F387059

General Info

Members Datasets Scaffolds Average Seq Length
285 204 260 436

Family's Representative Sequence

Representative Sequence 3300048917|Ga0496114_0066395|Ga0496114_0066395_1064_2704
Length 521
Sequence VVPWAADQEMPSAPGAVSRLVAGLRPVQQLSGGPQLGDVADEAGELPSPAVHRRDGDQLDEQPAPVALHRRQVGGLNAGRTASSAGRRTLYRMSTLAFVLGVLFMATGVAASIALHEVGHLVPAKRFGVRVTQYMVGFGPTMWSRTRGETEYGVKAVPLGGYIRMIGMFPPRPGDQPGTVRASSTGRFSQLVDEARAASLEEVRPGDERRVFYRLPVHQKVVVMLGGPTMNLLIGVVLLTLLVTVHGVATAQPGAVVASVSQCVVPVTKAGDATTCTDQPKTPALAAGILPGDRFVSIAGQPVDDTTDVGTLIRPRVGEAVPIVVERDGRKVTVTATPIRNIVPVLDDKGVPVTDADGTTQTTEAGFLGVRSSAPVAYEPQPVTAVPGMLWGYVSGTAQALVHVPQRMVGVGEATGGKYDSLVGKSVGDKLWFLVGLIAALNFMLFLFNLIPLLPLDGGHVAGALWEGTKRGLAKLRGRPDPGYVDVAKALPIAYTVSTVLLGASLLLIYADLVKPVNLGG

Samples

Sample ID Description Type Environment
1 2643221546 Microbacterium sp. Root53 Isolate Unclassified
2 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
3 2643221613 Oerskovia sp. Root22 Isolate Unclassified
4 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
5 2643221679 Angustibacter sp. Root456 Isolate Unclassified
6 2643221711 Terrabacter sp. Root85 Isolate Unclassified
7 2643221721 Oerskovia sp. Root918 Isolate Unclassified
8 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
9 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
10 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
11 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
12 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
13 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
14 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
15 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
16 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
17 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
18 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
19 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
20 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
21 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
22 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
23 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
24 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
25 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
26 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
27 3300003285 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
122 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
123 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
124 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
125 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
126 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
132 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
133 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
137 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
138 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
139 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
140 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
141 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
142 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
148 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
149 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
150 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
151 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
152 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
153 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
154 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
155 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
156 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
157 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
158 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
159 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
174 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
175 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
176 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
177 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
178 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
179 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
189 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
193 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
194 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
195 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
196 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
197 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
201 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
202 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
203 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
204 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.42
Metatranscriptomes 2.81
Isolates 8.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.35
Nodule 0
Rhizoplane 11.58
Rhizosphere 78.6
Stem 0
Stem Tuber 0
Unclassified 9.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10033546 3300001989 Bacteria 1755
2 Ga0007423J48922_100409 3300003285 Bacteria 4520
3 Ga0070690_100093846 3300005330 Bacteria 1980
4 Ga0068869_100033126 3300005334 Bacteria 3646
5 Ga0068868_100058785 3300005338 Bacteria 3039
6 Ga0070660_100119086 3300005339 Bacteria 2106
7 Ga0070691_10055232 3300005341 Bacteria 1902
8 Ga0070668_100031122 3300005347 Bacteria 4060
9 Ga0070669_100076337 3300005353 Bacteria 2487
10 Ga0070671_100104803 3300005355 Bacteria 2373
11 Ga0070674_100041870 3300005356 Bacteria 3108
12 Ga0070659_100040496 3300005366 Bacteria 3641
13 Ga0070667_100006935 3300005367 Bacteria 9412
14 Ga0070667_100059367 3300005367 Bacteria 3236
15 Ga0070709_10022633 3300005434 Bacteria 3679
16 Ga0070713_100071298 3300005436 Bacteria 2935
17 Ga0070710_10021594 3300005437 Bacteria 3357
18 Ga0070711_100013613 3300005439 Bacteria 5110
19 Ga0070705_100047352 3300005440 Bacteria 2485
20 Ga0070705_100051915 3300005440 Bacteria 2393
21 Ga0070700_100000019 3300005441 Bacteria 137133
22 Ga0070700_100104794 3300005441 Bacteria 1869
23 Ga0070662_100021306 3300005457 Bacteria 4425
24 Ga0070685_10020762 3300005466 Bacteria 3559
25 Ga0070696_100001435 3300005546 Bacteria 15594
26 Ga0070693_100025674 3300005547 Bacteria 3172
27 Ga0068855_100011521 3300005563 Bacteria 10686
28 Ga0068855_100198525 3300005563 Bacteria 2259
29 Ga0068855_100246170 3300005563 Bacteria 1995
30 Ga0068856_100021183 3300005614 Bacteria 6314
31 Ga0068856_100075752 3300005614 Bacteria 3333
32 Ga0070702_100010223 3300005615 Bacteria 4615
33 Ga0068852_100131508 3300005616 Bacteria 2305
34 Ga0068859_100020471 3300005617 Bacteria 6639
35 Ga0068866_10014676 3300005718 Bacteria 3465
36 Ga0068863_100033331 3300005841 Bacteria 4907
37 Ga0068858_100019113 3300005842 Bacteria 6408
38 Ga0068862_100144579 3300005844 Bacteria 2113
39 Ga0081540_1015414 3300005983 Bacteria 4841
40 Ga0070717_10027609 3300006028 Bacteria 4537
41 Ga0070716_100038853 3300006173 Bacteria 2637
42 Ga0070712_100026354 3300006175 Bacteria 3871
43 Ga0068871_100079814 3300006358 Bacteria 2708
44 Ga0068865_100032788 3300006881 Bacteria 3474
45 Ga0075436_100070563 3300006914 Bacteria 2415
46 Ga0097620_100020471 3300006931 Bacteria 6639
47 Ga0111539_10167016 3300009094 Bacteria 2572
48 Ga0105245_10061732 3300009098 Bacteria 3380
49 Ga0105247_10003967 3300009101 Bacteria 9524
50 Ga0105247_10017923 3300009101 Bacteria 4249
51 Ga0105243_10029437 3300009148 Bacteria 4223
52 Ga0105243_10114387 3300009148 Bacteria 2264
53 Ga0105242_10011733 3300009176 Bacteria 6742
54 Ga0105237_10040052 3300009545 Bacteria 4727
55 Ga0105238_10188626 3300009551 Bacteria 2038
56 Ga0105249_10063405 3300009553 Bacteria 3395
57 Ga0105239_10039259 3300010375 Bacteria 5186
58 Ga0105246_10045786 3300011119 Bacteria 2981
59 Ga0157371_10035481 3300013102 Bacteria 3573
60 Ga0157371_10066149 3300013102 Bacteria 2560
61 Ga0157370_10010932 3300013104 Bacteria 9531
62 Ga0157370_10056163 3300013104 Bacteria 3747
63 Ga0157369_10000631 3300013105 Bacteria 45670
64 Ga0157374_10126815 3300013296 Bacteria 2467
65 Ga0157378_10005623 3300013297 Bacteria 10981
66 Ga0163162_10157762 3300013306 Bacteria 2390
67 Ga0157372_10124186 3300013307 Bacteria 2967
68 Ga0157375_10064515 3300013308 Bacteria 3647
69 Ga0157380_10014591 3300014326 Bacteria 5752
70 Ga0157380_10026328 3300014326 Bacteria 4416
71 Ga0157377_10010842 3300014745 Bacteria 4526
72 Ga0157379_10174995 3300014968 Bacteria 1938
73 Ga0157376_10036024 3300014969 Bacteria 4005
74 Ga0163161_10026985 3300017792 Bacteria 4072
75 Ga0206356_11465649 3300020070 Bacteria 2574
76 Ga0206356_11569333 3300020070 Bacteria 2541
77 Ga0206354_10342800 3300020081 Bacteria 1767
78 Ga0206353_10733242 3300020082 Bacteria 4085
79 Ga0207642_10013468 3300025899 Bacteria 2985
80 Ga0207710_10002240 3300025900 Bacteria 9073
81 Ga0207688_10008791 3300025901 Bacteria 5494
82 Ga0207647_10134455 3300025904 Bacteria 1452
83 Ga0207693_10000409 3300025915 Bacteria 39089
84 Ga0207663_10032525 3300025916 Bacteria 3097
85 Ga0207662_10006697 3300025918 Bacteria 6228
86 Ga0207657_10025779 3300025919 Bacteria 5414
87 Ga0207694_10024682 3300025924 Bacteria 4567
88 Ga0207694_10173931 3300025924 Bacteria 1744
89 Ga0207687_10069510 3300025927 Bacteria 2512
90 Ga0207690_10041719 3300025932 Bacteria 3009
91 Ga0207706_10024851 3300025933 Bacteria 5370
92 Ga0207686_10036669 3300025934 Bacteria 2953
93 Ga0207686_10047476 3300025934 Bacteria 2655
94 Ga0207704_10088559 3300025938 Bacteria 2026
95 Ga0207665_10084933 3300025939 Bacteria 2185
96 Ga0207689_10037553 3300025942 Bacteria 4017
97 Ga0207667_10027650 3300025949 Bacteria 6170
98 Ga0207712_10105547 3300025961 Bacteria 2103
99 Ga0207668_10101761 3300025972 Bacteria 2136
100 Ga0207658_10006114 3300025986 Bacteria 8219
101 Ga0207703_10100351 3300026035 Bacteria 2452
102 Ga0207639_10142483 3300026041 Bacteria 1998
103 Ga0207678_10011042 3300026067 Bacteria 7933
104 Ga0207708_10000038 3300026075 Bacteria 137212
105 Ga0207702_10017726 3300026078 Bacteria 5894
106 Ga0207702_10021734 3300026078 Bacteria 5313
107 Ga0207676_10109476 3300026095 Bacteria 2308
108 Ga0207683_10005450 3300026121 Bacteria 10898
109 Ga0207698_10131171 3300026142 Bacteria 2142
110 Ga0268265_10035037 3300028380 Bacteria 3664
111 Ga0316575_10053212 3300031665 Bacteria 1612
112 Ga0316579_10001737 3300031691 Bacteria 8006
113 Ga0316579_10004164 3300031691 Bacteria 5716
114 Ga0316576_10012605 3300031727 Bacteria 5593
115 Ga0316576_10019087 3300031727 Bacteria 4693
116 Ga0316576_10198211 3300031727 Bacteria 1513
117 Ga0316578_10001140 3300031728 Bacteria 10429
118 Ga0316578_10045805 3300031728 Bacteria 2547
119 Ga0316578_10047731 3300031728 Bacteria 2499
120 Ga0316577_10011967 3300031733 Bacteria 4716
121 Ga0307413_10077641 3300031824 Bacteria 2116
122 Ga0307410_10023924 3300031852 Bacteria 3808
123 Ga0307410_10068928 3300031852 Bacteria 2445
124 Ga0307409_100047151 3300031995 Bacteria 3268
125 Ga0307409_100200350 3300031995 Bacteria 1785
126 Ga0307416_100152259 3300032002 Bacteria 2123
127 Ga0307415_100145885 3300032126 Bacteria 1814
128 Ga0316585_10000802 3300032137 Bacteria 7927
129 Ga0316580_10013997 3300032139 Bacteria 2446
130 Ga0316580_10019394 3300032139 Bacteria 2093
131 Ga0316593_10036827 3300032168 Bacteria 1614
132 Ga0316588_1019698 3300033528 Bacteria 1522
133 Ga0316596_1019669 3300033541 Bacteria 1714
134 Ga0373928_0001391 3300035084 Bacteria 4718
135 Ga0373932_0004199 3300035112 Bacteria 3421
136 Ga0316574_0001582 3300035398 Bacteria 10884
137 Ga0316574_0007258 3300035398 Bacteria 6061
138 Ga0316574_0017764 3300035398 Bacteria 4169
139 Ga0373927_0027250 3300035695 Bacteria 3732
140 Ga0316582_0001579 3300036647 Bacteria 10147
141 Ga0316582_0062833 3300036647 Bacteria 2385
142 Ga0316584_0011852 3300036712 Bacteria 6141
143 Ga0316584_0022669 3300036712 Bacteria 4582
144 Ga0316584_0042631 3300036712 Bacteria 3382
145 Ga0395899_0003096 3300037312 Bacteria 13237
146 Ga0395900_0039735 3300037418 Bacteria 4847
147 Ga0395900_0102808 3300037418 Bacteria 2935
148 Ga0395898_0020767 3300037466 Bacteria 6667
149 Ga0395898_0151210 3300037466 Bacteria 2221
150 Ga0395901_0006787 3300038443 Bacteria 11562
151 Ga0395901_0011024 3300038443 Bacteria 9157
152 Ga0395901_0080547 3300038443 Bacteria 3400
153 Ga0436365_1555741 3300039437 Bacteria 6566
154 Ga0451853_1873005 3300041512 Bacteria 1669
155 Ga0466972_0007787 3300044658 Bacteria 5378
156 Ga0466965_0053119 3300044683 Bacteria 2013
157 Ga0466966_0046786 3300044684 Bacteria 2761
158 Ga0466961_0012639 3300044693 Bacteria 5408
159 Ga0466961_0043353 3300044693 Bacteria 2882
160 Ga0466961_0056868 3300044693 Bacteria 2492
161 Ga0466961_0082692 3300044693 Bacteria 2031
162 Ga0466961_0128646 3300044693 Bacteria 1587
163 Ga0466963_0002248 3300044694 Bacteria 10720
164 Ga0466963_0008686 3300044694 Bacteria 6098
165 Ga0466963_0016342 3300044694 Bacteria 4614
166 Ga0466963_0036528 3300044694 Bacteria 3205
167 Ga0466963_0044948 3300044694 Bacteria 2907
168 Ga0466963_0087010 3300044694 Bacteria 2124
169 Ga0466963_0126080 3300044694 Bacteria 1765
170 Ga0466963_0158848 3300044694 Bacteria 1573
171 Ga0466964_0002434 3300044706 Bacteria 6613
172 Ga0466971_0004941 3300044719 Bacteria 5768
173 Ga0466970_0029186 3300044765 Bacteria 2903
174 Ga0466970_0059519 3300044765 Bacteria 2046
175 Ga0466957_0012711 3300044842 Bacteria 4878
176 Ga0466957_0027885 3300044842 Bacteria 3358
177 Ga0466960_0014394 3300044901 Bacteria 3385
178 Ga0466959_0010078 3300045049 Bacteria 6740
179 Ga0466959_0049129 3300045049 Bacteria 3099
180 Ga0466959_0060883 3300045049 Bacteria 2746
181 Ga0466958_0002046 3300045836 Bacteria 9965
182 Ga0466967_0000698 3300045976 Bacteria 17093
183 Ga0466967_0024807 3300045976 Bacteria 4935
184 Ga0466967_0055225 3300045976 Bacteria 3498
185 Ga0466967_0067759 3300045976 Bacteria 3184
186 Ga0466967_0202164 3300045976 Bacteria 1882
187 Ga0466967_0242113 3300045976 Bacteria 1721
188 Ga0496100_0054364 3300048903 Bacteria 2611
189 Ga0496100_0237084 3300048903 Bacteria 1345
190 Ga0496101_0108708 3300048904 Bacteria 2085
191 Ga0496101_0129893 3300048904 Bacteria 1912
192 Ga0496102_0000094 3300048905 Bacteria 125159
193 Ga0496102_0069431 3300048905 Bacteria 3234
194 Ga0496102_0090869 3300048905 Bacteria 2826
195 Ga0496103_0000042 3300048906 Bacteria 168701
196 Ga0496103_0010665 3300048906 Bacteria 5437
197 Ga0496103_0067027 3300048906 Bacteria 2241
198 Ga0496104_0061960 3300048907 Bacteria 3546
199 Ga0496104_0088357 3300048907 Bacteria 2960
200 Ga0496104_0096242 3300048907 Bacteria 2832
201 Ga0496105_0013776 3300048908 Bacteria 6421
202 Ga0496105_0091377 3300048908 Bacteria 2513
203 Ga0496105_0161187 3300048908 Bacteria 1841
204 Ga0496108_0039007 3300048911 Bacteria 3959
205 Ga0496108_0045506 3300048911 Bacteria 3665
206 Ga0496108_0068137 3300048911 Bacteria 3002
207 Ga0496109_0020228 3300048912 Bacteria 5879
208 Ga0496109_0022486 3300048912 Bacteria 5586
209 Ga0496109_0053175 3300048912 Bacteria 3692
210 Ga0496110_0021843 3300048913 Bacteria 5426
211 Ga0496110_0064877 3300048913 Bacteria 3228
212 Ga0496111_0004360 3300048914 Bacteria 8929
213 Ga0496111_0057460 3300048914 Bacteria 2817
214 Ga0496114_0002956 3300048917 Bacteria 13030
215 Ga0496114_0004219 3300048917 Bacteria 11137
216 Ga0496114_0013599 3300048917 Bacteria 6526
217 Ga0496114_0036366 3300048917 Bacteria 4070
218 Ga0496114_0066395 3300048917 Bacteria 3024
219 Ga0496114_0129346 3300048917 Bacteria 2179
220 Ga0496115_0007997 3300048918 Bacteria 7805
221 Ga0496118_0044238 3300048921 Bacteria 3489
222 Ga0496118_0072345 3300048921 Bacteria 2477
223 Ga0496119_0000055 3300048922 Bacteria 180121
224 Ga0496122_0004513 3300048925 Bacteria 17191
225 Ga0496123_0001305 3300048926 Bacteria 35428
226 Ga0496124_0005518 3300048927 Bacteria 14201
227 Ga0496126_0000006 3300048929 Bacteria 798804
228 Ga0496126_0043191 3300048929 Bacteria 4159
229 Ga0501031_0014816 3300049568 Bacteria 5068
230 Ga0501031_0036350 3300049568 Bacteria 3212
231 Ga0501032_0080589 3300049569 Bacteria 2166
232 Ga0501036_0024119 3300049572 Bacteria 5127
233 Ga0501036_0069371 3300049572 Bacteria 2982
234 Ga0501037_0014840 3300049573 Bacteria 5731
235 Ga0501041_0043677 3300049577 Bacteria 2724
236 Ga0501042_0072957 3300049578 Bacteria 2456
237 Ga0501043_0039041 3300049579 Bacteria 3732
238 Ga0501046_0034585 3300049580 Bacteria 4076
239 Ga0501048_0013140 3300049582 Bacteria 6146
240 Ga0501048_0055093 3300049582 Bacteria 2824
241 Ga0501067_0050611 3300049583 Bacteria 2302
242 Ga0501069_0054919 3300049585 Bacteria 2218
243 Ga0501071_0001400 3300049587 Bacteria 13851
244 Ga0501071_0278534 3300049587 Bacteria 1266
245 Ga0501074_0036197 3300049590 Bacteria 3576
246 Ga0501076_0003749 3300049592 Bacteria 10686
247 Ga0501077_0047951 3300049593 Bacteria 2714
248 Ga0501079_0007990 3300049741 Bacteria 8018
249 Ga0501080_0060857 3300049742 Bacteria 3515
250 Ga0501081_0062474 3300049743 Bacteria 2583
251 Ga0501035_0092761 3300049822 Bacteria 2657
252 Ga0501045_0067956 3300049824 Bacteria 2617
253 Ga0501045_0082917 3300049824 Bacteria 2365
254 Ga0501045_0145923 3300049824 Bacteria 1760
255 nmdc:mga08y16_138568_c1 3300050511 Bacteria 2529
256 nmdc:mga0n895_201709_c1 3300050512 Bacteria 2020
257 nmdc:mga0a205_11750_c1 3300050515 Bacteria 8076
258 Ga0500616_0003057 3300053153 Bacteria 13159
259 Ga0501084_0036046 3300054114 Bacteria 4133
260 Ga0530510_0038396 3300061734 Bacteria 3457

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048903 Ga0496100_0237084 Ga0496100_0237084_215_1324 357
2 3300049587 Ga0501071_0278534 Ga0501071_0278534_145_1254 360
3 3300044694 Ga0466963_0158848 Ga0466963_0158848_308_1549 377
4 3300044694 Ga0466963_0126080 Ga0466963_0126080_17_1225 385
5 3300037466 Ga0395898_0151210 Ga0395898_0151210_976_2205 400
6 3300048929 Ga0496126_0000006 Ga0496126_0000006_486210_487547 400
7 3300005367 Ga0070667_100006935 Ga0070667_1000069354 403
8 3300044693 Ga0466961_0056868 Ga0466961_0056868_1082_2407 406
9 3300044658 Ga0466972_0007787 Ga0466972_0007787_889_2238 410
10 3300044683 Ga0466965_0053119 Ga0466965_0053119_582_1931 410
11 3300044693 Ga0466961_0043353 Ga0466961_0043353_658_2007 410
12 3300044694 Ga0466963_0008686 Ga0466963_0008686_2164_3513 410
13 3300044706 Ga0466964_0002434 Ga0466964_0002434_946_2295 410
14 3300044719 Ga0466971_0004941 Ga0466971_0004941_3073_4422 410
15 3300044842 Ga0466957_0012711 Ga0466957_0012711_2432_3781 410
16 3300045836 Ga0466958_0002046 Ga0466958_0002046_3874_5223 410
17 3300005441 Ga0070700_100000019 Ga0070700_10000001951 413
18 3300026075 Ga0207708_10000038 Ga0207708_1000003851 414
19 3300044765 Ga0466970_0059519 Ga0466970_0059519_164_1507 414
20 3300045049 Ga0466959_0060883 Ga0466959_0060883_1060_2403 414
21 3300025949 Ga0207667_10027650 Ga0207667_100276504 415
22 3300037418 Ga0395900_0102808 Ga0395900_0102808_610_1977 415
23 3300037466 Ga0395898_0020767 Ga0395898_0020767_3103_4470 415
24 3300038443 Ga0395901_0006787 Ga0395901_0006787_7921_9288 415
25 3300044765 Ga0466970_0029186 Ga0466970_0029186_795_2126 416
26 3300044694 Ga0466963_0087010 Ga0466963_0087010_166_1515 417
27 3300005330 Ga0070690_100093846 Ga0070690_1000938462 418
28 3300005334 Ga0068869_100033126 Ga0068869_1000331263 418
29 3300005338 Ga0068868_100058785 Ga0068868_1000587853 418
30 3300005339 Ga0070660_100119086 Ga0070660_1001190862 418
31 3300005341 Ga0070691_10055232 Ga0070691_100552322 418
32 3300005347 Ga0070668_100031122 Ga0070668_1000311222 418
33 3300005353 Ga0070669_100076337 Ga0070669_1000763372 418
34 3300005355 Ga0070671_100104803 Ga0070671_1001048032 418
35 3300005366 Ga0070659_100040496 Ga0070659_1000404962 418
36 3300005367 Ga0070667_100059367 Ga0070667_1000593672 418
37 3300005434 Ga0070709_10022633 Ga0070709_100226332 418
38 3300005436 Ga0070713_100071298 Ga0070713_1000712982 418
39 3300005437 Ga0070710_10021594 Ga0070710_100215942 418
40 3300005439 Ga0070711_100013613 Ga0070711_1000136132 418
41 3300005440 Ga0070705_100051915 Ga0070705_1000519151 418
42 3300005441 Ga0070700_100104794 Ga0070700_1001047942 418
43 3300005457 Ga0070662_100021306 Ga0070662_1000213064 418
44 3300005466 Ga0070685_10020762 Ga0070685_100207622 418
45 3300005547 Ga0070693_100025674 Ga0070693_1000256742 418
46 3300005563 Ga0068855_100198525 Ga0068855_1001985252 418
47 3300005718 Ga0068866_10014676 Ga0068866_100146764 418
48 3300005841 Ga0068863_100033331 Ga0068863_1000333312 418
49 3300005844 Ga0068862_100144579 Ga0068862_1001445792 418
50 3300006028 Ga0070717_10027609 Ga0070717_100276092 418
51 3300006173 Ga0070716_100038853 Ga0070716_1000388532 418
52 3300006175 Ga0070712_100026354 Ga0070712_1000263543 418
53 3300006358 Ga0068871_100079814 Ga0068871_1000798142 418
54 3300006914 Ga0075436_100070563 Ga0075436_1000705632 418
55 3300009094 Ga0111539_10167016 Ga0111539_101670162 418
56 3300009098 Ga0105245_10061732 Ga0105245_100617322 418
57 3300009101 Ga0105247_10017923 Ga0105247_100179231 418
58 3300009545 Ga0105237_10040052 Ga0105237_100400523 418
59 3300009553 Ga0105249_10063405 Ga0105249_100634053 418
60 3300011119 Ga0105246_10045786 Ga0105246_100457862 418
61 3300013102 Ga0157371_10035481 Ga0157371_100354812 418
62 3300013102 Ga0157371_10066149 Ga0157371_100661492 418
63 3300013104 Ga0157370_10010932 Ga0157370_100109329 418
64 3300013104 Ga0157370_10056163 Ga0157370_100561633 418
65 3300013296 Ga0157374_10126815 Ga0157374_101268152 418
66 3300013306 Ga0163162_10157762 Ga0163162_101577622 418
67 3300013307 Ga0157372_10124186 Ga0157372_101241862 418
68 3300013308 Ga0157375_10064515 Ga0157375_100645154 418
69 3300014326 Ga0157380_10026328 Ga0157380_100263284 418
70 3300014745 Ga0157377_10010842 Ga0157377_100108423 418
71 3300014969 Ga0157376_10036024 Ga0157376_100360244 418
72 3300017792 Ga0163161_10026985 Ga0163161_100269854 418
73 3300025899 Ga0207642_10013468 Ga0207642_100134682 418
74 3300025901 Ga0207688_10008791 Ga0207688_100087912 418
75 3300025915 Ga0207693_10000409 Ga0207693_100004099 418
76 3300025916 Ga0207663_10032525 Ga0207663_100325252 418
77 3300025919 Ga0207657_10025779 Ga0207657_100257792 418
78 3300025927 Ga0207687_10069510 Ga0207687_100695102 418
79 3300025932 Ga0207690_10041719 Ga0207690_100417192 418
80 3300025933 Ga0207706_10024851 Ga0207706_100248514 418
81 3300025934 Ga0207686_10047476 Ga0207686_100474762 418
82 3300025939 Ga0207665_10084933 Ga0207665_100849332 418
83 3300025942 Ga0207689_10037553 Ga0207689_100375532 418
84 3300025961 Ga0207712_10105547 Ga0207712_101055471 418
85 3300025972 Ga0207668_10101761 Ga0207668_101017612 418
86 3300026067 Ga0207678_10011042 Ga0207678_100110424 418
87 3300026095 Ga0207676_10109476 Ga0207676_101094761 418
88 3300026121 Ga0207683_10005450 Ga0207683_100054504 418
89 3300026142 Ga0207698_10131171 Ga0207698_101311712 418
90 3300035084 Ga0373928_0001391 Ga0373928_0001391_2958_4322 418
91 3300035112 Ga0373932_0004199 Ga0373932_0004199_502_1866 418
92 3300048904 Ga0496101_0108708 Ga0496101_0108708_637_2001 418
93 3300048908 Ga0496105_0091377 Ga0496105_0091377_400_1764 418
94 3300048911 Ga0496108_0045506 Ga0496108_0045506_794_2158 418
95 3300048912 Ga0496109_0053175 Ga0496109_0053175_1585_2949 418
96 3300048913 Ga0496110_0021843 Ga0496110_0021843_487_1851 418
97 3300048917 Ga0496114_0004219 Ga0496114_0004219_6669_8033 418
98 3300048918 Ga0496115_0007997 Ga0496115_0007997_1510_2874 418
99 3300050511 nmdc:mga08y16_138568_c1 nmdc:mga08y16_138568_c1_696_2060 418
100 3300050512 nmdc:mga0n895_201709_c1 nmdc:mga0n895_201709_c1_67_1431 418
101 3300050515 nmdc:mga0a205_11750_c1 nmdc:mga0a205_11750_c1_637_2001 418
102 3300005617 Ga0068859_100020471 Ga0068859_1000204711 419
103 3300006931 Ga0097620_100020471 Ga0097620_1000204711 419
104 3300009101 Ga0105247_10003967 Ga0105247_100039675 419
105 3300013105 Ga0157369_10000631 Ga0157369_1000063111 419
106 3300025900 Ga0207710_10002240 Ga0207710_100022404 419
107 3300048905 Ga0496102_0000094 Ga0496102_0000094_94743_96047 419
108 3300048906 Ga0496103_0000042 Ga0496103_0000042_140973_142277 419
109 3300048921 Ga0496118_0044238 Ga0496118_0044238_66_1370 419
110 3300005563 Ga0068855_100246170 Ga0068855_1002461702 420
111 3300025904 Ga0207647_10134455 Ga0207647_101344551 420
112 3300049822 Ga0501035_0092761 Ga0501035_0092761_594_1931 420
113 3300014968 Ga0157379_10174995 Ga0157379_101749952 421
114 3300048917 Ga0496114_0066395 Ga0496114_0066395_1064_2704 422
115 3300048929 Ga0496126_0043191 Ga0496126_0043191_167_1477 422
116 3300005563 Ga0068855_100011521 Ga0068855_1000115212 423
117 3300025924 Ga0207694_10173931 Ga0207694_101739312 423
118 3300026078 Ga0207702_10021734 Ga0207702_100217342 423
119 3300044694 Ga0466963_0016342 Ga0466963_0016342_1140_2477 424
120 3300045976 Ga0466967_0055225 Ga0466967_0055225_851_2188 424
121 3300045976 Ga0466967_0067759 Ga0466967_0067759_1840_3165 424
122 3300048911 Ga0496108_0068137 Ga0496108_0068137_165_1490 424
123 3300048912 Ga0496109_0020228 Ga0496109_0020228_742_2067 424
124 3300048913 Ga0496110_0064877 Ga0496110_0064877_646_1971 424
125 3300053153 Ga0500616_0003057 Ga0500616_0003057_10864_12198 424
126 iso_pu_bacteria 2643221546 2643754123 425
127 iso_pu_bacteria 2643221613 2644081815 425
128 iso_pu_bacteria 2643221721 2644665142 425
129 iso_pu_bacteria 2839986021 2839989404 425
130 iso_pu_bacteria 2932431166 2932433505 425
131 iso_pu_bacteria 2935890801 2935891309 425
132 3300005614 Ga0068856_100075752 Ga0068856_1000757521 426
133 3300009551 Ga0105238_10188626 Ga0105238_101886262 426
134 3300010375 Ga0105239_10039259 Ga0105239_100392592 426
135 3300044694 Ga0466963_0002248 Ga0466963_0002248_7705_9066 426
136 3300045976 Ga0466967_0024807 Ga0466967_0024807_2436_3797 426
137 3300003285 Ga0007423J48922_100409 Ga0007423J48922_1004091 427
138 3300005356 Ga0070674_100041870 Ga0070674_1000418702 427
139 3300005842 Ga0068858_100019113 Ga0068858_1000191133 427
140 3300005983 Ga0081540_1015414 Ga0081540_10154144 427
141 3300025918 Ga0207662_10006697 Ga0207662_100066972 427
142 3300025924 Ga0207694_10024682 Ga0207694_100246824 427
143 3300026035 Ga0207703_10100351 Ga0207703_101003512 427
144 3300026041 Ga0207639_10142483 Ga0207639_101424832 427
145 3300028380 Ga0268265_10035037 Ga0268265_100350373 427
146 3300044693 Ga0466961_0082692 Ga0466961_0082692_419_1735 427
147 3300045976 Ga0466967_0000698 Ga0466967_0000698_7623_8927 427
148 3300049824 Ga0501045_0145923 Ga0501045_0145923_194_1537 427
149 3300025986 Ga0207658_10006114 Ga0207658_100061145 428
150 3300035695 Ga0373927_0027250 Ga0373927_0027250_1461_2804 428
151 3300044684 Ga0466966_0046786 Ga0466966_0046786_745_2070 428
152 3300039437 Ga0436365_1555741 Ga0436365_1555741_3188_4567 429
153 3300044694 Ga0466963_0044948 Ga0466963_0044948_412_1740 429
154 3300045976 Ga0466967_0202164 Ga0466967_0202164_416_1744 429
155 3300005546 Ga0070696_100001435 Ga0070696_1000014356 430
156 3300031824 Ga0307413_10077641 Ga0307413_100776412 430
157 3300031852 Ga0307410_10068928 Ga0307410_100689282 430
158 3300031995 Ga0307409_100047151 Ga0307409_1000471513 430
159 3300005614 Ga0068856_100021183 Ga0068856_1000211835 431
160 3300026078 Ga0207702_10017726 Ga0207702_100177262 431
161 3300037312 Ga0395899_0003096 Ga0395899_0003096_4619_5923 431
162 3300044693 Ga0466961_0012639 Ga0466961_0012639_1845_3185 431
163 3300044693 Ga0466961_0128646 Ga0466961_0128646_170_1534 431
164 3300044694 Ga0466963_0036528 Ga0466963_0036528_1326_2690 431
165 3300044842 Ga0466957_0027885 Ga0466957_0027885_1781_3145 431
166 3300044901 Ga0466960_0014394 Ga0466960_0014394_1600_2940 431
167 3300045049 Ga0466959_0010078 Ga0466959_0010078_1984_3324 431
168 3300045049 Ga0466959_0049129 Ga0466959_0049129_1732_3075 431
169 3300045976 Ga0466967_0242113 Ga0466967_0242113_296_1660 431
170 3300048921 Ga0496118_0072345 Ga0496118_0072345_970_2286 431
171 3300048925 Ga0496122_0004513 Ga0496122_0004513_8581_9897 431
172 3300048926 Ga0496123_0001305 Ga0496123_0001305_1524_2840 431
173 3300048927 Ga0496124_0005518 Ga0496124_0005518_9313_10629 431
174 3300049568 Ga0501031_0036350 Ga0501031_0036350_927_2270 431
175 3300049569 Ga0501032_0080589 Ga0501032_0080589_149_1492 431
176 3300049572 Ga0501036_0024119 Ga0501036_0024119_3572_4915 431
177 3300049573 Ga0501037_0014840 Ga0501037_0014840_3128_4471 431
178 3300049577 Ga0501041_0043677 Ga0501041_0043677_1164_2507 431
179 3300049579 Ga0501043_0039041 Ga0501043_0039041_1236_2579 431
180 3300049580 Ga0501046_0034585 Ga0501046_0034585_1745_3088 431
181 3300049582 Ga0501048_0013140 Ga0501048_0013140_3619_4962 431
182 3300049587 Ga0501071_0001400 Ga0501071_0001400_6981_8324 431
183 3300049590 Ga0501074_0036197 Ga0501074_0036197_166_1509 431
184 3300049592 Ga0501076_0003749 Ga0501076_0003749_1359_2702 431
185 3300049593 Ga0501077_0047951 Ga0501077_0047951_155_1498 431
186 3300049741 Ga0501079_0007990 Ga0501079_0007990_1172_2515 431
187 3300049742 Ga0501080_0060857 Ga0501080_0060857_794_2137 431
188 3300049743 Ga0501081_0062474 Ga0501081_0062474_709_2052 431
189 3300049824 Ga0501045_0067956 Ga0501045_0067956_1213_2556 431
190 3300054114 Ga0501084_0036046 Ga0501084_0036046_1578_2921 431
191 3300061734 Ga0530510_0038396 Ga0530510_0038396_400_1743 431
192 3300048922 Ga0496119_0000055 Ga0496119_0000055_38589_39923 432
193 iso_pu_bacteria 2848551377 2848551853 433
194 iso_pu_bacteria 2808606700 2810363443 434
195 iso_pu_bacteria 2857479173 2857481163 434
196 iso_pu_bacteria 2857632687 2857634412 434
197 iso_pu_bacteria 2870801768 2870802969 434
198 iso_pu_bacteria 2870804320 2870805034 434
199 iso_pu_bacteria 2905926851 2905930198 434
200 3300032002 Ga0307416_100152259 Ga0307416_1001522592 435
201 3300032126 Ga0307415_100145885 Ga0307415_1001458852 435
202 3300049568 Ga0501031_0014816 Ga0501031_0014816_253_1590 435
203 3300049572 Ga0501036_0069371 Ga0501036_0069371_168_1505 435
204 3300049578 Ga0501042_0072957 Ga0501042_0072957_455_1792 435
205 3300049582 Ga0501048_0055093 Ga0501048_0055093_1070_2407 435
206 3300049583 Ga0501067_0050611 Ga0501067_0050611_323_1645 435
207 3300049585 Ga0501069_0054919 Ga0501069_0054919_567_1889 435
208 3300049824 Ga0501045_0082917 Ga0501045_0082917_544_1881 435
209 iso_pu_bacteria 2643221711 2644609044 435
210 iso_pu_bacteria 2808606365 2808873480 435
211 iso_pu_bacteria 2818991318 2819426891 435
212 iso_pu_bacteria 2818991462 2819692598 435
213 iso_pu_bacteria 2818991469 2819728841 435
214 iso_pu_bacteria 3001889506 3001891003 435
215 iso_pu_bacteria 2643221679 2644446520 437
216 3300005440 Ga0070705_100047352 Ga0070705_1000473522 438
217 3300005615 Ga0070702_100010223 Ga0070702_1000102232 438
218 3300005616 Ga0068852_100131508 Ga0068852_1001315082 438
219 3300006881 Ga0068865_100032788 Ga0068865_1000327883 438
220 3300009148 Ga0105243_10029437 Ga0105243_100294372 438
221 3300009176 Ga0105242_10011733 Ga0105242_100117333 438
222 3300013297 Ga0157378_10005623 Ga0157378_1000562310 438
223 3300025934 Ga0207686_10036669 Ga0207686_100366692 438
224 3300025938 Ga0207704_10088559 Ga0207704_100885592 438
225 3300031727 Ga0316576_10012605 Ga0316576_100126054 438
226 3300031728 Ga0316578_10047731 Ga0316578_100477312 438
227 3300036712 Ga0316584_0011852 Ga0316584_0011852_3418_4773 438
228 3300031852 Ga0307410_10023924 Ga0307410_100239244 439
229 3300031995 Ga0307409_100200350 Ga0307409_1002003502 439
230 3300037418 Ga0395900_0039735 Ga0395900_0039735_1146_2492 439
231 3300038443 Ga0395901_0011024 Ga0395901_0011024_779_2125 439
232 3300048903 Ga0496100_0054364 Ga0496100_0054364_156_1502 439
233 3300048904 Ga0496101_0129893 Ga0496101_0129893_54_1400 439
234 3300048905 Ga0496102_0090869 Ga0496102_0090869_522_1868 439
235 3300048906 Ga0496103_0010665 Ga0496103_0010665_3515_4861 439
236 3300048907 Ga0496104_0061960 Ga0496104_0061960_183_1529 439
237 3300048907 Ga0496104_0088357 Ga0496104_0088357_919_2265 439
238 3300048907 Ga0496104_0096242 Ga0496104_0096242_1119_2465 439
239 3300048908 Ga0496105_0013776 Ga0496105_0013776_3341_4687 439
240 3300048914 Ga0496111_0004360 Ga0496111_0004360_4621_5967 439
241 3300048917 Ga0496114_0002956 Ga0496114_0002956_2630_3976 439
242 3300048917 Ga0496114_0013599 Ga0496114_0013599_4838_6184 439
243 3300031727 Ga0316576_10198211 Ga0316576_101982112 440
244 3300041512 Ga0451853_1873005 Ga0451853_1873005_261_1625 440
245 iso_pu_bacteria 2811994882 2812374195 442
246 iso_pu_bacteria 2818991458 2819665888 442
247 3300020070 Ga0206356_11465649 Ga0206356_114656491 443
248 3300020070 Ga0206356_11569333 Ga0206356_115693332 443
249 3300020081 Ga0206354_10342800 Ga0206354_103428002 443
250 3300020082 Ga0206353_10733242 Ga0206353_107332422 443
251 3300048906 Ga0496103_0067027 Ga0496103_0067027_400_1767 443
252 3300009148 Ga0105243_10114387 Ga0105243_101143872 444
253 iso_pu_bacteria 2643221567 2643850727 444
254 iso_pu_bacteria 2643221624 2644134481 444
255 iso_pu_bacteria 2919446982 2919449774 444
256 3300014326 Ga0157380_10014591 Ga0157380_100145913 447
257 3300031665 Ga0316575_10053212 Ga0316575_100532122 447
258 3300031691 Ga0316579_10001737 Ga0316579_100017376 447
259 3300031691 Ga0316579_10004164 Ga0316579_100041643 447
260 3300031727 Ga0316576_10019087 Ga0316576_100190872 447
261 3300031728 Ga0316578_10001140 Ga0316578_100011408 447
262 3300031728 Ga0316578_10045805 Ga0316578_100458052 447
263 3300031733 Ga0316577_10011967 Ga0316577_100119672 447
264 3300032137 Ga0316585_10000802 Ga0316585_100008025 447
265 3300032139 Ga0316580_10013997 Ga0316580_100139972 447
266 3300032139 Ga0316580_10019394 Ga0316580_100193941 447
267 3300032168 Ga0316593_10036827 Ga0316593_100368271 447
268 3300033528 Ga0316588_1019698 Ga0316588_10196982 447
269 3300033541 Ga0316596_1019669 Ga0316596_10196691 447
270 3300035398 Ga0316574_0001582 Ga0316574_0001582_8250_9614 447
271 3300035398 Ga0316574_0007258 Ga0316574_0007258_1132_2496 447
272 3300035398 Ga0316574_0017764 Ga0316574_0017764_2573_3937 447
273 3300036647 Ga0316582_0001579 Ga0316582_0001579_4053_5417 447
274 3300036647 Ga0316582_0062833 Ga0316582_0062833_293_1657 447
275 3300036712 Ga0316584_0022669 Ga0316584_0022669_1516_2880 447
276 3300036712 Ga0316584_0042631 Ga0316584_0042631_1027_2391 447
277 3300048908 Ga0496105_0161187 Ga0496105_0161187_436_1800 447
278 3300048911 Ga0496108_0039007 Ga0496108_0039007_1073_2437 447
279 3300048912 Ga0496109_0022486 Ga0496109_0022486_2124_3488 447
280 3300048914 Ga0496111_0057460 Ga0496111_0057460_1284_2648 447
281 3300048917 Ga0496114_0036366 Ga0496114_0036366_1016_2380 447
282 3300001989 JGI24739J22299_10033546 JGI24739J22299_100335462 448
283 3300038443 Ga0395901_0080547 Ga0395901_0080547_197_1564 448
284 3300048905 Ga0496102_0069431 Ga0496102_0069431_1555_2922 448
285 3300048917 Ga0496114_0129346 Ga0496114_0129346_230_1597 448

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17820

PDZ_6

PDZ domain

279

327

0.97

PF02163

Peptidase_M50

Peptidase family M50

104

480

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7w70-assembly1.cif.gz_B crystal structure of the pdz-c domain fragment of kangiella koreensis rsep orthologue 0.8598 164 272
3id3-assembly1.cif.gz_B crystal structure of rsep pdz2 i304a domain 0.8174 189 275
3wkm-assembly1.cif.gz_A the periplasmic pdz tandem fragment of the rsep homologue from aquifex aeolicus in complex with the fab fragment 0.817 158 275
6icc-assembly1.cif.gz_A the nz-1 fab complexed with the pdz tandem fragment of a. aeolicus s2p homolog with the pa12 tag inserted between the residues 181 and 186 0.8094 158 275
4fgm-assembly1.cif.gz_A crystal structure of the aminopeptidase n family protein q5qty1 from idiomarina loihiensis. northeast structural genomics consortium target ilr60. 0.8053 188 245
ID Description Score Start End Superfamily
af_Q4D678_1000_1086_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.8705 192 245 2.30.42.10
3wkmB02 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.8686 191 275 2.30.42.10
af_Q2FXJ6_310_406_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.8448 196 245 2.30.42.10
af_Q2G1Z5_167_256_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.831 164 272 2.30.42.10
3id3B00 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.8174 189 275 2.30.42.10
ID Description Score Start End GO Terms
AF-A0A7K0NW98-F1-model_v4 Peptidase M50 0.9464 11 142 GO:0004222
GO:0006508
GO:0016020
AF-A0A496MTS6-F1-model_v4 Zinc metalloprotease Rip1 0.9418 6 146 GO:0004222
GO:0006508
GO:0016020
AF-A0A6B3H9H0-F1-model_v4 Site-2 protease family protein 0.9408 4 127 GO:0004222
GO:0006508
GO:0016020
AF-A0A356TKY7-F1-model_v4 RIP metalloprotease RseP 0.9305 10 141 GO:0004222
GO:0006508
GO:0016020
AF-A0A6J4R8B5-F1-model_v4 Intramembrane protease RasP/YluC, implicated in cell division based on FtsL cleavage 0.9251 11 147 GO:0004222
GO:0006508
GO:0016020
GO:0051301

Feature Viewer

pLDDT pTM Quality
81.32 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map