F386788
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 285 | 210 | 251 | 94 |
Family's Representative Sequence
| Representative Sequence | 3300013105|Ga0157369_12307129|Ga0157369_123071291 |
| Length | 111 |
| Sequence | MSGVNGENEPSVDLRAAAGRLDGERDPDCSEVLEEVYLYLDLECSEDRRTLIQRHLDDCTHCLREYGIEHEVKALVARCCGDETAPKELRQRLRLKLDQLELQLETREYLP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 2 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 3 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 4 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 5 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 6 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 7 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 8 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 9 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 10 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 11 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 12 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 13 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 14 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 15 | 2858902515 | Micromonospora sp. MW-13 | Isolate | Rhizosphere |
| 16 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 17 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 18 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 19 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 20 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 21 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 22 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 23 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 24 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 25 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 26 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 27 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 28 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 29 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 30 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 31 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 32 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 33 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 62 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 63 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 66 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 91 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 125 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 126 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 127 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 128 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 129 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 130 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 131 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 132 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 133 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 134 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 135 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 136 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 137 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 138 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 139 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 140 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 141 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 142 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 143 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 144 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 145 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 146 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 147 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 148 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 149 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 150 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 151 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 152 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 153 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 154 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 155 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 156 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 157 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 158 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 159 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 160 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 161 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 162 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 163 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 164 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 165 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 166 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 167 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 168 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 169 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 170 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 171 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 172 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 173 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 176 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 178 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 183 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 184 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 185 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 186 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 187 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 188 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 189 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 190 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 192 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 193 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 194 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 195 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 196 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 197 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 198 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 199 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 200 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 201 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 202 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 203 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 204 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 205 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 206 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 207 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 208 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 209 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 210 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 79.65 |
| Metatranscriptomes | 8.42 |
| Isolates | 11.93 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.16 |
| Nodule | 1.75 |
| Rhizoplane | 3.51 |
| Rhizosphere | 72.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 19.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0006778J45830_1026032 | 3300003162 | Bacteria | 1161 |
| 2 | JGI25406J46586_10046430 | 3300003203 | Bacteria | 1488 |
| 3 | rootL2_10025114 | 3300003322 | Bacteria | 1169 |
| 4 | JGI25404J52841_10035267 | 3300003659 | Bacteria | 1065 |
| 5 | Ga0070658_10686538 | 3300005327 | Bacteria | 889 |
| 6 | Ga0070658_10816766 | 3300005327 | Bacteria | 810 |
| 7 | Ga0070676_11324105 | 3300005328 | Bacteria | 551 |
| 8 | Ga0070683_100362826 | 3300005329 | Bacteria | 1380 |
| 9 | Ga0070670_100741602 | 3300005331 | Bacteria | 885 |
| 10 | Ga0068869_102058839 | 3300005334 | Bacteria | 513 |
| 11 | Ga0068868_101511125 | 3300005338 | Bacteria | 629 |
| 12 | Ga0070661_101230231 | 3300005344 | Bacteria | 627 |
| 13 | Ga0070668_100001446 | 3300005347 | Bacteria | 17148 |
| 14 | Ga0070668_101160773 | 3300005347 | Bacteria | 699 |
| 15 | Ga0070671_100625029 | 3300005355 | Bacteria | 931 |
| 16 | Ga0070674_102068215 | 3300005356 | Bacteria | 519 |
| 17 | Ga0070673_102179290 | 3300005364 | Bacteria | 527 |
| 18 | Ga0070659_100262288 | 3300005366 | Bacteria | 1434 |
| 19 | Ga0070659_101520382 | 3300005366 | Bacteria | 597 |
| 20 | Ga0070667_100033669 | 3300005367 | Bacteria | 4285 |
| 21 | Ga0070667_100512025 | 3300005367 | Bacteria | 1101 |
| 22 | Ga0070711_101154496 | 3300005439 | Bacteria | 669 |
| 23 | Ga0070663_100742024 | 3300005455 | Bacteria | 838 |
| 24 | Ga0070685_10276892 | 3300005466 | Bacteria | 1122 |
| 25 | Ga0070684_100357588 | 3300005535 | Bacteria | 1344 |
| 26 | Ga0070672_101326974 | 3300005543 | Bacteria | 643 |
| 27 | Ga0070686_101718299 | 3300005544 | Bacteria | 533 |
| 28 | Ga0070664_100949380 | 3300005564 | Bacteria | 807 |
| 29 | Ga0070664_101742315 | 3300005564 | Bacteria | 591 |
| 30 | Ga0068857_100164892 | 3300005577 | Bacteria | 2012 |
| 31 | Ga0068852_100357439 | 3300005616 | Bacteria | 1428 |
| 32 | Ga0068859_100730670 | 3300005617 | Bacteria | 1080 |
| 33 | Ga0068864_100625264 | 3300005618 | Bacteria | 1047 |
| 34 | Ga0068861_101195611 | 3300005719 | Bacteria | 735 |
| 35 | Ga0068861_102573351 | 3300005719 | Bacteria | 513 |
| 36 | Ga0068870_10568129 | 3300005840 | Bacteria | 766 |
| 37 | Ga0068860_100119078 | 3300005843 | Bacteria | 2528 |
| 38 | Ga0068860_101974735 | 3300005843 | Bacteria | 605 |
| 39 | Ga0068862_100035245 | 3300005844 | Bacteria | 4236 |
| 40 | Ga0068862_100071723 | 3300005844 | Bacteria | 2991 |
| 41 | Ga0068862_100546260 | 3300005844 | Bacteria | 1106 |
| 42 | Ga0081540_1010473 | 3300005983 | Bacteria | 6272 |
| 43 | Ga0081539_10000657 | 3300005985 | Bacteria | 69568 |
| 44 | Ga0081539_10004494 | 3300005985 | Bacteria | 15344 |
| 45 | Ga0081539_10007450 | 3300005985 | Bacteria | 9974 |
| 46 | Ga0070717_10039953 | 3300006028 | Bacteria | 3819 |
| 47 | Ga0068871_101029747 | 3300006358 | Bacteria | 768 |
| 48 | Ga0075428_100532011 | 3300006844 | Bacteria | 1257 |
| 49 | Ga0075428_101411784 | 3300006844 | Bacteria | 731 |
| 50 | Ga0075430_100004417 | 3300006846 | Bacteria | 11867 |
| 51 | Ga0075431_100005322 | 3300006847 | Bacteria | 12689 |
| 52 | Ga0075431_100639411 | 3300006847 | Bacteria | 1045 |
| 53 | Ga0075434_102196886 | 3300006871 | Bacteria | 556 |
| 54 | Ga0075429_100003945 | 3300006880 | Bacteria | 12689 |
| 55 | Ga0075429_100009630 | 3300006880 | Bacteria | 8382 |
| 56 | Ga0068865_102148220 | 3300006881 | Bacteria | 508 |
| 57 | Ga0097620_100730666 | 3300006931 | Bacteria | 1080 |
| 58 | Ga0105250_10210441 | 3300009092 | Bacteria | 822 |
| 59 | Ga0111539_13394493 | 3300009094 | Bacteria | 512 |
| 60 | Ga0105245_10607920 | 3300009098 | Bacteria | 1120 |
| 61 | Ga0105245_11667983 | 3300009098 | Bacteria | 689 |
| 62 | Ga0105247_10334828 | 3300009101 | Bacteria | 1060 |
| 63 | Ga0105247_10353593 | 3300009101 | Bacteria | 1034 |
| 64 | Ga0114129_10000001 | 3300009147 | Bacteria | 292978 |
| 65 | Ga0114129_10026321 | 3300009147 | Bacteria | 8237 |
| 66 | Ga0114129_11396320 | 3300009147 | Bacteria | 864 |
| 67 | Ga0105237_10789106 | 3300009545 | Bacteria | 957 |
| 68 | Ga0105249_10360455 | 3300009553 | Bacteria | 1475 |
| 69 | Ga0105239_10940084 | 3300010375 | Bacteria | 993 |
| 70 | Ga0105239_13554844 | 3300010375 | Bacteria | 506 |
| 71 | Ga0157369_11395248 | 3300013105 | Bacteria | 713 |
| 72 | Ga0157369_12307129 | 3300013105 | Bacteria | 545 |
| 73 | Ga0157374_11171585 | 3300013296 | Bacteria | 790 |
| 74 | Ga0157378_10088001 | 3300013297 | Bacteria | 2818 |
| 75 | Ga0163162_10748247 | 3300013306 | Bacteria | 1097 |
| 76 | Ga0157372_11097780 | 3300013307 | Bacteria | 920 |
| 77 | Ga0157375_10339803 | 3300013308 | Bacteria | 1667 |
| 78 | Ga0157375_10914384 | 3300013308 | Bacteria | 1021 |
| 79 | Ga0157375_13169082 | 3300013308 | Bacteria | 549 |
| 80 | Ga0163163_10732973 | 3300014325 | Bacteria | 1052 |
| 81 | Ga0163163_10981099 | 3300014325 | Bacteria | 908 |
| 82 | Ga0157380_12314891 | 3300014326 | Bacteria | 602 |
| 83 | Ga0157377_10179403 | 3300014745 | Bacteria | 1331 |
| 84 | Ga0157377_10399176 | 3300014745 | Bacteria | 936 |
| 85 | Ga0157376_10767169 | 3300014969 | Bacteria | 975 |
| 86 | Ga0182007_10375155 | 3300015262 | Bacteria | 539 |
| 87 | Ga0163161_10818526 | 3300017792 | Bacteria | 784 |
| 88 | Ga0207692_10389754 | 3300025898 | Bacteria | 866 |
| 89 | Ga0207642_10371793 | 3300025899 | Bacteria | 849 |
| 90 | Ga0207643_10251588 | 3300025908 | Bacteria | 1089 |
| 91 | Ga0207705_10503339 | 3300025909 | Bacteria | 941 |
| 92 | Ga0207705_11385185 | 3300025909 | Bacteria | 535 |
| 93 | Ga0207671_10667577 | 3300025914 | Bacteria | 827 |
| 94 | Ga0207649_10429100 | 3300025920 | Bacteria | 994 |
| 95 | Ga0207681_10880718 | 3300025923 | Bacteria | 749 |
| 96 | Ga0207650_10598928 | 3300025925 | Bacteria | 927 |
| 97 | Ga0207659_11733758 | 3300025926 | Bacteria | 531 |
| 98 | Ga0207687_10655371 | 3300025927 | Bacteria | 888 |
| 99 | Ga0207690_10584958 | 3300025932 | Bacteria | 910 |
| 100 | Ga0207690_11170020 | 3300025932 | Bacteria | 642 |
| 101 | Ga0207669_10836802 | 3300025937 | Bacteria | 765 |
| 102 | Ga0207704_10478777 | 3300025938 | Bacteria | 999 |
| 103 | Ga0207691_11552664 | 3300025940 | Bacteria | 540 |
| 104 | Ga0207689_10723453 | 3300025942 | Bacteria | 840 |
| 105 | Ga0207661_10876233 | 3300025944 | Bacteria | 827 |
| 106 | Ga0207679_11036203 | 3300025945 | Bacteria | 752 |
| 107 | Ga0207712_10832786 | 3300025961 | Bacteria | 812 |
| 108 | Ga0207668_10000959 | 3300025972 | Bacteria | 17381 |
| 109 | Ga0207668_10002883 | 3300025972 | Bacteria | 10088 |
| 110 | Ga0207668_11631296 | 3300025972 | Bacteria | 582 |
| 111 | Ga0207668_12058781 | 3300025972 | Bacteria | 514 |
| 112 | Ga0207658_10126872 | 3300025986 | Bacteria | 2044 |
| 113 | Ga0207658_10763019 | 3300025986 | Bacteria | 876 |
| 114 | Ga0207677_10120819 | 3300026023 | Bacteria | 1970 |
| 115 | Ga0207703_10213512 | 3300026035 | Bacteria | 1722 |
| 116 | Ga0207678_10319445 | 3300026067 | Bacteria | 1336 |
| 117 | Ga0207678_10604383 | 3300026067 | Bacteria | 962 |
| 118 | Ga0207641_10122394 | 3300026088 | Bacteria | 2324 |
| 119 | Ga0207676_11215547 | 3300026095 | Bacteria | 747 |
| 120 | Ga0207674_10266158 | 3300026116 | Bacteria | 1661 |
| 121 | Ga0207675_101330770 | 3300026118 | Bacteria | 739 |
| 122 | Ga0207683_10117241 | 3300026121 | Bacteria | 2388 |
| 123 | Ga0207698_10824810 | 3300026142 | Bacteria | 931 |
| 124 | Ga0268266_10082383 | 3300028379 | Bacteria | 2807 |
| 125 | Ga0268266_11085095 | 3300028379 | Bacteria | 775 |
| 126 | Ga0268265_10016366 | 3300028380 | Bacteria | 5092 |
| 127 | Ga0268265_10179029 | 3300028380 | Bacteria | 1820 |
| 128 | Ga0268265_11208653 | 3300028380 | Bacteria | 754 |
| 129 | Ga0268264_12224583 | 3300028381 | Bacteria | 556 |
| 130 | Ga0307517_10070761 | 3300028786 | Bacteria | 3137 |
| 131 | Ga0307515_10000065 | 3300028794 | Bacteria | 244497 |
| 132 | Ga0307515_10014064 | 3300028794 | Bacteria | 14888 |
| 133 | Ga0307515_10069129 | 3300028794 | Bacteria | 4836 |
| 134 | Ga0307515_10090553 | 3300028794 | Bacteria | 3835 |
| 135 | Ga0307512_10002479 | 3300030522 | Bacteria | 23236 |
| 136 | Ga0307512_10004108 | 3300030522 | Bacteria | 16182 |
| 137 | Ga0307512_10098890 | 3300030522 | Bacteria | 1989 |
| 138 | Ga0307512_10438588 | 3300030522 | Bacteria | 532 |
| 139 | Ga0307513_10011749 | 3300031456 | Bacteria | 10859 |
| 140 | Ga0307513_10042316 | 3300031456 | Bacteria | 5017 |
| 141 | Ga0307408_100382769 | 3300031548 | Bacteria | 1203 |
| 142 | Ga0307508_10000654 | 3300031616 | Bacteria | 41574 |
| 143 | Ga0307508_10017115 | 3300031616 | Bacteria | 6592 |
| 144 | Ga0307508_10027795 | 3300031616 | Bacteria | 5118 |
| 145 | Ga0307508_10044828 | 3300031616 | Bacteria | 3954 |
| 146 | Ga0307508_10121398 | 3300031616 | Bacteria | 2216 |
| 147 | Ga0307508_10218930 | 3300031616 | Bacteria | 1504 |
| 148 | Ga0307514_10320613 | 3300031649 | Bacteria | 851 |
| 149 | Ga0307516_10007505 | 3300031730 | Bacteria | 12543 |
| 150 | Ga0307516_10082750 | 3300031730 | Bacteria | 3051 |
| 151 | Ga0307516_10142788 | 3300031730 | Bacteria | 2161 |
| 152 | Ga0307516_10468431 | 3300031730 | Bacteria | 915 |
| 153 | Ga0307516_10558739 | 3300031730 | Bacteria | 798 |
| 154 | Ga0307405_10016994 | 3300031731 | Bacteria | 3983 |
| 155 | Ga0307405_10071735 | 3300031731 | Bacteria | 2229 |
| 156 | Ga0307405_10198892 | 3300031731 | Bacteria | 1454 |
| 157 | Ga0307405_10461843 | 3300031731 | Bacteria | 1009 |
| 158 | Ga0307413_10017755 | 3300031824 | Bacteria | 3714 |
| 159 | Ga0307410_10579470 | 3300031852 | Bacteria | 933 |
| 160 | Ga0326468_10000101 | 3300031889 | Bacteria | 7564 |
| 161 | Ga0307406_10016456 | 3300031901 | Bacteria | 4297 |
| 162 | Ga0307406_10237009 | 3300031901 | Bacteria | 1366 |
| 163 | Ga0307406_10433414 | 3300031901 | Bacteria | 1050 |
| 164 | Ga0307409_100041457 | 3300031995 | Bacteria | 3439 |
| 165 | Ga0307416_100058454 | 3300032002 | Bacteria | 3126 |
| 166 | Ga0307416_100561517 | 3300032002 | Bacteria | 1216 |
| 167 | Ga0307416_103421466 | 3300032002 | Bacteria | 531 |
| 168 | Ga0307411_10860595 | 3300032005 | Bacteria | 803 |
| 169 | Ga0307415_100006463 | 3300032126 | Bacteria | 6326 |
| 170 | Ga0307415_100224354 | 3300032126 | Bacteria | 1509 |
| 171 | Ga0307415_100548649 | 3300032126 | Bacteria | 1020 |
| 172 | Ga0307415_101238428 | 3300032126 | Bacteria | 704 |
| 173 | Ga0307507_10224618 | 3300033179 | Bacteria | 1256 |
| 174 | Ga0373930_0160701 | 3300034816 | Bacteria | 568 |
| 175 | Ga0373950_0005792 | 3300034818 | Bacteria | 1858 |
| 176 | Ga0373958_0074364 | 3300034819 | Bacteria | 759 |
| 177 | Ga0373926_0239144 | 3300035083 | Bacteria | 703 |
| 178 | Ga0373928_0077105 | 3300035084 | Bacteria | 834 |
| 179 | Ga0373940_0030873 | 3300035088 | Bacteria | 1427 |
| 180 | Ga0373951_0000058 | 3300035091 | Bacteria | 45018 |
| 181 | Ga0373939_0466369 | 3300035114 | Bacteria | 534 |
| 182 | Ga0373942_0000492 | 3300035207 | Bacteria | 11206 |
| 183 | Ga0373962_0011248 | 3300035242 | Bacteria | 2241 |
| 184 | Ga0373931_0902912 | 3300035691 | Bacteria | 594 |
| 185 | Ga0373935_0014090 | 3300035692 | Bacteria | 4827 |
| 186 | Ga0373937_1941998 | 3300036401 | Bacteria | 535 |
| 187 | Ga0395900_0169377 | 3300037418 | Bacteria | 2224 |
| 188 | Ga0395898_0197554 | 3300037466 | Bacteria | 1921 |
| 189 | Ga0395905_0099567 | 3300037471 | Bacteria | 2730 |
| 190 | Ga0436364_0310403 | 3300037853 | Bacteria | 2006 |
| 191 | Ga0395901_0054322 | 3300038443 | Bacteria | 4163 |
| 192 | Ga0451787_785072 | 3300041441 | Bacteria | 524 |
| 193 | Ga0451789_1268452 | 3300041443 | Bacteria | 633 |
| 194 | Ga0451791_0244710 | 3300041451 | Bacteria | 1174 |
| 195 | Ga0451797_0345596 | 3300041453 | Bacteria | 630 |
| 196 | Ga0451800_1101153 | 3300041459 | Bacteria | 627 |
| 197 | Ga0451802_0698277 | 3300041460 | Bacteria | 717 |
| 198 | Ga0451802_1373457 | 3300041460 | Bacteria | 874 |
| 199 | Ga0451804_0048006 | 3300041463 | Bacteria | 651 |
| 200 | Ga0451807_0232236 | 3300041486 | Bacteria | 540 |
| 201 | Ga0451837_1821234 | 3300041494 | Bacteria | 1458 |
| 202 | Ga0451843_1374275 | 3300041509 | Bacteria | 600 |
| 203 | Ga0451853_2951295 | 3300041512 | Bacteria | 956 |
| 204 | Ga0451853_3311038 | 3300041512 | Bacteria | 999 |
| 205 | Ga0439463_021080 | 3300042016 | Bacteria | 1627 |
| 206 | Ga0466967_1605966 | 3300045976 | Bacteria | 648 |
| 207 | Ga0495632_0019459 | 3300046519 | Bacteria | 3697 |
| 208 | Ga0495632_0127259 | 3300046519 | Bacteria | 1187 |
| 209 | Ga0495649_0452750 | 3300046694 | Bacteria | 641 |
| 210 | Ga0496108_0000010 | 3300048911 | Bacteria | 273269 |
| 211 | Ga0501045_0449293 | 3300049824 | Bacteria | 958 |
| 212 | nmdc:mga00v17_256823_c1 | 3300050491 | Bacteria | 1133 |
| 213 | nmdc:mga05p37_1502161_c1 | 3300050507 | Bacteria | 671 |
| 214 | nmdc:mga05p37_2088_c1 | 3300050507 | Bacteria | 23310 |
| 215 | nmdc:mga05p37_614655_c1 | 3300050507 | Bacteria | 1224 |
| 216 | nmdc:mga09592_70_c1 | 3300050508 | Bacteria | 57439 |
| 217 | nmdc:mga0qj67_15_c2 | 3300050509 | Bacteria | 66458 |
| 218 | nmdc:mga06r32_1364129_c1 | 3300050510 | Bacteria | 651 |
| 219 | nmdc:mga06r32_60_c2 | 3300050510 | Bacteria | 57439 |
| 220 | Ga0500578_0387459 | 3300053086 | Bacteria | 809 |
| 221 | Ga0500644_0059340 | 3300053088 | Bacteria | 1342 |
| 222 | Ga0500646_0092882 | 3300053090 | Bacteria | 937 |
| 223 | Ga0500651_0312961 | 3300053093 | Bacteria | 898 |
| 224 | Ga0500641_0143329 | 3300053096 | Bacteria | 1032 |
| 225 | Ga0500594_0026709 | 3300053118 | Bacteria | 1489 |
| 226 | Ga0500652_015449 | 3300053131 | Bacteria | 2755 |
| 227 | Ga0500588_0325399 | 3300053146 | Bacteria | 583 |
| 228 | Ga0501084_0624585 | 3300054114 | Bacteria | 910 |
| 229 | Ga0587073_0072338 | 3300059492 | Bacteria | 836 |
| 230 | Ga0587073_0276834 | 3300059492 | Bacteria | 537 |
| 231 | Ga0587077_077773 | 3300059493 | Bacteria | 755 |
| 232 | Ga0587082_027055 | 3300059504 | Bacteria | 975 |
| 233 | Ga0587083_0048943 | 3300059505 | Bacteria | 915 |
| 234 | Ga0587083_0050803 | 3300059505 | Bacteria | 903 |
| 235 | Ga0587083_0217054 | 3300059505 | Bacteria | 554 |
| 236 | Ga0587083_0231037 | 3300059505 | Bacteria | 543 |
| 237 | Ga0587088_116396 | 3300059508 | Bacteria | 614 |
| 238 | Ga0587098_017456 | 3300059604 | Bacteria | 879 |
| 239 | Ga0587106_040673 | 3300059605 | Bacteria | 788 |
| 240 | Ga0587106_114018 | 3300059605 | Bacteria | 566 |
| 241 | Ga0587069_157757 | 3300059642 | Bacteria | 508 |
| 242 | Ga0587075_047408 | 3300059644 | Bacteria | 740 |
| 243 | Ga0587075_047496 | 3300059644 | Bacteria | 739 |
| 244 | Ga0587075_125609 | 3300059644 | Bacteria | 535 |
| 245 | Ga0587079_037797 | 3300059647 | Bacteria | 961 |
| 246 | Ga0587107_116783 | 3300059652 | Bacteria | 546 |
| 247 | Ga0587114_132391 | 3300059655 | Bacteria | 514 |
| 248 | Ga0587071_119950 | 3300060344 | Bacteria | 627 |
| 249 | Ga0587071_148531 | 3300060344 | Bacteria | 581 |
| 250 | Ga0587071_154831 | 3300060344 | Bacteria | 572 |
| 251 | Ga0587111_0248594 | 3300060346 | Bacteria | 525 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300030522 | Ga0307512_10438588 | Ga0307512_104385882 | 89 |
| 2 | iso_pu_bacteria | 2622736626 | 2623591566 | 89 |
| 3 | iso_pu_bacteria | 2772190715 | 2772645758 | 89 |
| 4 | iso_pu_bacteria | 2832004796 | 2832007154 | 89 |
| 5 | iso_pu_bacteria | 2855670206 | 2855670564 | 89 |
| 6 | iso_pu_bacteria | 2855676851 | 2855683515 | 89 |
| 7 | iso_pu_bacteria | 2855683550 | 2855687306 | 89 |
| 8 | iso_pu_bacteria | 2856858025 | 2856858616 | 89 |
| 9 | iso_pu_bacteria | 2857288857 | 2857288910 | 89 |
| 10 | iso_pu_bacteria | 2858848962 | 2858854262 | 89 |
| 11 | iso_pu_bacteria | 2858868258 | 2858872821 | 89 |
| 12 | iso_pu_bacteria | 2858882152 | 2858887243 | 89 |
| 13 | iso_pu_bacteria | 2858888857 | 2858892097 | 89 |
| 14 | iso_pu_bacteria | 2858895516 | 2858897789 | 89 |
| 15 | iso_pu_bacteria | 2858902515 | 2858903180 | 89 |
| 16 | iso_pu_bacteria | 2866065130 | 2866069889 | 89 |
| 17 | iso_pu_bacteria | 2867302475 | 2867305457 | 89 |
| 18 | iso_pu_bacteria | 2867312974 | 2867316713 | 89 |
| 19 | iso_pu_bacteria | 2867319477 | 2867321906 | 89 |
| 20 | iso_pu_bacteria | 2869048445 | 2869052334 | 89 |
| 21 | iso_pu_bacteria | 2869061728 | 2869068488 | 89 |
| 22 | iso_pu_bacteria | 2869068681 | 2869070548 | 89 |
| 23 | iso_pu_bacteria | 2880489317 | 2880495523 | 89 |
| 24 | iso_pu_bacteria | 2880495981 | 2880496833 | 89 |
| 25 | iso_pu_bacteria | 2902582711 | 2902583846 | 89 |
| 26 | iso_pu_bacteria | 2929219909 | 2929225455 | 89 |
| 27 | iso_pu_bacteria | 2929226422 | 2929231570 | 89 |
| 28 | iso_pu_bacteria | 2996221748 | 2996223968 | 89 |
| 29 | iso_pu_bacteria | 649633069 | 649813202 | 89 |
| 30 | iso_pu_bacteria | 8003830390 | 8003833794 | 89 |
| 31 | iso_pu_bacteria | 8003856774 | 8003863424 | 89 |
| 32 | iso_pu_bacteria | 8054704163 | 8054704481 | 89 |
| 33 | iso_pu_bacteria | 8054727385 | 8054734415 | 89 |
| 34 | iso_pu_bacteria | 8054734606 | 8054740178 | 89 |
| 35 | 3300005564 | Ga0070664_100949380 | Ga0070664_1009493802 | 91 |
| 36 | 3300005577 | Ga0068857_100164892 | Ga0068857_1001648923 | 91 |
| 37 | 3300005840 | Ga0068870_10568129 | Ga0068870_105681292 | 91 |
| 38 | 3300005844 | Ga0068862_100546260 | Ga0068862_1005462602 | 91 |
| 39 | 3300009147 | Ga0114129_11396320 | Ga0114129_113963202 | 91 |
| 40 | 3300009553 | Ga0105249_10360455 | Ga0105249_103604553 | 91 |
| 41 | 3300013308 | Ga0157375_13169082 | Ga0157375_131690822 | 91 |
| 42 | 3300014325 | Ga0163163_10981099 | Ga0163163_109810992 | 91 |
| 43 | 3300025908 | Ga0207643_10251588 | Ga0207643_102515882 | 91 |
| 44 | 3300025961 | Ga0207712_10832786 | Ga0207712_108327862 | 91 |
| 45 | 3300026116 | Ga0207674_10266158 | Ga0207674_102661582 | 91 |
| 46 | 3300028380 | Ga0268265_11208653 | Ga0268265_112086531 | 91 |
| 47 | 3300031730 | Ga0307516_10468431 | Ga0307516_104684312 | 91 |
| 48 | 3300034816 | Ga0373930_0160701 | Ga0373930_0160701_19_303 | 91 |
| 49 | 3300034818 | Ga0373950_0005792 | Ga0373950_0005792_854_1138 | 91 |
| 50 | 3300034819 | Ga0373958_0074364 | Ga0373958_0074364_235_519 | 91 |
| 51 | 3300035084 | Ga0373928_0077105 | Ga0373928_0077105_427_711 | 91 |
| 52 | 3300035088 | Ga0373940_0030873 | Ga0373940_0030873_649_933 | 91 |
| 53 | 3300035207 | Ga0373942_0000492 | Ga0373942_0000492_8781_9065 | 91 |
| 54 | 3300035242 | Ga0373962_0011248 | Ga0373962_0011248_1819_2103 | 91 |
| 55 | 3300050507 | nmdc:mga05p37_1502161_c1 | nmdc:mga05p37_1502161_c1_306_584 | 91 |
| 56 | 3300059605 | Ga0587106_114018 | Ga0587106_114018_211_486 | 91 |
| 57 | 3300059642 | Ga0587069_157757 | Ga0587069_157757_24_299 | 91 |
| 58 | iso_pu_bacteria | 2751185782 | 2753267442 | 91 |
| 59 | 3300003162 | Ga0006778J45830_1026032 | Ga0006778J45830_10260322 | 92 |
| 60 | 3300003203 | JGI25406J46586_10046430 | JGI25406J46586_100464302 | 92 |
| 61 | 3300003322 | rootL2_10025114 | rootL2_100251141 | 92 |
| 62 | 3300003659 | JGI25404J52841_10035267 | JGI25404J52841_100352671 | 92 |
| 63 | 3300005327 | Ga0070658_10686538 | Ga0070658_106865382 | 92 |
| 64 | 3300005327 | Ga0070658_10816766 | Ga0070658_108167662 | 92 |
| 65 | 3300005328 | Ga0070676_11324105 | Ga0070676_113241052 | 92 |
| 66 | 3300005329 | Ga0070683_100362826 | Ga0070683_1003628263 | 92 |
| 67 | 3300005331 | Ga0070670_100741602 | Ga0070670_1007416022 | 92 |
| 68 | 3300005334 | Ga0068869_102058839 | Ga0068869_1020588391 | 92 |
| 69 | 3300005338 | Ga0068868_101511125 | Ga0068868_1015111252 | 92 |
| 70 | 3300005344 | Ga0070661_101230231 | Ga0070661_1012302312 | 92 |
| 71 | 3300005347 | Ga0070668_100001446 | Ga0070668_10000144613 | 92 |
| 72 | 3300005347 | Ga0070668_101160773 | Ga0070668_1011607731 | 92 |
| 73 | 3300005355 | Ga0070671_100625029 | Ga0070671_1006250292 | 92 |
| 74 | 3300005356 | Ga0070674_102068215 | Ga0070674_1020682152 | 92 |
| 75 | 3300005364 | Ga0070673_102179290 | Ga0070673_1021792902 | 92 |
| 76 | 3300005366 | Ga0070659_100262288 | Ga0070659_1002622881 | 92 |
| 77 | 3300005366 | Ga0070659_101520382 | Ga0070659_1015203822 | 92 |
| 78 | 3300005367 | Ga0070667_100033669 | Ga0070667_1000336696 | 92 |
| 79 | 3300005367 | Ga0070667_100512025 | Ga0070667_1005120252 | 92 |
| 80 | 3300005439 | Ga0070711_101154496 | Ga0070711_1011544962 | 92 |
| 81 | 3300005455 | Ga0070663_100742024 | Ga0070663_1007420241 | 92 |
| 82 | 3300005466 | Ga0070685_10276892 | Ga0070685_102768922 | 92 |
| 83 | 3300005535 | Ga0070684_100357588 | Ga0070684_1003575882 | 92 |
| 84 | 3300005543 | Ga0070672_101326974 | Ga0070672_1013269742 | 92 |
| 85 | 3300005544 | Ga0070686_101718299 | Ga0070686_1017182992 | 92 |
| 86 | 3300005564 | Ga0070664_101742315 | Ga0070664_1017423152 | 92 |
| 87 | 3300005616 | Ga0068852_100357439 | Ga0068852_1003574392 | 92 |
| 88 | 3300005617 | Ga0068859_100730670 | Ga0068859_1007306702 | 92 |
| 89 | 3300005618 | Ga0068864_100625264 | Ga0068864_1006252642 | 92 |
| 90 | 3300005719 | Ga0068861_101195611 | Ga0068861_1011956111 | 92 |
| 91 | 3300005719 | Ga0068861_102573351 | Ga0068861_1025733512 | 92 |
| 92 | 3300005843 | Ga0068860_100119078 | Ga0068860_1001190784 | 92 |
| 93 | 3300005843 | Ga0068860_101974735 | Ga0068860_1019747352 | 92 |
| 94 | 3300005844 | Ga0068862_100035245 | Ga0068862_1000352453 | 92 |
| 95 | 3300005844 | Ga0068862_100071723 | Ga0068862_1000717233 | 92 |
| 96 | 3300005983 | Ga0081540_1010473 | Ga0081540_10104736 | 92 |
| 97 | 3300005985 | Ga0081539_10000657 | Ga0081539_100006578 | 92 |
| 98 | 3300005985 | Ga0081539_10004494 | Ga0081539_1000449420 | 92 |
| 99 | 3300005985 | Ga0081539_10007450 | Ga0081539_100074505 | 92 |
| 100 | 3300006028 | Ga0070717_10039953 | Ga0070717_100399535 | 92 |
| 101 | 3300006358 | Ga0068871_101029747 | Ga0068871_1010297471 | 92 |
| 102 | 3300006844 | Ga0075428_100532011 | Ga0075428_1005320114 | 92 |
| 103 | 3300006844 | Ga0075428_101411784 | Ga0075428_1014117842 | 92 |
| 104 | 3300006846 | Ga0075430_100004417 | Ga0075430_1000044172 | 92 |
| 105 | 3300006847 | Ga0075431_100005322 | Ga0075431_1000053222 | 92 |
| 106 | 3300006847 | Ga0075431_100639411 | Ga0075431_1006394112 | 92 |
| 107 | 3300006871 | Ga0075434_102196886 | Ga0075434_1021968862 | 92 |
| 108 | 3300006880 | Ga0075429_100003945 | Ga0075429_1000039452 | 92 |
| 109 | 3300006880 | Ga0075429_100009630 | Ga0075429_1000096306 | 92 |
| 110 | 3300006881 | Ga0068865_102148220 | Ga0068865_1021482202 | 92 |
| 111 | 3300006931 | Ga0097620_100730666 | Ga0097620_1007306662 | 92 |
| 112 | 3300009092 | Ga0105250_10210441 | Ga0105250_102104412 | 92 |
| 113 | 3300009094 | Ga0111539_13394493 | Ga0111539_133944931 | 92 |
| 114 | 3300009098 | Ga0105245_10607920 | Ga0105245_106079202 | 92 |
| 115 | 3300009098 | Ga0105245_11667983 | Ga0105245_116679832 | 92 |
| 116 | 3300009101 | Ga0105247_10334828 | Ga0105247_103348283 | 92 |
| 117 | 3300009101 | Ga0105247_10353593 | Ga0105247_103535932 | 92 |
| 118 | 3300009147 | Ga0114129_10000001 | Ga0114129_1000000133 | 92 |
| 119 | 3300009147 | Ga0114129_10026321 | Ga0114129_100263212 | 92 |
| 120 | 3300009545 | Ga0105237_10789106 | Ga0105237_107891062 | 92 |
| 121 | 3300010375 | Ga0105239_10940084 | Ga0105239_109400842 | 92 |
| 122 | 3300010375 | Ga0105239_13554844 | Ga0105239_135548442 | 92 |
| 123 | 3300013105 | Ga0157369_11395248 | Ga0157369_113952482 | 92 |
| 124 | 3300013105 | Ga0157369_12307129 | Ga0157369_123071291 | 92 |
| 125 | 3300013296 | Ga0157374_11171585 | Ga0157374_111715852 | 92 |
| 126 | 3300013297 | Ga0157378_10088001 | Ga0157378_100880012 | 92 |
| 127 | 3300013306 | Ga0163162_10748247 | Ga0163162_107482473 | 92 |
| 128 | 3300013307 | Ga0157372_11097780 | Ga0157372_110977802 | 92 |
| 129 | 3300013308 | Ga0157375_10339803 | Ga0157375_103398033 | 92 |
| 130 | 3300013308 | Ga0157375_10914384 | Ga0157375_109143841 | 92 |
| 131 | 3300014325 | Ga0163163_10732973 | Ga0163163_107329731 | 92 |
| 132 | 3300014326 | Ga0157380_12314891 | Ga0157380_123148912 | 92 |
| 133 | 3300014745 | Ga0157377_10179403 | Ga0157377_101794032 | 92 |
| 134 | 3300014745 | Ga0157377_10399176 | Ga0157377_103991761 | 92 |
| 135 | 3300014969 | Ga0157376_10767169 | Ga0157376_107671692 | 92 |
| 136 | 3300015262 | Ga0182007_10375155 | Ga0182007_103751551 | 92 |
| 137 | 3300017792 | Ga0163161_10818526 | Ga0163161_108185261 | 92 |
| 138 | 3300025898 | Ga0207692_10389754 | Ga0207692_103897542 | 92 |
| 139 | 3300025899 | Ga0207642_10371793 | Ga0207642_103717931 | 92 |
| 140 | 3300025909 | Ga0207705_10503339 | Ga0207705_105033392 | 92 |
| 141 | 3300025909 | Ga0207705_11385185 | Ga0207705_113851852 | 92 |
| 142 | 3300025914 | Ga0207671_10667577 | Ga0207671_106675772 | 92 |
| 143 | 3300025920 | Ga0207649_10429100 | Ga0207649_104291002 | 92 |
| 144 | 3300025923 | Ga0207681_10880718 | Ga0207681_108807182 | 92 |
| 145 | 3300025925 | Ga0207650_10598928 | Ga0207650_105989281 | 92 |
| 146 | 3300025926 | Ga0207659_11733758 | Ga0207659_117337581 | 92 |
| 147 | 3300025927 | Ga0207687_10655371 | Ga0207687_106553711 | 92 |
| 148 | 3300025932 | Ga0207690_10584958 | Ga0207690_105849582 | 92 |
| 149 | 3300025932 | Ga0207690_11170020 | Ga0207690_111700202 | 92 |
| 150 | 3300025937 | Ga0207669_10836802 | Ga0207669_108368022 | 92 |
| 151 | 3300025938 | Ga0207704_10478777 | Ga0207704_104787771 | 92 |
| 152 | 3300025940 | Ga0207691_11552664 | Ga0207691_115526642 | 92 |
| 153 | 3300025942 | Ga0207689_10723453 | Ga0207689_107234532 | 92 |
| 154 | 3300025944 | Ga0207661_10876233 | Ga0207661_108762332 | 92 |
| 155 | 3300025945 | Ga0207679_11036203 | Ga0207679_110362031 | 92 |
| 156 | 3300025972 | Ga0207668_10000959 | Ga0207668_100009596 | 92 |
| 157 | 3300025972 | Ga0207668_10002883 | Ga0207668_100028839 | 92 |
| 158 | 3300025972 | Ga0207668_11631296 | Ga0207668_116312961 | 92 |
| 159 | 3300025972 | Ga0207668_12058781 | Ga0207668_120587811 | 92 |
| 160 | 3300025986 | Ga0207658_10126872 | Ga0207658_101268722 | 92 |
| 161 | 3300025986 | Ga0207658_10763019 | Ga0207658_107630192 | 92 |
| 162 | 3300026023 | Ga0207677_10120819 | Ga0207677_101208192 | 92 |
| 163 | 3300026035 | Ga0207703_10213512 | Ga0207703_102135123 | 92 |
| 164 | 3300026067 | Ga0207678_10319445 | Ga0207678_103194452 | 92 |
| 165 | 3300026067 | Ga0207678_10604383 | Ga0207678_106043832 | 92 |
| 166 | 3300026088 | Ga0207641_10122394 | Ga0207641_101223943 | 92 |
| 167 | 3300026095 | Ga0207676_11215547 | Ga0207676_112155472 | 92 |
| 168 | 3300026118 | Ga0207675_101330770 | Ga0207675_1013307701 | 92 |
| 169 | 3300026121 | Ga0207683_10117241 | Ga0207683_101172414 | 92 |
| 170 | 3300026142 | Ga0207698_10824810 | Ga0207698_108248102 | 92 |
| 171 | 3300028379 | Ga0268266_10082383 | Ga0268266_100823832 | 92 |
| 172 | 3300028379 | Ga0268266_11085095 | Ga0268266_110850952 | 92 |
| 173 | 3300028380 | Ga0268265_10016366 | Ga0268265_100163665 | 92 |
| 174 | 3300028380 | Ga0268265_10179029 | Ga0268265_101790293 | 92 |
| 175 | 3300028381 | Ga0268264_12224583 | Ga0268264_122245832 | 92 |
| 176 | 3300028786 | Ga0307517_10070761 | Ga0307517_100707613 | 92 |
| 177 | 3300028794 | Ga0307515_10000065 | Ga0307515_10000065104 | 92 |
| 178 | 3300028794 | Ga0307515_10014064 | Ga0307515_1001406415 | 92 |
| 179 | 3300028794 | Ga0307515_10069129 | Ga0307515_100691294 | 92 |
| 180 | 3300028794 | Ga0307515_10090553 | Ga0307515_100905533 | 92 |
| 181 | 3300030522 | Ga0307512_10002479 | Ga0307512_1000247924 | 92 |
| 182 | 3300030522 | Ga0307512_10004108 | Ga0307512_100041089 | 92 |
| 183 | 3300030522 | Ga0307512_10098890 | Ga0307512_100988902 | 92 |
| 184 | 3300031456 | Ga0307513_10011749 | Ga0307513_1001174910 | 92 |
| 185 | 3300031456 | Ga0307513_10042316 | Ga0307513_100423167 | 92 |
| 186 | 3300031548 | Ga0307408_100382769 | Ga0307408_1003827692 | 92 |
| 187 | 3300031616 | Ga0307508_10000654 | Ga0307508_1000065420 | 92 |
| 188 | 3300031616 | Ga0307508_10017115 | Ga0307508_100171153 | 92 |
| 189 | 3300031616 | Ga0307508_10027795 | Ga0307508_100277956 | 92 |
| 190 | 3300031616 | Ga0307508_10044828 | Ga0307508_100448283 | 92 |
| 191 | 3300031616 | Ga0307508_10121398 | Ga0307508_101213983 | 92 |
| 192 | 3300031616 | Ga0307508_10218930 | Ga0307508_102189303 | 92 |
| 193 | 3300031649 | Ga0307514_10320613 | Ga0307514_103206131 | 92 |
| 194 | 3300031730 | Ga0307516_10007505 | Ga0307516_100075056 | 92 |
| 195 | 3300031730 | Ga0307516_10082750 | Ga0307516_100827504 | 92 |
| 196 | 3300031730 | Ga0307516_10142788 | Ga0307516_101427883 | 92 |
| 197 | 3300031730 | Ga0307516_10558739 | Ga0307516_105587391 | 92 |
| 198 | 3300031731 | Ga0307405_10016994 | Ga0307405_100169944 | 92 |
| 199 | 3300031731 | Ga0307405_10071735 | Ga0307405_100717351 | 92 |
| 200 | 3300031731 | Ga0307405_10198892 | Ga0307405_101988922 | 92 |
| 201 | 3300031731 | Ga0307405_10461843 | Ga0307405_104618432 | 92 |
| 202 | 3300031824 | Ga0307413_10017755 | Ga0307413_100177553 | 92 |
| 203 | 3300031852 | Ga0307410_10579470 | Ga0307410_105794702 | 92 |
| 204 | 3300031889 | Ga0326468_10000101 | Ga0326468_100001011 | 92 |
| 205 | 3300031901 | Ga0307406_10016456 | Ga0307406_100164566 | 92 |
| 206 | 3300031901 | Ga0307406_10237009 | Ga0307406_102370094 | 92 |
| 207 | 3300031901 | Ga0307406_10433414 | Ga0307406_104334141 | 92 |
| 208 | 3300031995 | Ga0307409_100041457 | Ga0307409_1000414574 | 92 |
| 209 | 3300032002 | Ga0307416_100058454 | Ga0307416_1000584543 | 92 |
| 210 | 3300032002 | Ga0307416_100561517 | Ga0307416_1005615172 | 92 |
| 211 | 3300032002 | Ga0307416_103421466 | Ga0307416_1034214662 | 92 |
| 212 | 3300032005 | Ga0307411_10860595 | Ga0307411_108605952 | 92 |
| 213 | 3300032126 | Ga0307415_100006463 | Ga0307415_1000064634 | 92 |
| 214 | 3300032126 | Ga0307415_100224354 | Ga0307415_1002243543 | 92 |
| 215 | 3300032126 | Ga0307415_100548649 | Ga0307415_1005486491 | 92 |
| 216 | 3300032126 | Ga0307415_101238428 | Ga0307415_1012384282 | 92 |
| 217 | 3300033179 | Ga0307507_10224618 | Ga0307507_102246182 | 92 |
| 218 | 3300035083 | Ga0373926_0239144 | Ga0373926_0239144_288_575 | 92 |
| 219 | 3300035091 | Ga0373951_0000058 | Ga0373951_0000058_3773_4051 | 92 |
| 220 | 3300035114 | Ga0373939_0466369 | Ga0373939_0466369_105_392 | 92 |
| 221 | 3300035691 | Ga0373931_0902912 | Ga0373931_0902912_153_440 | 92 |
| 222 | 3300035692 | Ga0373935_0014090 | Ga0373935_0014090_1216_1503 | 92 |
| 223 | 3300036401 | Ga0373937_1941998 | Ga0373937_1941998_200_487 | 92 |
| 224 | 3300037418 | Ga0395900_0169377 | Ga0395900_0169377_56_349 | 92 |
| 225 | 3300037466 | Ga0395898_0197554 | Ga0395898_0197554_709_1002 | 92 |
| 226 | 3300037471 | Ga0395905_0099567 | Ga0395905_0099567_1182_1475 | 92 |
| 227 | 3300037853 | Ga0436364_0310403 | Ga0436364_0310403_37_324 | 92 |
| 228 | 3300038443 | Ga0395901_0054322 | Ga0395901_0054322_2172_2465 | 92 |
| 229 | 3300041441 | Ga0451787_785072 | Ga0451787_785072_127_414 | 92 |
| 230 | 3300041443 | Ga0451789_1268452 | Ga0451789_1268452_19_306 | 92 |
| 231 | 3300041451 | Ga0451791_0244710 | Ga0451791_0244710_200_487 | 92 |
| 232 | 3300041453 | Ga0451797_0345596 | Ga0451797_0345596_278_565 | 92 |
| 233 | 3300041459 | Ga0451800_1101153 | Ga0451800_1101153_285_569 | 92 |
| 234 | 3300041460 | Ga0451802_0698277 | Ga0451802_0698277_378_665 | 92 |
| 235 | 3300041460 | Ga0451802_1373457 | Ga0451802_1373457_303_590 | 92 |
| 236 | 3300041463 | Ga0451804_0048006 | Ga0451804_0048006_340_627 | 92 |
| 237 | 3300041486 | Ga0451807_0232236 | Ga0451807_0232236_62_349 | 92 |
| 238 | 3300041494 | Ga0451837_1821234 | Ga0451837_1821234_819_1106 | 92 |
| 239 | 3300041509 | Ga0451843_1374275 | Ga0451843_1374275_78_362 | 92 |
| 240 | 3300041512 | Ga0451853_2951295 | Ga0451853_2951295_560_844 | 92 |
| 241 | 3300041512 | Ga0451853_3311038 | Ga0451853_3311038_396_683 | 92 |
| 242 | 3300042016 | Ga0439463_021080 | Ga0439463_021080_1267_1545 | 92 |
| 243 | 3300045976 | Ga0466967_1605966 | Ga0466967_1605966_243_521 | 92 |
| 244 | 3300046519 | Ga0495632_0019459 | Ga0495632_0019459_3205_3492 | 92 |
| 245 | 3300046519 | Ga0495632_0127259 | Ga0495632_0127259_715_1002 | 92 |
| 246 | 3300046694 | Ga0495649_0452750 | Ga0495649_0452750_320_607 | 92 |
| 247 | 3300048911 | Ga0496108_0000010 | Ga0496108_0000010_150511_150798 | 92 |
| 248 | 3300049824 | Ga0501045_0449293 | Ga0501045_0449293_492_776 | 92 |
| 249 | 3300050491 | nmdc:mga00v17_256823_c1 | nmdc:mga00v17_256823_c1_538_825 | 92 |
| 250 | 3300050507 | nmdc:mga05p37_2088_c1 | nmdc:mga05p37_2088_c1_14337_14621 | 92 |
| 251 | 3300050507 | nmdc:mga05p37_614655_c1 | nmdc:mga05p37_614655_c1_13_306 | 92 |
| 252 | 3300050508 | nmdc:mga09592_70_c1 | nmdc:mga09592_70_c1_41221_41505 | 92 |
| 253 | 3300050509 | nmdc:mga0qj67_15_c2 | nmdc:mga0qj67_15_c2_32161_32445 | 92 |
| 254 | 3300050510 | nmdc:mga06r32_1364129_c1 | nmdc:mga06r32_1364129_c1_268_561 | 92 |
| 255 | 3300050510 | nmdc:mga06r32_60_c2 | nmdc:mga06r32_60_c2_15935_16219 | 92 |
| 256 | 3300053086 | Ga0500578_0387459 | Ga0500578_0387459_319_606 | 92 |
| 257 | 3300053088 | Ga0500644_0059340 | Ga0500644_0059340_446_730 | 92 |
| 258 | 3300053090 | Ga0500646_0092882 | Ga0500646_0092882_638_925 | 92 |
| 259 | 3300053093 | Ga0500651_0312961 | Ga0500651_0312961_374_661 | 92 |
| 260 | 3300053096 | Ga0500641_0143329 | Ga0500641_0143329_70_357 | 92 |
| 261 | 3300053118 | Ga0500594_0026709 | Ga0500594_0026709_98_385 | 92 |
| 262 | 3300053131 | Ga0500652_015449 | Ga0500652_015449_1929_2216 | 92 |
| 263 | 3300053146 | Ga0500588_0325399 | Ga0500588_0325399_218_505 | 92 |
| 264 | 3300054114 | Ga0501084_0624585 | Ga0501084_0624585_54_338 | 92 |
| 265 | 3300059492 | Ga0587073_0072338 | Ga0587073_0072338_411_689 | 92 |
| 266 | 3300059492 | Ga0587073_0276834 | Ga0587073_0276834_96_374 | 92 |
| 267 | 3300059493 | Ga0587077_077773 | Ga0587077_077773_67_345 | 92 |
| 268 | 3300059504 | Ga0587082_027055 | Ga0587082_027055_392_670 | 92 |
| 269 | 3300059505 | Ga0587083_0048943 | Ga0587083_0048943_89_367 | 92 |
| 270 | 3300059505 | Ga0587083_0050803 | Ga0587083_0050803_520_804 | 92 |
| 271 | 3300059505 | Ga0587083_0217054 | Ga0587083_0217054_137_415 | 92 |
| 272 | 3300059505 | Ga0587083_0231037 | Ga0587083_0231037_89_367 | 92 |
| 273 | 3300059508 | Ga0587088_116396 | Ga0587088_116396_176_454 | 92 |
| 274 | 3300059604 | Ga0587098_017456 | Ga0587098_017456_418_696 | 92 |
| 275 | 3300059605 | Ga0587106_040673 | Ga0587106_040673_470_748 | 92 |
| 276 | 3300059644 | Ga0587075_047408 | Ga0587075_047408_211_489 | 92 |
| 277 | 3300059644 | Ga0587075_047496 | Ga0587075_047496_61_339 | 92 |
| 278 | 3300059644 | Ga0587075_125609 | Ga0587075_125609_89_367 | 92 |
| 279 | 3300059647 | Ga0587079_037797 | Ga0587079_037797_593_871 | 92 |
| 280 | 3300059652 | Ga0587107_116783 | Ga0587107_116783_211_489 | 92 |
| 281 | 3300059655 | Ga0587114_132391 | Ga0587114_132391_170_469 | 92 |
| 282 | 3300060344 | Ga0587071_119950 | Ga0587071_119950_175_453 | 92 |
| 283 | 3300060344 | Ga0587071_148531 | Ga0587071_148531_129_407 | 92 |
| 284 | 3300060344 | Ga0587071_154831 | Ga0587071_154831_38_322 | 92 |
| 285 | 3300060346 | Ga0587111_0248594 | Ga0587111_0248594_54_332 | 92 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5frh-assembly1.cif.gz_A | solution structure of oxidised rsra | 0.7293 | 4 | 83 |
| 5frh-assembly1.cif.gz_A | solution structure of oxidised rsra | 0.6435 | 4 | 83 |
| 2lch-assembly1.cif.gz_A | solution nmr structure of a protein with a redesigned hydrophobic core, northeast structural genomics consortium target or38 | 0.5593 | 10 | 88 |
| 2lch-assembly1.cif.gz_A | solution nmr structure of a protein with a redesigned hydrophobic core, northeast structural genomics consortium target or38 | 0.4957 | 10 | 88 |
| 3u3b-assembly2.cif.gz_B | crystal structure of computationally redesigned four-helix bundle | 0.4723 | 7 | 87 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1JAW9_541_693_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.5598 | 3 | 64 | 1.25.10.10 |
| 2lchA00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain | 0.5593 | 10 | 88 | 1.20.120.160 |
| af_G5EGK1_1078_1232_1.20.1420.10 | Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain | 0.498 | 7 | 79 | 1.20.1420.10 |
| 2lchA00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain | 0.4957 | 10 | 88 | 1.20.120.160 |
| 3u3bB00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain | 0.4723 | 7 | 87 | 1.20.120.160 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A810L0B1-F1-model_v4 | Putative zinc-finger domain-containing protein | 0.8654 | 14 | 84 |
|
| AF-A0A2X0KGQ7-F1-model_v4 | Mycothiol system anti-sigma-R factor | 0.8372 | 10 | 83 |
|
| AF-A0A6N7I8I2-F1-model_v4 | Mycothiol system anti-sigma-R factor | 0.8349 | 6 | 84 |
|
| AF-A0A7W1B156-F1-model_v4 | Mycothiol system anti-sigma-R factor | 0.8336 | 5 | 85 |
|
| AF-A0A3D4WUJ6-F1-model_v4 | Mycothiol system anti-sigma-R factor | 0.8321 | 2 | 86 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar