus yunnanensis DSM 21948 | Isolate | Unclassified |
| 21 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 22 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 23 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
| 24 | 2935890801 | Oerskovia enterophila 3230 | Isolate | Rhizosphere |
| 25 | 3001889506 | Janibacter sp. YIM B02568 | Isolate | Unclassified |
| 26 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 27 | 3300003285 | Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 28 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 59 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 65 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 122 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 123 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 124 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 125 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 126 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 127 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 128 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 129 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 130 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 131 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 132 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 133 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 134 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 135 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 136 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 137 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 138 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 139 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 140 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 141 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 142 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 143 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 144 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 145 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 146 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 147 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 148 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 149 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 150 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 151 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 152 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 153 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 154 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 155 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 156 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 157 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 158 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 159 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 160 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 161 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 162 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 163 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 164 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 165 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 166 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 167 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 168 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 169 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 170 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 171 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 172 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 173 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 174 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 175 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 176 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 177 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 178 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 179 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 200 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 201 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 202 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 203 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.42 |
| Metatranscriptomes | 2.81 |
| Isolates | 8.77 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.35 |
| Nodule | 0 |
| Rhizoplane | 11.58 |
| Rhizosphere | 78.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.47 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10033546 | 3300001989 | Bacteria | 1755 |
| 2 | Ga0007423J48922_100409 | 3300003285 | Bacteria | 4520 |
| 3 | Ga0070690_100093846 | 3300005330 | Bacteria | 1980 |
| 4 | Ga0068869_100033126 | 3300005334 | Bacteria | 3646 |
| 5 | Ga0068868_100058785 | 3300005338 | Bacteria | 3039 |
| 6 | Ga0070660_100119086 | 3300005339 | Bacteria | 2106 |
| 7 | Ga0070691_10055232 | 3300005341 | Bacteria | 1902 |
| 8 | Ga0070668_100031122 | 3300005347 | Bacteria | 4060 |
| 9 | Ga0070669_100076337 | 3300005353 | Bacteria | 2487 |
| 10 | Ga0070671_100104803 | 3300005355 | Bacteria | 2373 |
| 11 | Ga0070674_100041870 | 3300005356 | Bacteria | 3108 |
| 12 | Ga0070659_100040496 | 3300005366 | Bacteria | 3641 |
| 13 | Ga0070667_100006935 | 3300005367 | Bacteria | 9412 |
| 14 | Ga0070667_100059367 | 3300005367 | Bacteria | 3236 |
| 15 | Ga0070709_10022633 | 3300005434 | Bacteria | 3679 |
| 16 | Ga0070713_100071298 | 3300005436 | Bacteria | 2935 |
| 17 | Ga0070710_10021594 | 3300005437 | Bacteria | 3357 |
| 18 | Ga0070711_100013613 | 3300005439 | Bacteria | 5110 |
| 19 | Ga0070705_100047352 | 3300005440 | Bacteria | 2485 |
| 20 | Ga0070705_100051915 | 3300005440 | Bacteria | 2393 |
| 21 | Ga0070700_100000019 | 3300005441 | Bacteria | 137133 |
| 22 | Ga0070700_100104794 | 3300005441 | Bacteria | 1869 |
| 23 | Ga0070662_100021306 | 3300005457 | Bacteria | 4425 |
| 24 | Ga0070685_10020762 | 3300005466 | Bacteria | 3559 |
| 25 | Ga0070696_100001435 | 3300005546 | Bacteria | 15594 |
| 26 | Ga0070693_100025674 | 3300005547 | Bacteria | 3172 |
| 27 | Ga0068855_100011521 | 3300005563 | Bacteria | 10686 |
| 28 | Ga0068855_100198525 | 3300005563 | Bacteria | 2259 |
| 29 | Ga0068855_100246170 | 3300005563 | Bacteria | 1995 |
| 30 | Ga0068856_100021183 | 3300005614 | Bacteria | 6314 |
| 31 | Ga0068856_100075752 | 3300005614 | Bacteria | 3333 |
| 32 | Ga0070702_100010223 | 3300005615 | Bacteria | 4615 |
| 33 | Ga0068852_100131508 | 3300005616 | Bacteria | 2305 |
| 34 | Ga0068859_100020471 | 3300005617 | Bacteria | 6639 |
| 35 | Ga0068866_10014676 | 3300005718 | Bacteria | 3465 |
| 36 | Ga0068863_100033331 | 3300005841 | Bacteria | 4907 |
| 37 | Ga0068858_100019113 | 3300005842 | Bacteria | 6408 |
| 38 | Ga0068862_100144579 | 3300005844 | Bacteria | 2113 |
| 39 | Ga0081540_1015414 | 3300005983 | Bacteria | 4841 |
| 40 | Ga0070717_10027609 | 3300006028 | Bacteria | 4537 |
| 41 | Ga0070716_100038853 | 3300006173 | Bacteria | 2637 |
| 42 | Ga0070712_100026354 | 3300006175 | Bacteria | 3871 |
| 43 | Ga0068871_100079814 | 3300006358 | Bacteria | 2708 |
| 44 | Ga0068865_100032788 | 3300006881 | Bacteria | 3474 |
| 45 | Ga0075436_100070563 | 3300006914 | Bacteria | 2415 |
| 46 | Ga0097620_100020471 | 3300006931 | Bacteria | 6639 |
| 47 | Ga0111539_10167016 | 3300009094 | Bacteria | 2572 |
| 48 | Ga0105245_10061732 | 3300009098 | Bacteria | 3380 |
| 49 | Ga0105247_10003967 | 3300009101 | Bacteria | 9524 |
| 50 | Ga0105247_10017923 | 3300009101 | Bacteria | 4249 |
| 51 | Ga0105243_10029437 | 3300009148 | Bacteria | 4223 |
| 52 | Ga0105243_10114387 | 3300009148 | Bacteria | 2264 |
| 53 | Ga0105242_10011733 | 3300009176 | Bacteria | 6742 |
| 54 | Ga0105237_10040052 | 3300009545 | Bacteria | 4727 |
| 55 | Ga0105238_10188626 | 3300009551 | Bacteria | 2038 |
| 56 | Ga0105249_10063405 | 3300009553 | Bacteria | 3395 |
| 57 | Ga0105239_10039259 | 3300010375 | Bacteria | 5186 |
| 58 | Ga0105246_10045786 | 3300011119 | Bacteria | 2981 |
| 59 | Ga0157371_10035481 | 3300013102 | Bacteria | 3573 |
| 60 | Ga0157371_10066149 | 3300013102 | Bacteria | 2560 |
| 61 | Ga0157370_10010932 | 3300013104 | Bacteria | 9531 |
| 62 | Ga0157370_10056163 | 3300013104 | Bacteria | 3747 |
| 63 | Ga0157369_10000631 | 3300013105 | Bacteria | 45670 |
| 64 | Ga0157374_10126815 | 3300013296 | Bacteria | 2467 |
| 65 | Ga0157378_10005623 | 3300013297 | Bacteria | 10981 |
| 66 | Ga0163162_10157762 | 3300013306 | Bacteria | 2390 |
| 67 | Ga0157372_10124186 | 3300013307 | Bacteria | 2967 |
| 68 | Ga0157375_10064515 | 3300013308 | Bacteria | 3647 |
| 69 | Ga0157380_10014591 | 3300014326 | Bacteria | 5752 |
| 70 | Ga0157380_10026328 | 3300014326 | Bacteria | 4416 |
| 71 | Ga0157377_10010842 | 3300014745 | Bacteria | 4526 |
| 72 | Ga0157379_10174995 | 3300014968 | Bacteria | 1938 |
| 73 | Ga0157376_10036024 | 3300014969 | Bacteria | 4005 |
| 74 | Ga0163161_10026985 | 3300017792 | Bacteria | 4072 |
| 75 | Ga0206356_11465649 | 3300020070 | Bacteria | 2574 |
| 76 | Ga0206356_11569333 | 3300020070 | Bacteria | 2541 |
| 77 | Ga0206354_10342800 | 3300020081 | Bacteria | 1767 |
| 78 | Ga0206353_10733242 | 3300020082 | Bacteria | 4085 |
| 79 | Ga0207642_10013468 | 3300025899 | Bacteria | 2985 |
| 80 | Ga0207710_10002240 | 3300025900 | Bacteria | 9073 |
| 81 | Ga0207688_10008791 | 3300025901 | Bacteria | 5494 |
| 82 | Ga0207647_10134455 | 3300025904 | Bacteria | 1452 |
| 83 | Ga0207693_10000409 | 3300025915 | Bacteria | 39089 |
| 84 | Ga0207663_10032525 | 3300025916 | Bacteria | 3097 |
| 85 | Ga0207662_10006697 | 3300025918 | Bacteria | 6228 |
| 86 | Ga0207657_10025779 | 3300025919 | Bacteria | 5414 |
| 87 | Ga0207694_10024682 | 3300025924 | Bacteria | 4567 |
| 88 | Ga0207694_10173931 | 3300025924 | Bacteria | 1744 |
| 89 | Ga0207687_10069510 | 3300025927 | Bacteria | 2512 |
| 90 | Ga0207690_10041719 | 3300025932 | Bacteria | 3009 |
| 91 | Ga0207706_10024851 | 3300025933 | Bacteria | 5370 |
| 92 | Ga0207686_10036669 | 3300025934 | Bacteria | 2953 |
| 93 | Ga0207686_10047476 | 3300025934 | Bacteria | 2655 |
| 94 | Ga0207704_10088559 | 3300025938 | Bacteria | 2026 |
| 95 | Ga0207665_10084933 | 3300025939 | Bacteria | 2185 |
| 96 | Ga0207689_10037553 | 3300025942 | Bacteria | 4017 |
| 97 | Ga0207667_10027650 | 3300025949 | Bacteria | 6170 |
| 98 | Ga0207712_10105547 | 3300025961 | Bacteria | 2103 |
| 99 | Ga0207668_10101761 | 3300025972 | Bacteria | 2136 |
| 100 | Ga0207658_10006114 | 3300025986 | Bacteria | 8219 |
| 101 | Ga0207703_10100351 | 3300026035 | Bacteria | 2452 |
| 102 | Ga0207639_10142483 | 3300026041 | Bacteria | 1998 |
| 103 | Ga0207678_10011042 | 3300026067 | Bacteria | 7933 |
| 104 | Ga0207708_10000038 | 3300026075 | Bacteria | 137212 |
| 105 | Ga0207702_10017726 | 3300026078 | Bacteria | 5894 |
| 106 | Ga0207702_10021734 | 3300026078 | Bacteria | 5313 |
| 107 | Ga0207676_10109476 | 3300026095 | Bacteria | 2308 |
| 108 | Ga0207683_10005450 | 3300026121 | Bacteria | 10898 |
| 109 | Ga0207698_10131171 | 3300026142 | Bacteria | 2142 |
| 110 | Ga0268265_10035037 | 3300028380 | Bacteria | 3664 |
| 111 | Ga0316575_10053212 | 3300031665 | Bacteria | 1612 |
| 112 | Ga0316579_10001737 | 3300031691 | Bacteria | 8006 |
| 113 | Ga0316579_10004164 | 3300031691 | Bacteria | 5716 |
| 114 | Ga0316576_10012605 | 3300031727 | Bacteria | 5593 |
| 115 | Ga0316576_10019087 | 3300031727 | Bacteria | 4693 |
| 116 | Ga0316576_10198211 | 3300031727 | Bacteria | 1513 |
| 117 | Ga0316578_10001140 | 3300031728 | Bacteria | 10429 |
| 118 | Ga0316578_10045805 | 3300031728 | Bacteria | 2547 |
| 119 | Ga0316578_10047731 | 3300031728 | Bacteria | 2499 |
| 120 | Ga0316577_10011967 | 3300031733 | Bacteria | 4716 |
| 121 | Ga0307413_10077641 | 3300031824 | Bacteria | 2116 |
| 122 | Ga0307410_10023924 | 3300031852 | Bacteria | 3808 |
| 123 | Ga0307410_10068928 | 3300031852 | Bacteria | 2445 |
| 124 | Ga0307409_100047151 | 3300031995 | Bacteria | 3268 |
| 125 | Ga0307409_100200350 | 3300031995 | Bacteria | 1785 |
| 126 | Ga0307416_100152259 | 3300032002 | Bacteria | 2123 |
| 127 | Ga0307415_100145885 | 3300032126 | Bacteria | 1814 |
| 128 | Ga0316585_10000802 | 3300032137 | Bacteria | 7927 |
| 129 | Ga0316580_10013997 | 3300032139 | Bacteria | 2446 |
| 130 | Ga0316580_10019394 | 3300032139 | Bacteria | 2093 |
| 131 | Ga0316593_10036827 | 3300032168 | Bacteria | 1614 |
| 132 | Ga0316588_1019698 | 3300033528 | Bacteria | 1522 |
| 133 | Ga0316596_1019669 | 3300033541 | Bacteria | 1714 |
| 134 | Ga0373928_0001391 | 3300035084 | Bacteria | 4718 |
| 135 | Ga0373932_0004199 | 3300035112 | Bacteria | 3421 |
| 136 | Ga0316574_0001582 | 3300035398 | Bacteria | 10884 |
| 137 | Ga0316574_0007258 | 3300035398 | Bacteria | 6061 |
| 138 | Ga0316574_0017764 | 3300035398 | Bacteria | 4169 |
| 139 | Ga0373927_0027250 | 3300035695 | Bacteria | 3732 |
| 140 | Ga0316582_0001579 | 3300036647 | Bacteria | 10147 |
| 141 | Ga0316582_0062833 | 3300036647 | Bacteria | 2385 |
| 142 | Ga0316584_0011852 | 3300036712 | Bacteria | 6141 |
| 143 | Ga0316584_0022669 | 3300036712 | Bacteria | 4582 |
| 144 | Ga0316584_0042631 | 3300036712 | Bacteria | 3382 |
| 145 | Ga0395899_0003096 | 3300037312 | Bacteria | 13237 |
| 146 | Ga0395900_0039735 | 3300037418 | Bacteria | 4847 |
| 147 | Ga0395900_0102808 | 3300037418 | Bacteria | 2935 |
| 148 | Ga0395898_0020767 | 3300037466 | Bacteria | 6667 |
| 149 | Ga0395898_0151210 | 3300037466 | Bacteria | 2221 |
| 150 | Ga0395901_0006787 | 3300038443 | Bacteria | 11562 |
| 151 | Ga0395901_0011024 | 3300038443 | Bacteria | 9157 |
| 152 | Ga0395901_0080547 | 3300038443 | Bacteria | 3400 |
| 153 | Ga0436365_1555741 | 3300039437 | Bacteria | 6566 |
| 154 | Ga0451853_1873005 | 3300041512 | Bacteria | 1669 |
| 155 | Ga0466972_0007787 | 3300044658 | Bacteria | 5378 |
| 156 | Ga0466965_0053119 | 3300044683 | Bacteria | 2013 |
| 157 | Ga0466966_0046786 | 3300044684 | Bacteria | 2761 |
| 158 | Ga0466961_0012639 | 3300044693 | Bacteria | 5408 |
| 159 | Ga0466961_0043353 | 3300044693 | Bacteria | 2882 |
| 160 | Ga0466961_0056868 | 3300044693 | Bacteria | 2492 |
| 161 | Ga0466961_0082692 | 3300044693 | Bacteria | 2031 |
| 162 | Ga0466961_0128646 | 3300044693 | Bacteria | 1587 |
| 163 | Ga0466963_0002248 | 3300044694 | Bacteria | 10720 |
| 164 | Ga0466963_0008686 | 3300044694 | Bacteria | 6098 |
| 165 | Ga0466963_0016342 | 3300044694 | Bacteria | 4614 |
| 166 | Ga0466963_0036528 | 3300044694 | Bacteria | 3205 |
| 167 | Ga0466963_0044948 | 3300044694 | Bacteria | 2907 |
| 168 | Ga0466963_0087010 | 3300044694 | Bacteria | 2124 |
| 169 | Ga0466963_0126080 | 3300044694 | Bacteria | 1765 |
| 170 | Ga0466963_0158848 | 3300044694 | Bacteria | 1573 |
| 171 | Ga0466964_0002434 | 3300044706 | Bacteria | 6613 |
| 172 | Ga0466971_0004941 | 3300044719 | Bacteria | 5768 |
| 173 | Ga0466970_0029186 | 3300044765 | Bacteria | 2903 |
| 174 | Ga0466970_0059519 | 3300044765 | Bacteria | 2046 |
| 175 | Ga0466957_0012711 | 3300044842 | Bacteria | 4878 |
| 176 | Ga0466957_0027885 | 3300044842 | Bacteria | 3358 |
| 177 | Ga0466960_0014394 | 3300044901 | Bacteria | 3385 |
| 178 | Ga0466959_0010078 | 3300045049 | Bacteria | 6740 |
| 179 | Ga0466959_0049129 | 3300045049 | Bacteria | 3099 |
| 180 | Ga0466959_0060883 | 3300045049 | Bacteria | 2746 |
| 181 | Ga0466958_0002046 | 3300045836 | Bacteria | 9965 |
| 182 | Ga0466967_0000698 | 3300045976 | Bacteria | 17093 |
| 183 | Ga0466967_0024807 | 3300045976 | Bacteria | 4935 |
| 184 | Ga0466967_0055225 | 3300045976 | Bacteria | 3498 |
| 185 | Ga0466967_0067759 | 3300045976 | Bacteria | 3184 |
| 186 | Ga0466967_0202164 | 3300045976 | Bacteria | 1882 |
| 187 | Ga0466967_0242113 | 3300045976 | Bacteria | 1721 |
| 188 | Ga0496100_0054364 | 3300048903 | Bacteria | 2611 |
| 189 | Ga0496100_0237084 | 3300048903 | Bacteria | 1345 |
| 190 | Ga0496101_0108708 | 3300048904 | Bacteria | 2085 |
| 191 | Ga0496101_0129893 | 3300048904 | Bacteria | 1912 |
| 192 | Ga0496102_0000094 | 3300048905 | Bacteria | 125159 |
| 193 | Ga0496102_0069431 | 3300048905 | Bacteria | 3234 |
| 194 | Ga0496102_0090869 | 3300048905 | Bacteria | 2826 |
| 195 | Ga0496103_0000042 | 3300048906 | Bacteria | 168701 |
| 196 | Ga0496103_0010665 | 3300048906 | Bacteria | 5437 |
| 197 | Ga0496103_0067027 | 3300048906 | Bacteria | 2241 |
| 198 | Ga0496104_0061960 | 3300048907 | Bacteria | 3546 |
| 199 | Ga0496104_0088357 | 3300048907 | Bacteria | 2960 |
| 200 | Ga0496104_0096242 | 3300048907 | Bacteria | 2832 |
| 201 | Ga0496105_0013776 | 3300048908 | Bacteria | 6421 |
| 202 | Ga0496105_0091377 | 3300048908 | Bacteria | 2513 |
| 203 | Ga0496105_0161187 | 3300048908 | Bacteria | 1841 |
| 204 | Ga0496108_0039007 | 3300048911 | Bacteria | 3959 |
| 205 | Ga0496108_0045506 | 3300048911 | Bacteria | 3665 |
| 206 | Ga0496108_0068137 | 3300048911 | Bacteria | 3002 |
| 207 | Ga0496109_0020228 | 3300048912 | Bacteria | 5879 |
| 208 | Ga0496109_0022486 | 3300048912 | Bacteria | 5586 |
| 209 | Ga0496109_0053175 | 3300048912 | Bacteria | 3692 |
| 210 | Ga0496110_0021843 | 3300048913 | Bacteria | 5426 |
| 211 | Ga0496110_0064877 | 3300048913 | Bacteria | 3228 |
| 212 | Ga0496111_0004360 | 3300048914 | Bacteria | 8929 |
| 213 | Ga0496111_0057460 | 3300048914 | Bacteria | 2817 |
| 214 | Ga0496114_0002956 | 3300048917 | Bacteria | 13030 |
| 215 | Ga0496114_0004219 | 3300048917 | Bacteria | 11137 |
| 216 | Ga0496114_0013599 | 3300048917 | Bacteria | 6526 |
| 217 | Ga0496114_0036366 | 3300048917 | Bacteria | 4070 |
| 218 | Ga0496114_0066395 | 3300048917 | Bacteria | 3024 |
| 219 | Ga0496114_0129346 | 3300048917 | Bacteria | 2179 |
| 220 | Ga0496115_0007997 | 3300048918 | Bacteria | 7805 |
| 221 | Ga0496118_0044238 | 3300048921 | Bacteria | 3489 |
| 222 | Ga0496118_0072345 | 3300048921 | Bacteria | 2477 |
| 223 | Ga0496119_0000055 | 3300048922 | Bacteria | 180121 |
| 224 | Ga0496122_0004513 | 3300048925 | Bacteria | 17191 |
| 225 | Ga0496123_0001305 | 3300048926 | Bacteria | 35428 |
| 226 | Ga0496124_0005518 | 3300048927 | Bacteria | 14201 |
| 227 | Ga0496126_0000006 | 3300048929 | Bacteria | 798804 |
| 228 | Ga0496126_0043191 | 3300048929 | Bacteria | 4159 |
| 229 | Ga0501031_0014816 | 3300049568 | Bacteria | 5068 |
| 230 | Ga0501031_0036350 | 3300049568 | Bacteria | 3212 |
| 231 | Ga0501032_0080589 | 3300049569 | Bacteria | 2166 |
| 232 | Ga0501036_0024119 | 3300049572 | Bacteria | 5127 |
| 233 | Ga0501036_0069371 | 3300049572 | Bacteria | 2982 |
| 234 | Ga0501037_0014840 | 3300049573 | Bacteria | 5731 |
| 235 | Ga0501041_0043677 | 3300049577 | Bacteria | 2724 |
| 236 | Ga0501042_0072957 | 3300049578 | Bacteria | 2456 |
| 237 | Ga0501043_0039041 | 3300049579 | Bacteria | 3732 |
| 238 | Ga0501046_0034585 | 3300049580 | Bacteria | 4076 |
| 239 | Ga0501048_0013140 | 3300049582 | Bacteria | 6146 |
| 240 | Ga0501048_0055093 | 3300049582 | Bacteria | 2824 |
| 241 | Ga0501067_0050611 | 3300049583 | Bacteria | 2302 |
| 242 | Ga0501069_0054919 | 3300049585 | Bacteria | 2218 |
| 243 | Ga0501071_0001400 | 3300049587 | Bacteria | 13851 |
| 244 | Ga0501071_0278534 | 3300049587 | Bacteria | 1266 |
| 245 | Ga0501074_0036197 | 3300049590 | Bacteria | 3576 |
| 246 | Ga0501076_0003749 | 3300049592 | Bacteria | 10686 |
| 247 | Ga0501077_0047951 | 3300049593 | Bacteria | 2714 |
| 248 | Ga0501079_0007990 | 3300049741 | Bacteria | 8018 |
| 249 | Ga0501080_0060857 | 3300049742 | Bacteria | 3515 |
| 250 | Ga0501081_0062474 | 3300049743 | Bacteria | 2583 |
| 251 | Ga0501035_0092761 | 3300049822 | Bacteria | 2657 |
| 252 | Ga0501045_0067956 | 3300049824 | Bacteria | 2617 |
| 253 | Ga0501045_0082917 | 3300049824 | Bacteria | 2365 |
| 254 | Ga0501045_0145923 | 3300049824 | Bacteria | 1760 |
| 255 | nmdc:mga08y16_138568_c1 | 3300050511 | Bacteria | 2529 |
| 256 | nmdc:mga0n895_201709_c1 | 3300050512 | Bacteria | 2020 |
| 257 | nmdc:mga0a205_11750_c1 | 3300050515 | Bacteria | 8076 |
| 258 | Ga0500616_0003057 | 3300053153 | Bacteria | 13159 |
| 259 | Ga0501084_0036046 | 3300054114 | Bacteria | 4133 |
| 260 | Ga0530510_0038396 | 3300061734 | Bacteria | 3457 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048903 | Ga0496100_0237084 | Ga0496100_0237084_215_1324 | 357 |
| 2 | 3300049587 | Ga0501071_0278534 | Ga0501071_0278534_145_1254 | 360 |
| 3 | 3300044694 | Ga0466963_0158848 | Ga0466963_0158848_308_1549 | 377 |
| 4 | 3300044694 | Ga0466963_0126080 | Ga0466963_0126080_17_1225 | 385 |
| 5 | 3300037466 | Ga0395898_0151210 | Ga0395898_0151210_976_2205 | 400 |
| 6 | 3300048929 | Ga0496126_0000006 | Ga0496126_0000006_486210_487547 | 400 |
| 7 | 3300005367 | Ga0070667_100006935 | Ga0070667_1000069354 | 403 |
| 8 | 3300044693 | Ga0466961_0056868 | Ga0466961_0056868_1082_2407 | 406 |
| 9 | 3300044658 | Ga0466972_0007787 | Ga0466972_0007787_889_2238 | 410 |
| 10 | 3300044683 | Ga0466965_0053119 | Ga0466965_0053119_582_1931 | 410 |
| 11 | 3300044693 | Ga0466961_0043353 | Ga0466961_0043353_658_2007 | 410 |
| 12 | 3300044694 | Ga0466963_0008686 | Ga0466963_0008686_2164_3513 | 410 |
| 13 | 3300044706 | Ga0466964_0002434 | Ga0466964_0002434_946_2295 | 410 |
| 14 | 3300044719 | Ga0466971_0004941 | Ga0466971_0004941_3073_4422 | 410 |
| 15 | 3300044842 | Ga0466957_0012711 | Ga0466957_0012711_2432_3781 | 410 |
| 16 | 3300045836 | Ga0466958_0002046 | Ga0466958_0002046_3874_5223 | 410 |
| 17 | 3300005441 | Ga0070700_100000019 | Ga0070700_10000001951 | 413 |
| 18 | 3300026075 | Ga0207708_10000038 | Ga0207708_1000003851 | 414 |
| 19 | 3300044765 | Ga0466970_0059519 | Ga0466970_0059519_164_1507 | 414 |
| 20 | 3300045049 | Ga0466959_0060883 | Ga0466959_0060883_1060_2403 | 414 |
| 21 | 3300025949 | Ga0207667_10027650 | Ga0207667_100276504 | 415 |
| 22 | 3300037418 | Ga0395900_0102808 | Ga0395900_0102808_610_1977 | 415 |
| 23 | 3300037466 | Ga0395898_0020767 | Ga0395898_0020767_3103_4470 | 415 |
| 24 | 3300038443 | Ga0395901_0006787 | Ga0395901_0006787_7921_9288 | 415 |
| 25 | 3300044765 | Ga0466970_0029186 | Ga0466970_0029186_795_2126 | 416 |
| 26 | 3300044694 | Ga0466963_0087010 | Ga0466963_0087010_166_1515 | 417 |
| 27 | 3300005330 | Ga0070690_100093846 | Ga0070690_1000938462 | 418 |
| 28 | 3300005334 | Ga0068869_100033126 | Ga0068869_1000331263 | 418 |
| 29 | 3300005338 | Ga0068868_100058785 | Ga0068868_1000587853 | 418 |
| 30 | 3300005339 | Ga0070660_100119086 | Ga0070660_1001190862 | 418 |
| 31 | 3300005341 | Ga0070691_10055232 | Ga0070691_100552322 | 418 |
| 32 | 3300005347 | Ga0070668_100031122 | Ga0070668_1000311222 | 418 |
| 33 | 3300005353 | Ga0070669_100076337 | Ga0070669_1000763372 | 418 |
| 34 | 3300005355 | Ga0070671_100104803 | Ga0070671_1001048032 | 418 |
| 35 | 3300005366 | Ga0070659_100040496 | Ga0070659_1000404962 | 418 |
| 36 | 3300005367 | Ga0070667_100059367 | Ga0070667_1000593672 | 418 |
| 37 | 3300005434 | Ga0070709_10022633 | Ga0070709_100226332 | 418 |
| 38 | 3300005436 | Ga0070713_100071298 | Ga0070713_1000712982 | 418 |
| 39 | 3300005437 | Ga0070710_10021594 | Ga0070710_100215942 | 418 |
| 40 | 3300005439 | Ga0070711_100013613 | Ga0070711_1000136132 | 418 |
| 41 | 3300005440 | Ga0070705_100051915 | Ga0070705_1000519151 | 418 |
| 42 | 3300005441 | Ga0070700_100104794 | Ga0070700_1001047942 | 418 |
| 43 | 3300005457 | Ga0070662_100021306 | Ga0070662_1000213064 | 418 |
| 44 | 3300005466 | Ga0070685_10020762 | Ga0070685_100207622 | 418 |
| 45 | 3300005547 | Ga0070693_100025674 | Ga0070693_1000256742 | 418 |
| 46 | 3300005563 | Ga0068855_100198525 | Ga0068855_1001985252 | 418 |
| 47 | 3300005718 | Ga0068866_10014676 | Ga0068866_100146764 | 418 |
| 48 | 3300005841 | Ga0068863_100033331 | Ga0068863_1000333312 | 418 |
| 49 | 3300005844 | Ga0068862_100144579 | Ga0068862_1001445792 | 418 |
| 50 | 3300006028 | Ga0070717_10027609 | Ga0070717_100276092 | 418 |
| 51 | 3300006173 | Ga0070716_100038853 | Ga0070716_1000388532 | 418 |
| 52 | 3300006175 | Ga0070712_100026354 | Ga0070712_1000263543 | 418 |
| 53 | 3300006358 | Ga0068871_100079814 | Ga0068871_1000798142 | 418 |
| 54 | 3300006914 | Ga0075436_100070563 | Ga0075436_1000705632 | 418 |
| 55 | 3300009094 | Ga0111539_10167016 | Ga0111539_101670162 | 418 |
| 56 | 3300009098 | Ga0105245_10061732 | Ga0105245_100617322 | 418 |
| 57 | 3300009101 | Ga0105247_10017923 | Ga0105247_100179231 | 418 |
| 58 | 3300009545 | Ga0105237_10040052 | Ga0105237_100400523 | 418 |
| 59 | 3300009553 | Ga0105249_10063405 | Ga0105249_100634053 | 418 |
| 60 | 3300011119 | Ga0105246_10045786 | Ga0105246_100457862 | 418 |
| 61 | 3300013102 | Ga0157371_10035481 | Ga0157371_100354812 | 418 |
| 62 | 3300013102 | Ga0157371_10066149 | Ga0157371_100661492 | 418 |
| 63 | 3300013104 | Ga0157370_10010932 | Ga0157370_100109329 | 418 |
| 64 | 3300013104 | Ga0157370_10056163 | Ga0157370_100561633 | 418 |
| 65 | 3300013296 | Ga0157374_10126815 | Ga0157374_101268152 | 418 |
| 66 | 3300013306 | Ga0163162_10157762 | Ga0163162_101577622 | 418 |
| 67 | 3300013307 | Ga0157372_10124186 | Ga0157372_101241862 | 418 |
| 68 | 3300013308 | Ga0157375_10064515 | Ga0157375_100645154 | 418 |
| 69 | 3300014326 | Ga0157380_10026328 | Ga0157380_100263284 | 418 |
| 70 | 3300014745 | Ga0157377_10010842 | Ga0157377_100108423 | 418 |
| 71 | 3300014969 | Ga0157376_10036024 | Ga0157376_100360244 | 418 |
| 72 | 3300017792 | Ga0163161_10026985 | Ga0163161_100269854 | 418 |
| 73 | 3300025899 | Ga0207642_10013468 | Ga0207642_100134682 | 418 |
| 74 | 3300025901 | Ga0207688_10008791 | Ga0207688_100087912 | 418 |
| 75 | 3300025915 | Ga0207693_10000409 | Ga0207693_100004099 | 418 |
| 76 | 3300025916 | Ga0207663_10032525 | Ga0207663_100325252 | 418 |
| 77 | 3300025919 | Ga0207657_10025779 | Ga0207657_100257792 | 418 |
| 78 | 3300025927 | Ga0207687_10069510 | Ga0207687_100695102 | 418 |
| 79 | 3300025932 | Ga0207690_10041719 | Ga0207690_100417192 | 418 |
| 80 | 3300025933 | Ga0207706_10024851 | Ga0207706_100248514 | 418 |
| 81 | 3300025934 | Ga0207686_10047476 | Ga0207686_100474762 | 418 |
| 82 | 3300025939 | Ga0207665_10084933 | Ga0207665_100849332 | 418 |
| 83 | 3300025942 | Ga0207689_10037553 | Ga0207689_100375532 | 418 |
| 84 | 3300025961 | Ga0207712_10105547 | Ga0207712_101055471 | 418 |
| 85 | 3300025972 | Ga0207668_10101761 | Ga0207668_101017612 | 418 |
| 86 | 3300026067 | Ga0207678_10011042 | Ga0207678_100110424 | 418 |
| 87 | 3300026095 | Ga0207676_10109476 | Ga0207676_101094761 | 418 |
| 88 | 3300026121 | Ga0207683_10005450 | Ga0207683_100054504 | 418 |
| 89 | 3300026142 | Ga0207698_10131171 | Ga0207698_101311712 | 418 |
| 90 | 3300035084 | Ga0373928_0001391 | Ga0373928_0001391_2958_4322 | 418 |
| 91 | 3300035112 | Ga0373932_0004199 | Ga0373932_0004199_502_1866 | 418 |
| 92 | 3300048904 | Ga0496101_0108708 | Ga0496101_0108708_637_2001 | 418 |
| 93 | 3300048908 | Ga0496105_0091377 | Ga0496105_0091377_400_1764 | 418 |
| 94 | 3300048911 | Ga0496108_0045506 | Ga0496108_0045506_794_2158 | 418 |
| 95 | 3300048912 | Ga0496109_0053175 | Ga0496109_0053175_1585_2949 | 418 |
| 96 | 3300048913 | Ga0496110_0021843 | Ga0496110_0021843_487_1851 | 418 |
| 97 | 3300048917 | Ga0496114_0004219 | Ga0496114_0004219_6669_8033 | 418 |
| 98 | 3300048918 | Ga0496115_0007997 | Ga0496115_0007997_1510_2874 | 418 |
| 99 | 3300050511 | nmdc:mga08y16_138568_c1 | nmdc:mga08y16_138568_c1_696_2060 | 418 |
| 100 | 3300050512 | nmdc:mga0n895_201709_c1 | nmdc:mga0n895_201709_c1_67_1431 | 418 |
| 101 | 3300050515 | nmdc:mga0a205_11750_c1 | nmdc:mga0a205_11750_c1_637_2001 | 418 |
| 102 | 3300005617 | Ga0068859_100020471 | Ga0068859_1000204711 | 419 |
| 103 | 3300006931 | Ga0097620_100020471 | Ga0097620_1000204711 | 419 |
| 104 | 3300009101 | Ga0105247_10003967 | Ga0105247_100039675 | 419 |
| 105 | 3300013105 | Ga0157369_10000631 | Ga0157369_1000063111 | 419 |
| 106 | 3300025900 | Ga0207710_10002240 | Ga0207710_100022404 | 419 |
| 107 | 3300048905 | Ga0496102_0000094 | Ga0496102_0000094_94743_96047 | 419 |
| 108 | 3300048906 | Ga0496103_0000042 | Ga0496103_0000042_140973_142277 | 419 |
| 109 | 3300048921 | Ga0496118_0044238 | Ga0496118_0044238_66_1370 | 419 |
| 110 | 3300005563 | Ga0068855_100246170 | Ga0068855_1002461702 | 420 |
| 111 | 3300025904 | Ga0207647_10134455 | Ga0207647_101344551 | 420 |
| 112 | 3300049822 | Ga0501035_0092761 | Ga0501035_0092761_594_1931 | 420 |
| 113 | 3300014968 | Ga0157379_10174995 | Ga0157379_101749952 | 421 |
| 114 | 3300048917 | Ga0496114_0066395 | Ga0496114_0066395_1064_2704 | 422 |
| 115 | 3300048929 | Ga0496126_0043191 | Ga0496126_0043191_167_1477 | 422 |
| 116 | 3300005563 | Ga0068855_100011521 | Ga0068855_1000115212 | 423 |
| 117 | 3300025924 | Ga0207694_10173931 | Ga0207694_101739312 | 423 |
| 118 | 3300026078 | Ga0207702_10021734 | Ga0207702_100217342 | 423 |
| 119 | 3300044694 | Ga0466963_0016342 | Ga0466963_0016342_1140_2477 | 424 |
| 120 | 3300045976 | Ga0466967_0055225 | Ga0466967_0055225_851_2188 | 424 |
| 121 | 3300045976 | Ga0466967_0067759 | Ga0466967_0067759_1840_3165 | 424 |
| 122 | 3300048911 | Ga0496108_0068137 | Ga0496108_0068137_165_1490 | 424 |
| 123 | 3300048912 | Ga0496109_0020228 | Ga0496109_0020228_742_2067 | 424 |
| 124 | 3300048913 | Ga0496110_0064877 | Ga0496110_0064877_646_1971 | 424 |
| 125 | 3300053153 | Ga0500616_0003057 | Ga0500616_0003057_10864_12198 | 424 |
| 126 | iso_pu_bacteria | 2643221546 | 2643754123 | 425 |
| 127 | iso_pu_bacteria | 2643221613 | 2644081815 | 425 |
| 128 | iso_pu_bacteria | 2643221721 | 2644665142 | 425 |
| 129 | iso_pu_bacteria | 2839986021 | 2839989404 | 425 |
| 130 | iso_pu_bacteria | 2932431166 | 2932433505 | 425 |
| 131 | iso_pu_bacteria | 2935890801 | 2935891309 | 425 |
| 132 | 3300005614 | Ga0068856_100075752 | Ga0068856_1000757521 | 426 |
| 133 | 3300009551 | Ga0105238_10188626 | Ga0105238_101886262 | 426 |
| 134 | 3300010375 | Ga0105239_10039259 | Ga0105239_100392592 | 426 |
| 135 | 3300044694 | Ga0466963_0002248 | Ga0466963_0002248_7705_9066 | 426 |
| 136 | 3300045976 | Ga0466967_0024807 | Ga0466967_0024807_2436_3797 | 426 |
| 137 | 3300003285 | Ga0007423J48922_100409 | Ga0007423J48922_1004091 | 427 |
| 138 | 3300005356 | Ga0070674_100041870 | Ga0070674_1000418702 | 427 |
| 139 | 3300005842 | Ga0068858_100019113 | Ga0068858_1000191133 | 427 |
| 140 | 3300005983 | Ga0081540_1015414 | Ga0081540_10154144 | 427 |
| 141 | 3300025918 | Ga0207662_10006697 | Ga0207662_100066972 | 427 |
| 142 | 3300025924 | Ga0207694_10024682 | Ga0207694_100246824 | 427 |
| 143 | 3300026035 | Ga0207703_10100351 | Ga0207703_101003512 | 427 |
| 144 | 3300026041 | Ga0207639_10142483 | Ga0207639_101424832 | 427 |
| 145 | 3300028380 | Ga0268265_10035037 | Ga0268265_100350373 | 427 |
| 146 | 3300044693 | Ga0466961_0082692 | Ga0466961_0082692_419_1735 | 427 |
| 147 | 3300045976 | Ga0466967_0000698 | Ga0466967_0000698_7623_8927 | 427 |
| 148 | 3300049824 | Ga0501045_0145923 | Ga0501045_0145923_194_1537 | 427 |
| 149 | 3300025986 | Ga0207658_10006114 | Ga0207658_100061145 | 428 |
| 150 | 3300035695 | Ga0373927_0027250 | Ga0373927_0027250_1461_2804 | 428 |
| 151 | 3300044684 | Ga0466966_0046786 | Ga0466966_0046786_745_2070 | 428 |
| 152 | 3300039437 | Ga0436365_1555741 | Ga0436365_1555741_3188_4567 | 429 |
| 153 | 3300044694 | Ga0466963_0044948 | Ga0466963_0044948_412_1740 | 429 |
| 154 | 3300045976 | Ga0466967_0202164 | Ga0466967_0202164_416_1744 | 429 |
| 155 | 3300005546 | Ga0070696_100001435 | Ga0070696_1000014356 | 430 |
| 156 | 3300031824 | Ga0307413_10077641 | Ga0307413_100776412 | 430 |
| 157 | 3300031852 | Ga0307410_10068928 | Ga0307410_100689282 | 430 |
| 158 | 3300031995 | Ga0307409_100047151 | Ga0307409_1000471513 | 430 |
| 159 | 3300005614 | Ga0068856_100021183 | Ga0068856_1000211835 | 431 |
| 160 | 3300026078 | Ga0207702_10017726 | Ga0207702_100177262 | 431 |
| 161 | 3300037312 | Ga0395899_0003096 | Ga0395899_0003096_4619_5923 | 431 |
| 162 | 3300044693 | Ga0466961_0012639 | Ga0466961_0012639_1845_3185 | 431 |
| 163 | 3300044693 | Ga0466961_0128646 | Ga0466961_0128646_170_1534 | 431 |
| 164 | 3300044694 | Ga0466963_0036528 | Ga0466963_0036528_1326_2690 | 431 |
| 165 | 3300044842 | Ga0466957_0027885 | Ga0466957_0027885_1781_3145 | 431 |
| 166 | 3300044901 | Ga0466960_0014394 | Ga0466960_0014394_1600_2940 | 431 |
| 167 | 3300045049 | Ga0466959_0010078 | Ga0466959_0010078_1984_3324 | 431 |
| 168 | 3300045049 | Ga0466959_0049129 | Ga0466959_0049129_1732_3075 | 431 |
| 169 | 3300045976 | Ga0466967_0242113 | Ga0466967_0242113_296_1660 | 431 |
| 170 | 3300048921 | Ga0496118_0072345 | Ga0496118_0072345_970_2286 | 431 |
| 171 | 3300048925 | Ga0496122_0004513 | Ga0496122_0004513_8581_9897 | 431 |
| 172 | 3300048926 | Ga0496123_0001305 | Ga0496123_0001305_1524_2840 | 431 |
| 173 | 3300048927 | Ga0496124_0005518 | Ga0496124_0005518_9313_10629 | 431 |
| 174 | 3300049568 | Ga0501031_0036350 | Ga0501031_0036350_927_2270 | 431 |
| 175 | 3300049569 | Ga0501032_0080589 | Ga0501032_0080589_149_1492 | 431 |
| 176 | 3300049572 | Ga0501036_0024119 | Ga0501036_0024119_3572_4915 | 431 |
| 177 | 3300049573 | Ga0501037_0014840 | Ga0501037_0014840_3128_4471 | 431 |
| 178 | 3300049577 | Ga0501041_0043677 | Ga0501041_0043677_1164_2507 | 431 |
| 179 | 3300049579 | Ga0501043_0039041 | Ga0501043_0039041_1236_2579 | 431 |
| 180 | 3300049580 | Ga0501046_0034585 | Ga0501046_0034585_1745_3088 | 431 |
| 181 | 3300049582 | Ga0501048_0013140 | Ga0501048_0013140_3619_4962 | 431 |
| 182 | 3300049587 | Ga0501071_0001400 | Ga0501071_0001400_6981_8324 | 431 |
| 183 | 3300049590 | Ga0501074_0036197 | Ga0501074_0036197_166_1509 | 431 |
| 184 | 3300049592 | Ga0501076_0003749 | Ga0501076_0003749_1359_2702 | 431 |
| 185 | 3300049593 | Ga0501077_0047951 | Ga0501077_0047951_155_1498 | 431 |
| 186 | 3300049741 | Ga0501079_0007990 | Ga0501079_0007990_1172_2515 | 431 |
| 187 | 3300049742 | Ga0501080_0060857 | Ga0501080_0060857_794_2137 | 431 |
| 188 | 3300049743 | Ga0501081_0062474 | Ga0501081_0062474_709_2052 | 431 |
| 189 | 3300049824 | Ga0501045_0067956 | Ga0501045_0067956_1213_2556 | 431 |
| 190 | 3300054114 | Ga0501084_0036046 | Ga0501084_0036046_1578_2921 | 431 |
| 191 | 3300061734 | Ga0530510_0038396 | Ga0530510_0038396_400_1743 | 431 |
| 192 | 3300048922 | Ga0496119_0000055 | Ga0496119_0000055_38589_39923 | 432 |
| 193 | iso_pu_bacteria | 2848551377 | 2848551853 | 433 |
| 194 | iso_pu_bacteria | 2808606700 | 2810363443 | 434 |
| 195 | iso_pu_bacteria | 2857479173 | 2857481163 | 434 |
| 196 | iso_pu_bacteria | 2857632687 | 2857634412 | 434 |
| 197 | iso_pu_bacteria | 2870801768 | 2870802969 | 434 |
| 198 | iso_pu_bacteria | 2870804320 | 2870805034 | 434 |
| 199 | iso_pu_bacteria | 2905926851 | 2905930198 | 434 |
| 200 | 3300032002 | Ga0307416_100152259 | Ga0307416_1001522592 | 435 |
| 201 | 3300032126 | Ga0307415_100145885 | Ga0307415_1001458852 | 435 |
| 202 | 3300049568 | Ga0501031_0014816 | Ga0501031_0014816_253_1590 | 435 |
| 203 | 3300049572 | Ga0501036_0069371 | Ga0501036_0069371_168_1505 | 435 |
| 204 | 3300049578 | Ga0501042_0072957 | Ga0501042_0072957_455_1792 | 435 |
| 205 | 3300049582 | Ga0501048_0055093 | Ga0501048_0055093_1070_2407 | 435 |
| 206 | 3300049583 | Ga0501067_0050611 | Ga0501067_0050611_323_1645 | 435 |
| 207 | 3300049585 | Ga0501069_0054919 | Ga0501069_0054919_567_1889 | 435 |
| 208 | 3300049824 | Ga0501045_0082917 | Ga0501045_0082917_544_1881 | 435 |
| 209 | iso_pu_bacteria | 2643221711 | 2644609044 | 435 |
| 210 | iso_pu_bacteria | 2808606365 | 2808873480 | 435 |
| 211 | iso_pu_bacteria | 2818991318 | 2819426891 | 435 |
| 212 | iso_pu_bacteria | 2818991462 | 2819692598 | 435 |
| 213 | iso_pu_bacteria | 2818991469 | 2819728841 | 435 |
| 214 | iso_pu_bacteria | 3001889506 | 3001891003 | 435 |
| 215 | iso_pu_bacteria | 2643221679 | 2644446520 | 437 |
| 216 | 3300005440 | Ga0070705_100047352 | Ga0070705_1000473522 | 438 |
| 217 | 3300005615 | Ga0070702_100010223 | Ga0070702_1000102232 | 438 |
| 218 | 3300005616 | Ga0068852_100131508 | Ga0068852_1001315082 | 438 |
| 219 | 3300006881 | Ga0068865_100032788 | Ga0068865_1000327883 | 438 |
| 220 | 3300009148 | Ga0105243_10029437 | Ga0105243_100294372 | 438 |
| 221 | 3300009176 | Ga0105242_10011733 | Ga0105242_100117333 | 438 |
| 222 | 3300013297 | Ga0157378_10005623 | Ga0157378_1000562310 | 438 |
| 223 | 3300025934 | Ga0207686_10036669 | Ga0207686_100366692 | 438 |
| 224 | 3300025938 | Ga0207704_10088559 | Ga0207704_100885592 | 438 |
| 225 | 3300031727 | Ga0316576_10012605 | Ga0316576_100126054 | 438 |
| 226 | 3300031728 | Ga0316578_10047731 | Ga0316578_100477312 | 438 |
| 227 | 3300036712 | Ga0316584_0011852 | Ga0316584_0011852_3418_4773 | 438 |
| 228 | 3300031852 | Ga0307410_10023924 | Ga0307410_100239244 | 439 |
| 229 | 3300031995 | Ga0307409_100200350 | Ga0307409_1002003502 | 439 |
| 230 | 3300037418 | Ga0395900_0039735 | Ga0395900_0039735_1146_2492 | 439 |
| 231 | 3300038443 | Ga0395901_0011024 | Ga0395901_0011024_779_2125 | 439 |
| 232 | 3300048903 | Ga0496100_0054364 | Ga0496100_0054364_156_1502 | 439 |
| 233 | 3300048904 | Ga0496101_0129893 | Ga0496101_0129893_54_1400 | 439 |
| 234 | 3300048905 | Ga0496102_0090869 | Ga0496102_0090869_522_1868 | 439 |
| 235 | 3300048906 | Ga0496103_0010665 | Ga0496103_0010665_3515_4861 | 439 |
| 236 | 3300048907 | Ga0496104_0061960 | Ga0496104_0061960_183_1529 | 439 |
| 237 | 3300048907 | Ga0496104_0088357 | Ga0496104_0088357_919_2265 | 439 |
| 238 | 3300048907 | Ga0496104_0096242 | Ga0496104_0096242_1119_2465 | 439 |
| 239 | 3300048908 | Ga0496105_0013776 | Ga0496105_0013776_3341_4687 | 439 |
| 240 | 3300048914 | Ga0496111_0004360 | Ga0496111_0004360_4621_5967 | 439 |
| 241 | 3300048917 | Ga0496114_0002956 | Ga0496114_0002956_2630_3976 | 439 |
| 242 | 3300048917 | Ga0496114_0013599 | Ga0496114_0013599_4838_6184 | 439 |
| 243 | 3300031727 | Ga0316576_10198211 | Ga0316576_101982112 | 440 |
| 244 | 3300041512 | Ga0451853_1873005 | Ga0451853_1873005_261_1625 | 440 |
| 245 | iso_pu_bacteria | 2811994882 | 2812374195 | 442 |
| 246 | iso_pu_bacteria | 2818991458 | 2819665888 | 442 |
| 247 | 3300020070 | Ga0206356_11465649 | Ga0206356_114656491 | 443 |
| 248 | 3300020070 | Ga0206356_11569333 | Ga0206356_115693332 | 443 |
| 249 | 3300020081 | Ga0206354_10342800 | Ga0206354_103428002 | 443 |
| 250 | 3300020082 | Ga0206353_10733242 | Ga0206353_107332422 | 443 |
| 251 | 3300048906 | Ga0496103_0067027 | Ga0496103_0067027_400_1767 | 443 |
| 252 | 3300009148 | Ga0105243_10114387 | Ga0105243_101143872 | 444 |
| 253 | iso_pu_bacteria | 2643221567 | 2643850727 | 444 |
| 254 | iso_pu_bacteria | 2643221624 | 2644134481 | 444 |
| 255 | iso_pu_bacteria | 2919446982 | 2919449774 | 444 |
| 256 | 3300014326 | Ga0157380_10014591 | Ga0157380_100145913 | 447 |
| 257 | 3300031665 | Ga0316575_10053212 | Ga0316575_100532122 | 447 |
| 258 | 3300031691 | Ga0316579_10001737 | Ga0316579_100017376 | 447 |
| 259 | 3300031691 | Ga0316579_10004164 | Ga0316579_100041643 | 447 |
| 260 | 3300031727 | Ga0316576_10019087 | Ga0316576_100190872 | 447 |
| 261 | 3300031728 | Ga0316578_10001140 | Ga0316578_100011408 | 447 |
| 262 | 3300031728 | Ga0316578_10045805 | Ga0316578_100458052 | 447 |
| 263 | 3300031733 | Ga0316577_10011967 | Ga0316577_100119672 | 447 |
| 264 | 3300032137 | Ga0316585_10000802 | Ga0316585_100008025 | 447 |
| 265 | 3300032139 | Ga0316580_10013997 | Ga0316580_100139972 | 447 |
| 266 | 3300032139 | Ga0316580_10019394 | Ga0316580_100193941 | 447 |
| 267 | 3300032168 | Ga0316593_10036827 | Ga0316593_100368271 | 447 |
| 268 | 3300033528 | Ga0316588_1019698 | Ga0316588_10196982 | 447 |
| 269 | 3300033541 | Ga0316596_1019669 | Ga0316596_10196691 | 447 |
| 270 | 3300035398 | Ga0316574_0001582 | Ga0316574_0001582_8250_9614 | 447 |
| 271 | 3300035398 | Ga0316574_0007258 | Ga0316574_0007258_1132_2496 | 447 |
| 272 | 3300035398 | Ga0316574_0017764 | Ga0316574_0017764_2573_3937 | 447 |
| 273 | 3300036647 | Ga0316582_0001579 | Ga0316582_0001579_4053_5417 | 447 |
| 274 | 3300036647 | Ga0316582_0062833 | Ga0316582_0062833_293_1657 | 447 |
| 275 | 3300036712 | Ga0316584_0022669 | Ga0316584_0022669_1516_2880 | 447 |
| 276 | 3300036712 | Ga0316584_0042631 | Ga0316584_0042631_1027_2391 | 447 |
| 277 | 3300048908 | Ga0496105_0161187 | Ga0496105_0161187_436_1800 | 447 |
| 278 | 3300048911 | Ga0496108_0039007 | Ga0496108_0039007_1073_2437 | 447 |
| 279 | 3300048912 | Ga0496109_0022486 | Ga0496109_0022486_2124_3488 | 447 |
| 280 | 3300048914 | Ga0496111_0057460 | Ga0496111_0057460_1284_2648 | 447 |
| 281 | 3300048917 | Ga0496114_0036366 | Ga0496114_0036366_1016_2380 | 447 |
| 282 | 3300001989 | JGI24739J22299_10033546 | JGI24739J22299_100335462 | 448 |
| 283 | 3300038443 | Ga0395901_0080547 | Ga0395901_0080547_197_1564 | 448 |
| 284 | 3300048905 | Ga0496102_0069431 | Ga0496102_0069431_1555_2922 | 448 |
| 285 | 3300048917 | Ga0496114_0129346 | Ga0496114_0129346_230_1597 | 448 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7w70-assembly1.cif.gz_B | crystal structure of the pdz-c domain fragment of kangiella koreensis rsep orthologue | 0.8598 | 164 | 272 |
| 3id3-assembly1.cif.gz_B | crystal structure of rsep pdz2 i304a domain | 0.8174 | 189 | 275 |
| 3wkm-assembly1.cif.gz_A | the periplasmic pdz tandem fragment of the rsep homologue from aquifex aeolicus in complex with the fab fragment | 0.817 | 158 | 275 |
| 6icc-assembly1.cif.gz_A | the nz-1 fab complexed with the pdz tandem fragment of a. aeolicus s2p homolog with the pa12 tag inserted between the residues 181 and 186 | 0.8094 | 158 | 275 |
| 4fgm-assembly1.cif.gz_A | crystal structure of the aminopeptidase n family protein q5qty1 from idiomarina loihiensis. northeast structural genomics consortium target ilr60. | 0.8053 | 188 | 245 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4D678_1000_1086_2.30.42.10 | Mainly Beta;Roll;Pdz3 Domain;PDZ domain | 0.8705 | 192 | 245 | 2.30.42.10 |
| 3wkmB02 | Mainly Beta;Roll;Pdz3 Domain;PDZ domain | 0.8686 | 191 | 275 | 2.30.42.10 |
| af_Q2FXJ6_310_406_2.30.42.10 | Mainly Beta;Roll;Pdz3 Domain;PDZ domain | 0.8448 | 196 | 245 | 2.30.42.10 |
| af_Q2G1Z5_167_256_2.30.42.10 | Mainly Beta;Roll;Pdz3 Domain;PDZ domain | 0.831 | 164 | 272 | 2.30.42.10 |
| 3id3B00 | Mainly Beta;Roll;Pdz3 Domain;PDZ domain | 0.8174 | 189 | 275 | 2.30.42.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7K0NW98-F1-model_v4 | Peptidase M50 | 0.9464 | 11 | 142 |
GO:0004222
GO:0006508 GO:0016020 |
| AF-A0A496MTS6-F1-model_v4 | Zinc metalloprotease Rip1 | 0.9418 | 6 | 146 |
GO:0004222
GO:0006508 GO:0016020 |
| AF-A0A6B3H9H0-F1-model_v4 | Site-2 protease family protein | 0.9408 | 4 | 127 |
GO:0004222
GO:0006508 GO:0016020 |
| AF-A0A356TKY7-F1-model_v4 | RIP metalloprotease RseP | 0.9305 | 10 | 141 |
GO:0004222
GO:0006508 GO:0016020 |
| AF-A0A6J4R8B5-F1-model_v4 | Intramembrane protease RasP/YluC, implicated in cell division based on FtsL cleavage | 0.9251 | 11 | 147 |
GO:0004222
GO:0006508 GO:0016020 GO:0051301 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar