F386788

General Info

Members Datasets Scaffolds Average Seq Length
285 210 251 94

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_12307129|Ga0157369_123071291
Length 111
Sequence MSGVNGENEPSVDLRAAAGRLDGERDPDCSEVLEEVYLYLDLECSEDRRTLIQRHLDDCTHCLREYGIEHEVKALVARCCGDETAPKELRQRLRLKLDQLELQLETREYLP

Samples

Sample ID Description Type Environment
1 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
2 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
3 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
4 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
5 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
6 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
7 2855683550 Micromonospora sp. RP3T Isolate Unclassified
8 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
9 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
10 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
11 2858868258 Micromonospora sp. MH33 Isolate Unclassified
12 2858882152 Micromonospora noduli MED15 Isolate Nodule
13 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
14 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
15 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
16 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
17 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
18 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
19 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
20 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
21 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
22 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
23 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
24 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
25 2902582711 Micromonospora sp. AP08 Isolate Unclassified
26 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
27 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
28 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
29 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
30 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
32 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
34 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
35 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
125 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
126 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
127 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
130 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
131 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
142 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
143 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
144 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
145 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
146 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
147 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
148 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
149 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
150 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
151 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
161 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
162 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
163 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
164 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
165 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
166 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
167 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
168 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
169 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
170 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
171 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
174 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
177 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
180 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
181 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
182 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
183 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
184 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
185 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
186 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
187 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
188 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
189 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
190 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
191 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 649633069 Micromonospora sp. L5 Isolate Unclassified
206 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
207 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
208 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
209 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
210 8054734606 Micromonospora hortensis NIE111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79.65
Metatranscriptomes 8.42
Isolates 11.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.16
Nodule 1.75
Rhizoplane 3.51
Rhizosphere 72.28
Stem 0
Stem Tuber 0
Unclassified 19.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006778J45830_1026032 3300003162 Bacteria 1161
2 JGI25406J46586_10046430 3300003203 Bacteria 1488
3 rootL2_10025114 3300003322 Bacteria 1169
4 JGI25404J52841_10035267 3300003659 Bacteria 1065
5 Ga0070658_10686538 3300005327 Bacteria 889
6 Ga0070658_10816766 3300005327 Bacteria 810
7 Ga0070676_11324105 3300005328 Bacteria 551
8 Ga0070683_100362826 3300005329 Bacteria 1380
9 Ga0070670_100741602 3300005331 Bacteria 885
10 Ga0068869_102058839 3300005334 Bacteria 513
11 Ga0068868_101511125 3300005338 Bacteria 629
12 Ga0070661_101230231 3300005344 Bacteria 627
13 Ga0070668_100001446 3300005347 Bacteria 17148
14 Ga0070668_101160773 3300005347 Bacteria 699
15 Ga0070671_100625029 3300005355 Bacteria 931
16 Ga0070674_102068215 3300005356 Bacteria 519
17 Ga0070673_102179290 3300005364 Bacteria 527
18 Ga0070659_100262288 3300005366 Bacteria 1434
19 Ga0070659_101520382 3300005366 Bacteria 597
20 Ga0070667_100033669 3300005367 Bacteria 4285
21 Ga0070667_100512025 3300005367 Bacteria 1101
22 Ga0070711_101154496 3300005439 Bacteria 669
23 Ga0070663_100742024 3300005455 Bacteria 838
24 Ga0070685_10276892 3300005466 Bacteria 1122
25 Ga0070684_100357588 3300005535 Bacteria 1344
26 Ga0070672_101326974 3300005543 Bacteria 643
27 Ga0070686_101718299 3300005544 Bacteria 533
28 Ga0070664_100949380 3300005564 Bacteria 807
29 Ga0070664_101742315 3300005564 Bacteria 591
30 Ga0068857_100164892 3300005577 Bacteria 2012
31 Ga0068852_100357439 3300005616 Bacteria 1428
32 Ga0068859_100730670 3300005617 Bacteria 1080
33 Ga0068864_100625264 3300005618 Bacteria 1047
34 Ga0068861_101195611 3300005719 Bacteria 735
35 Ga0068861_102573351 3300005719 Bacteria 513
36 Ga0068870_10568129 3300005840 Bacteria 766
37 Ga0068860_100119078 3300005843 Bacteria 2528
38 Ga0068860_101974735 3300005843 Bacteria 605
39 Ga0068862_100035245 3300005844 Bacteria 4236
40 Ga0068862_100071723 3300005844 Bacteria 2991
41 Ga0068862_100546260 3300005844 Bacteria 1106
42 Ga0081540_1010473 3300005983 Bacteria 6272
43 Ga0081539_10000657 3300005985 Bacteria 69568
44 Ga0081539_10004494 3300005985 Bacteria 15344
45 Ga0081539_10007450 3300005985 Bacteria 9974
46 Ga0070717_10039953 3300006028 Bacteria 3819
47 Ga0068871_101029747 3300006358 Bacteria 768
48 Ga0075428_100532011 3300006844 Bacteria 1257
49 Ga0075428_101411784 3300006844 Bacteria 731
50 Ga0075430_100004417 3300006846 Bacteria 11867
51 Ga0075431_100005322 3300006847 Bacteria 12689
52 Ga0075431_100639411 3300006847 Bacteria 1045
53 Ga0075434_102196886 3300006871 Bacteria 556
54 Ga0075429_100003945 3300006880 Bacteria 12689
55 Ga0075429_100009630 3300006880 Bacteria 8382
56 Ga0068865_102148220 3300006881 Bacteria 508
57 Ga0097620_100730666 3300006931 Bacteria 1080
58 Ga0105250_10210441 3300009092 Bacteria 822
59 Ga0111539_13394493 3300009094 Bacteria 512
60 Ga0105245_10607920 3300009098 Bacteria 1120
61 Ga0105245_11667983 3300009098 Bacteria 689
62 Ga0105247_10334828 3300009101 Bacteria 1060
63 Ga0105247_10353593 3300009101 Bacteria 1034
64 Ga0114129_10000001 3300009147 Bacteria 292978
65 Ga0114129_10026321 3300009147 Bacteria 8237
66 Ga0114129_11396320 3300009147 Bacteria 864
67 Ga0105237_10789106 3300009545 Bacteria 957
68 Ga0105249_10360455 3300009553 Bacteria 1475
69 Ga0105239_10940084 3300010375 Bacteria 993
70 Ga0105239_13554844 3300010375 Bacteria 506
71 Ga0157369_11395248 3300013105 Bacteria 713
72 Ga0157369_12307129 3300013105 Bacteria 545
73 Ga0157374_11171585 3300013296 Bacteria 790
74 Ga0157378_10088001 3300013297 Bacteria 2818
75 Ga0163162_10748247 3300013306 Bacteria 1097
76 Ga0157372_11097780 3300013307 Bacteria 920
77 Ga0157375_10339803 3300013308 Bacteria 1667
78 Ga0157375_10914384 3300013308 Bacteria 1021
79 Ga0157375_13169082 3300013308 Bacteria 549
80 Ga0163163_10732973 3300014325 Bacteria 1052
81 Ga0163163_10981099 3300014325 Bacteria 908
82 Ga0157380_12314891 3300014326 Bacteria 602
83 Ga0157377_10179403 3300014745 Bacteria 1331
84 Ga0157377_10399176 3300014745 Bacteria 936
85 Ga0157376_10767169 3300014969 Bacteria 975
86 Ga0182007_10375155 3300015262 Bacteria 539
87 Ga0163161_10818526 3300017792 Bacteria 784
88 Ga0207692_10389754 3300025898 Bacteria 866
89 Ga0207642_10371793 3300025899 Bacteria 849
90 Ga0207643_10251588 3300025908 Bacteria 1089
91 Ga0207705_10503339 3300025909 Bacteria 941
92 Ga0207705_11385185 3300025909 Bacteria 535
93 Ga0207671_10667577 3300025914 Bacteria 827
94 Ga0207649_10429100 3300025920 Bacteria 994
95 Ga0207681_10880718 3300025923 Bacteria 749
96 Ga0207650_10598928 3300025925 Bacteria 927
97 Ga0207659_11733758 3300025926 Bacteria 531
98 Ga0207687_10655371 3300025927 Bacteria 888
99 Ga0207690_10584958 3300025932 Bacteria 910
100 Ga0207690_11170020 3300025932 Bacteria 642
101 Ga0207669_10836802 3300025937 Bacteria 765
102 Ga0207704_10478777 3300025938 Bacteria 999
103 Ga0207691_11552664 3300025940 Bacteria 540
104 Ga0207689_10723453 3300025942 Bacteria 840
105 Ga0207661_10876233 3300025944 Bacteria 827
106 Ga0207679_11036203 3300025945 Bacteria 752
107 Ga0207712_10832786 3300025961 Bacteria 812
108 Ga0207668_10000959 3300025972 Bacteria 17381
109 Ga0207668_10002883 3300025972 Bacteria 10088
110 Ga0207668_11631296 3300025972 Bacteria 582
111 Ga0207668_12058781 3300025972 Bacteria 514
112 Ga0207658_10126872 3300025986 Bacteria 2044
113 Ga0207658_10763019 3300025986 Bacteria 876
114 Ga0207677_10120819 3300026023 Bacteria 1970
115 Ga0207703_10213512 3300026035 Bacteria 1722
116 Ga0207678_10319445 3300026067 Bacteria 1336
117 Ga0207678_10604383 3300026067 Bacteria 962
118 Ga0207641_10122394 3300026088 Bacteria 2324
119 Ga0207676_11215547 3300026095 Bacteria 747
120 Ga0207674_10266158 3300026116 Bacteria 1661
121 Ga0207675_101330770 3300026118 Bacteria 739
122 Ga0207683_10117241 3300026121 Bacteria 2388
123 Ga0207698_10824810 3300026142 Bacteria 931
124 Ga0268266_10082383 3300028379 Bacteria 2807
125 Ga0268266_11085095 3300028379 Bacteria 775
126 Ga0268265_10016366 3300028380 Bacteria 5092
127 Ga0268265_10179029 3300028380 Bacteria 1820
128 Ga0268265_11208653 3300028380 Bacteria 754
129 Ga0268264_12224583 3300028381 Bacteria 556
130 Ga0307517_10070761 3300028786 Bacteria 3137
131 Ga0307515_10000065 3300028794 Bacteria 244497
132 Ga0307515_10014064 3300028794 Bacteria 14888
133 Ga0307515_10069129 3300028794 Bacteria 4836
134 Ga0307515_10090553 3300028794 Bacteria 3835
135 Ga0307512_10002479 3300030522 Bacteria 23236
136 Ga0307512_10004108 3300030522 Bacteria 16182
137 Ga0307512_10098890 3300030522 Bacteria 1989
138 Ga0307512_10438588 3300030522 Bacteria 532
139 Ga0307513_10011749 3300031456 Bacteria 10859
140 Ga0307513_10042316 3300031456 Bacteria 5017
141 Ga0307408_100382769 3300031548 Bacteria 1203
142 Ga0307508_10000654 3300031616 Bacteria 41574
143 Ga0307508_10017115 3300031616 Bacteria 6592
144 Ga0307508_10027795 3300031616 Bacteria 5118
145 Ga0307508_10044828 3300031616 Bacteria 3954
146 Ga0307508_10121398 3300031616 Bacteria 2216
147 Ga0307508_10218930 3300031616 Bacteria 1504
148 Ga0307514_10320613 3300031649 Bacteria 851
149 Ga0307516_10007505 3300031730 Bacteria 12543
150 Ga0307516_10082750 3300031730 Bacteria 3051
151 Ga0307516_10142788 3300031730 Bacteria 2161
152 Ga0307516_10468431 3300031730 Bacteria 915
153 Ga0307516_10558739 3300031730 Bacteria 798
154 Ga0307405_10016994 3300031731 Bacteria 3983
155 Ga0307405_10071735 3300031731 Bacteria 2229
156 Ga0307405_10198892 3300031731 Bacteria 1454
157 Ga0307405_10461843 3300031731 Bacteria 1009
158 Ga0307413_10017755 3300031824 Bacteria 3714
159 Ga0307410_10579470 3300031852 Bacteria 933
160 Ga0326468_10000101 3300031889 Bacteria 7564
161 Ga0307406_10016456 3300031901 Bacteria 4297
162 Ga0307406_10237009 3300031901 Bacteria 1366
163 Ga0307406_10433414 3300031901 Bacteria 1050
164 Ga0307409_100041457 3300031995 Bacteria 3439
165 Ga0307416_100058454 3300032002 Bacteria 3126
166 Ga0307416_100561517 3300032002 Bacteria 1216
167 Ga0307416_103421466 3300032002 Bacteria 531
168 Ga0307411_10860595 3300032005 Bacteria 803
169 Ga0307415_100006463 3300032126 Bacteria 6326
170 Ga0307415_100224354 3300032126 Bacteria 1509
171 Ga0307415_100548649 3300032126 Bacteria 1020
172 Ga0307415_101238428 3300032126 Bacteria 704
173 Ga0307507_10224618 3300033179 Bacteria 1256
174 Ga0373930_0160701 3300034816 Bacteria 568
175 Ga0373950_0005792 3300034818 Bacteria 1858
176 Ga0373958_0074364 3300034819 Bacteria 759
177 Ga0373926_0239144 3300035083 Bacteria 703
178 Ga0373928_0077105 3300035084 Bacteria 834
179 Ga0373940_0030873 3300035088 Bacteria 1427
180 Ga0373951_0000058 3300035091 Bacteria 45018
181 Ga0373939_0466369 3300035114 Bacteria 534
182 Ga0373942_0000492 3300035207 Bacteria 11206
183 Ga0373962_0011248 3300035242 Bacteria 2241
184 Ga0373931_0902912 3300035691 Bacteria 594
185 Ga0373935_0014090 3300035692 Bacteria 4827
186 Ga0373937_1941998 3300036401 Bacteria 535
187 Ga0395900_0169377 3300037418 Bacteria 2224
188 Ga0395898_0197554 3300037466 Bacteria 1921
189 Ga0395905_0099567 3300037471 Bacteria 2730
190 Ga0436364_0310403 3300037853 Bacteria 2006
191 Ga0395901_0054322 3300038443 Bacteria 4163
192 Ga0451787_785072 3300041441 Bacteria 524
193 Ga0451789_1268452 3300041443 Bacteria 633
194 Ga0451791_0244710 3300041451 Bacteria 1174
195 Ga0451797_0345596 3300041453 Bacteria 630
196 Ga0451800_1101153 3300041459 Bacteria 627
197 Ga0451802_0698277 3300041460 Bacteria 717
198 Ga0451802_1373457 3300041460 Bacteria 874
199 Ga0451804_0048006 3300041463 Bacteria 651
200 Ga0451807_0232236 3300041486 Bacteria 540
201 Ga0451837_1821234 3300041494 Bacteria 1458
202 Ga0451843_1374275 3300041509 Bacteria 600
203 Ga0451853_2951295 3300041512 Bacteria 956
204 Ga0451853_3311038 3300041512 Bacteria 999
205 Ga0439463_021080 3300042016 Bacteria 1627
206 Ga0466967_1605966 3300045976 Bacteria 648
207 Ga0495632_0019459 3300046519 Bacteria 3697
208 Ga0495632_0127259 3300046519 Bacteria 1187
209 Ga0495649_0452750 3300046694 Bacteria 641
210 Ga0496108_0000010 3300048911 Bacteria 273269
211 Ga0501045_0449293 3300049824 Bacteria 958
212 nmdc:mga00v17_256823_c1 3300050491 Bacteria 1133
213 nmdc:mga05p37_1502161_c1 3300050507 Bacteria 671
214 nmdc:mga05p37_2088_c1 3300050507 Bacteria 23310
215 nmdc:mga05p37_614655_c1 3300050507 Bacteria 1224
216 nmdc:mga09592_70_c1 3300050508 Bacteria 57439
217 nmdc:mga0qj67_15_c2 3300050509 Bacteria 66458
218 nmdc:mga06r32_1364129_c1 3300050510 Bacteria 651
219 nmdc:mga06r32_60_c2 3300050510 Bacteria 57439
220 Ga0500578_0387459 3300053086 Bacteria 809
221 Ga0500644_0059340 3300053088 Bacteria 1342
222 Ga0500646_0092882 3300053090 Bacteria 937
223 Ga0500651_0312961 3300053093 Bacteria 898
224 Ga0500641_0143329 3300053096 Bacteria 1032
225 Ga0500594_0026709 3300053118 Bacteria 1489
226 Ga0500652_015449 3300053131 Bacteria 2755
227 Ga0500588_0325399 3300053146 Bacteria 583
228 Ga0501084_0624585 3300054114 Bacteria 910
229 Ga0587073_0072338 3300059492 Bacteria 836
230 Ga0587073_0276834 3300059492 Bacteria 537
231 Ga0587077_077773 3300059493 Bacteria 755
232 Ga0587082_027055 3300059504 Bacteria 975
233 Ga0587083_0048943 3300059505 Bacteria 915
234 Ga0587083_0050803 3300059505 Bacteria 903
235 Ga0587083_0217054 3300059505 Bacteria 554
236 Ga0587083_0231037 3300059505 Bacteria 543
237 Ga0587088_116396 3300059508 Bacteria 614
238 Ga0587098_017456 3300059604 Bacteria 879
239 Ga0587106_040673 3300059605 Bacteria 788
240 Ga0587106_114018 3300059605 Bacteria 566
241 Ga0587069_157757 3300059642 Bacteria 508
242 Ga0587075_047408 3300059644 Bacteria 740
243 Ga0587075_047496 3300059644 Bacteria 739
244 Ga0587075_125609 3300059644 Bacteria 535
245 Ga0587079_037797 3300059647 Bacteria 961
246 Ga0587107_116783 3300059652 Bacteria 546
247 Ga0587114_132391 3300059655 Bacteria 514
248 Ga0587071_119950 3300060344 Bacteria 627
249 Ga0587071_148531 3300060344 Bacteria 581
250 Ga0587071_154831 3300060344 Bacteria 572
251 Ga0587111_0248594 3300060346 Bacteria 525

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300030522 Ga0307512_10438588 Ga0307512_104385882 89
2 iso_pu_bacteria 2622736626 2623591566 89
3 iso_pu_bacteria 2772190715 2772645758 89
4 iso_pu_bacteria 2832004796 2832007154 89
5 iso_pu_bacteria 2855670206 2855670564 89
6 iso_pu_bacteria 2855676851 2855683515 89
7 iso_pu_bacteria 2855683550 2855687306 89
8 iso_pu_bacteria 2856858025 2856858616 89
9 iso_pu_bacteria 2857288857 2857288910 89
10 iso_pu_bacteria 2858848962 2858854262 89
11 iso_pu_bacteria 2858868258 2858872821 89
12 iso_pu_bacteria 2858882152 2858887243 89
13 iso_pu_bacteria 2858888857 2858892097 89
14 iso_pu_bacteria 2858895516 2858897789 89
15 iso_pu_bacteria 2858902515 2858903180 89
16 iso_pu_bacteria 2866065130 2866069889 89
17 iso_pu_bacteria 2867302475 2867305457 89
18 iso_pu_bacteria 2867312974 2867316713 89
19 iso_pu_bacteria 2867319477 2867321906 89
20 iso_pu_bacteria 2869048445 2869052334 89
21 iso_pu_bacteria 2869061728 2869068488 89
22 iso_pu_bacteria 2869068681 2869070548 89
23 iso_pu_bacteria 2880489317 2880495523 89
24 iso_pu_bacteria 2880495981 2880496833 89
25 iso_pu_bacteria 2902582711 2902583846 89
26 iso_pu_bacteria 2929219909 2929225455 89
27 iso_pu_bacteria 2929226422 2929231570 89
28 iso_pu_bacteria 2996221748 2996223968 89
29 iso_pu_bacteria 649633069 649813202 89
30 iso_pu_bacteria 8003830390 8003833794 89
31 iso_pu_bacteria 8003856774 8003863424 89
32 iso_pu_bacteria 8054704163 8054704481 89
33 iso_pu_bacteria 8054727385 8054734415 89
34 iso_pu_bacteria 8054734606 8054740178 89
35 3300005564 Ga0070664_100949380 Ga0070664_1009493802 91
36 3300005577 Ga0068857_100164892 Ga0068857_1001648923 91
37 3300005840 Ga0068870_10568129 Ga0068870_105681292 91
38 3300005844 Ga0068862_100546260 Ga0068862_1005462602 91
39 3300009147 Ga0114129_11396320 Ga0114129_113963202 91
40 3300009553 Ga0105249_10360455 Ga0105249_103604553 91
41 3300013308 Ga0157375_13169082 Ga0157375_131690822 91
42 3300014325 Ga0163163_10981099 Ga0163163_109810992 91
43 3300025908 Ga0207643_10251588 Ga0207643_102515882 91
44 3300025961 Ga0207712_10832786 Ga0207712_108327862 91
45 3300026116 Ga0207674_10266158 Ga0207674_102661582 91
46 3300028380 Ga0268265_11208653 Ga0268265_112086531 91
47 3300031730 Ga0307516_10468431 Ga0307516_104684312 91
48 3300034816 Ga0373930_0160701 Ga0373930_0160701_19_303 91
49 3300034818 Ga0373950_0005792 Ga0373950_0005792_854_1138 91
50 3300034819 Ga0373958_0074364 Ga0373958_0074364_235_519 91
51 3300035084 Ga0373928_0077105 Ga0373928_0077105_427_711 91
52 3300035088 Ga0373940_0030873 Ga0373940_0030873_649_933 91
53 3300035207 Ga0373942_0000492 Ga0373942_0000492_8781_9065 91
54 3300035242 Ga0373962_0011248 Ga0373962_0011248_1819_2103 91
55 3300050507 nmdc:mga05p37_1502161_c1 nmdc:mga05p37_1502161_c1_306_584 91
56 3300059605 Ga0587106_114018 Ga0587106_114018_211_486 91
57 3300059642 Ga0587069_157757 Ga0587069_157757_24_299 91
58 iso_pu_bacteria 2751185782 2753267442 91
59 3300003162 Ga0006778J45830_1026032 Ga0006778J45830_10260322 92
60 3300003203 JGI25406J46586_10046430 JGI25406J46586_100464302 92
61 3300003322 rootL2_10025114 rootL2_100251141 92
62 3300003659 JGI25404J52841_10035267 JGI25404J52841_100352671 92
63 3300005327 Ga0070658_10686538 Ga0070658_106865382 92
64 3300005327 Ga0070658_10816766 Ga0070658_108167662 92
65 3300005328 Ga0070676_11324105 Ga0070676_113241052 92
66 3300005329 Ga0070683_100362826 Ga0070683_1003628263 92
67 3300005331 Ga0070670_100741602 Ga0070670_1007416022 92
68 3300005334 Ga0068869_102058839 Ga0068869_1020588391 92
69 3300005338 Ga0068868_101511125 Ga0068868_1015111252 92
70 3300005344 Ga0070661_101230231 Ga0070661_1012302312 92
71 3300005347 Ga0070668_100001446 Ga0070668_10000144613 92
72 3300005347 Ga0070668_101160773 Ga0070668_1011607731 92
73 3300005355 Ga0070671_100625029 Ga0070671_1006250292 92
74 3300005356 Ga0070674_102068215 Ga0070674_1020682152 92
75 3300005364 Ga0070673_102179290 Ga0070673_1021792902 92
76 3300005366 Ga0070659_100262288 Ga0070659_1002622881 92
77 3300005366 Ga0070659_101520382 Ga0070659_1015203822 92
78 3300005367 Ga0070667_100033669 Ga0070667_1000336696 92
79 3300005367 Ga0070667_100512025 Ga0070667_1005120252 92
80 3300005439 Ga0070711_101154496 Ga0070711_1011544962 92
81 3300005455 Ga0070663_100742024 Ga0070663_1007420241 92
82 3300005466 Ga0070685_10276892 Ga0070685_102768922 92
83 3300005535 Ga0070684_100357588 Ga0070684_1003575882 92
84 3300005543 Ga0070672_101326974 Ga0070672_1013269742 92
85 3300005544 Ga0070686_101718299 Ga0070686_1017182992 92
86 3300005564 Ga0070664_101742315 Ga0070664_1017423152 92
87 3300005616 Ga0068852_100357439 Ga0068852_1003574392 92
88 3300005617 Ga0068859_100730670 Ga0068859_1007306702 92
89 3300005618 Ga0068864_100625264 Ga0068864_1006252642 92
90 3300005719 Ga0068861_101195611 Ga0068861_1011956111 92
91 3300005719 Ga0068861_102573351 Ga0068861_1025733512 92
92 3300005843 Ga0068860_100119078 Ga0068860_1001190784 92
93 3300005843 Ga0068860_101974735 Ga0068860_1019747352 92
94 3300005844 Ga0068862_100035245 Ga0068862_1000352453 92
95 3300005844 Ga0068862_100071723 Ga0068862_1000717233 92
96 3300005983 Ga0081540_1010473 Ga0081540_10104736 92
97 3300005985 Ga0081539_10000657 Ga0081539_100006578 92
98 3300005985 Ga0081539_10004494 Ga0081539_1000449420 92
99 3300005985 Ga0081539_10007450 Ga0081539_100074505 92
100 3300006028 Ga0070717_10039953 Ga0070717_100399535 92
101 3300006358 Ga0068871_101029747 Ga0068871_1010297471 92
102 3300006844 Ga0075428_100532011 Ga0075428_1005320114 92
103 3300006844 Ga0075428_101411784 Ga0075428_1014117842 92
104 3300006846 Ga0075430_100004417 Ga0075430_1000044172 92
105 3300006847 Ga0075431_100005322 Ga0075431_1000053222 92
106 3300006847 Ga0075431_100639411 Ga0075431_1006394112 92
107 3300006871 Ga0075434_102196886 Ga0075434_1021968862 92
108 3300006880 Ga0075429_100003945 Ga0075429_1000039452 92
109 3300006880 Ga0075429_100009630 Ga0075429_1000096306 92
110 3300006881 Ga0068865_102148220 Ga0068865_1021482202 92
111 3300006931 Ga0097620_100730666 Ga0097620_1007306662 92
112 3300009092 Ga0105250_10210441 Ga0105250_102104412 92
113 3300009094 Ga0111539_13394493 Ga0111539_133944931 92
114 3300009098 Ga0105245_10607920 Ga0105245_106079202 92
115 3300009098 Ga0105245_11667983 Ga0105245_116679832 92
116 3300009101 Ga0105247_10334828 Ga0105247_103348283 92
117 3300009101 Ga0105247_10353593 Ga0105247_103535932 92
118 3300009147 Ga0114129_10000001 Ga0114129_1000000133 92
119 3300009147 Ga0114129_10026321 Ga0114129_100263212 92
120 3300009545 Ga0105237_10789106 Ga0105237_107891062 92
121 3300010375 Ga0105239_10940084 Ga0105239_109400842 92
122 3300010375 Ga0105239_13554844 Ga0105239_135548442 92
123 3300013105 Ga0157369_11395248 Ga0157369_113952482 92
124 3300013105 Ga0157369_12307129 Ga0157369_123071291 92
125 3300013296 Ga0157374_11171585 Ga0157374_111715852 92
126 3300013297 Ga0157378_10088001 Ga0157378_100880012 92
127 3300013306 Ga0163162_10748247 Ga0163162_107482473 92
128 3300013307 Ga0157372_11097780 Ga0157372_110977802 92
129 3300013308 Ga0157375_10339803 Ga0157375_103398033 92
130 3300013308 Ga0157375_10914384 Ga0157375_109143841 92
131 3300014325 Ga0163163_10732973 Ga0163163_107329731 92
132 3300014326 Ga0157380_12314891 Ga0157380_123148912 92
133 3300014745 Ga0157377_10179403 Ga0157377_101794032 92
134 3300014745 Ga0157377_10399176 Ga0157377_103991761 92
135 3300014969 Ga0157376_10767169 Ga0157376_107671692 92
136 3300015262 Ga0182007_10375155 Ga0182007_103751551 92
137 3300017792 Ga0163161_10818526 Ga0163161_108185261 92
138 3300025898 Ga0207692_10389754 Ga0207692_103897542 92
139 3300025899 Ga0207642_10371793 Ga0207642_103717931 92
140 3300025909 Ga0207705_10503339 Ga0207705_105033392 92
141 3300025909 Ga0207705_11385185 Ga0207705_113851852 92
142 3300025914 Ga0207671_10667577 Ga0207671_106675772 92
143 3300025920 Ga0207649_10429100 Ga0207649_104291002 92
144 3300025923 Ga0207681_10880718 Ga0207681_108807182 92
145 3300025925 Ga0207650_10598928 Ga0207650_105989281 92
146 3300025926 Ga0207659_11733758 Ga0207659_117337581 92
147 3300025927 Ga0207687_10655371 Ga0207687_106553711 92
148 3300025932 Ga0207690_10584958 Ga0207690_105849582 92
149 3300025932 Ga0207690_11170020 Ga0207690_111700202 92
150 3300025937 Ga0207669_10836802 Ga0207669_108368022 92
151 3300025938 Ga0207704_10478777 Ga0207704_104787771 92
152 3300025940 Ga0207691_11552664 Ga0207691_115526642 92
153 3300025942 Ga0207689_10723453 Ga0207689_107234532 92
154 3300025944 Ga0207661_10876233 Ga0207661_108762332 92
155 3300025945 Ga0207679_11036203 Ga0207679_110362031 92
156 3300025972 Ga0207668_10000959 Ga0207668_100009596 92
157 3300025972 Ga0207668_10002883 Ga0207668_100028839 92
158 3300025972 Ga0207668_11631296 Ga0207668_116312961 92
159 3300025972 Ga0207668_12058781 Ga0207668_120587811 92
160 3300025986 Ga0207658_10126872 Ga0207658_101268722 92
161 3300025986 Ga0207658_10763019 Ga0207658_107630192 92
162 3300026023 Ga0207677_10120819 Ga0207677_101208192 92
163 3300026035 Ga0207703_10213512 Ga0207703_102135123 92
164 3300026067 Ga0207678_10319445 Ga0207678_103194452 92
165 3300026067 Ga0207678_10604383 Ga0207678_106043832 92
166 3300026088 Ga0207641_10122394 Ga0207641_101223943 92
167 3300026095 Ga0207676_11215547 Ga0207676_112155472 92
168 3300026118 Ga0207675_101330770 Ga0207675_1013307701 92
169 3300026121 Ga0207683_10117241 Ga0207683_101172414 92
170 3300026142 Ga0207698_10824810 Ga0207698_108248102 92
171 3300028379 Ga0268266_10082383 Ga0268266_100823832 92
172 3300028379 Ga0268266_11085095 Ga0268266_110850952 92
173 3300028380 Ga0268265_10016366 Ga0268265_100163665 92
174 3300028380 Ga0268265_10179029 Ga0268265_101790293 92
175 3300028381 Ga0268264_12224583 Ga0268264_122245832 92
176 3300028786 Ga0307517_10070761 Ga0307517_100707613 92
177 3300028794 Ga0307515_10000065 Ga0307515_10000065104 92
178 3300028794 Ga0307515_10014064 Ga0307515_1001406415 92
179 3300028794 Ga0307515_10069129 Ga0307515_100691294 92
180 3300028794 Ga0307515_10090553 Ga0307515_100905533 92
181 3300030522 Ga0307512_10002479 Ga0307512_1000247924 92
182 3300030522 Ga0307512_10004108 Ga0307512_100041089 92
183 3300030522 Ga0307512_10098890 Ga0307512_100988902 92
184 3300031456 Ga0307513_10011749 Ga0307513_1001174910 92
185 3300031456 Ga0307513_10042316 Ga0307513_100423167 92
186 3300031548 Ga0307408_100382769 Ga0307408_1003827692 92
187 3300031616 Ga0307508_10000654 Ga0307508_1000065420 92
188 3300031616 Ga0307508_10017115 Ga0307508_100171153 92
189 3300031616 Ga0307508_10027795 Ga0307508_100277956 92
190 3300031616 Ga0307508_10044828 Ga0307508_100448283 92
191 3300031616 Ga0307508_10121398 Ga0307508_101213983 92
192 3300031616 Ga0307508_10218930 Ga0307508_102189303 92
193 3300031649 Ga0307514_10320613 Ga0307514_103206131 92
194 3300031730 Ga0307516_10007505 Ga0307516_100075056 92
195 3300031730 Ga0307516_10082750 Ga0307516_100827504 92
196 3300031730 Ga0307516_10142788 Ga0307516_101427883 92
197 3300031730 Ga0307516_10558739 Ga0307516_105587391 92
198 3300031731 Ga0307405_10016994 Ga0307405_100169944 92
199 3300031731 Ga0307405_10071735 Ga0307405_100717351 92
200 3300031731 Ga0307405_10198892 Ga0307405_101988922 92
201 3300031731 Ga0307405_10461843 Ga0307405_104618432 92
202 3300031824 Ga0307413_10017755 Ga0307413_100177553 92
203 3300031852 Ga0307410_10579470 Ga0307410_105794702 92
204 3300031889 Ga0326468_10000101 Ga0326468_100001011 92
205 3300031901 Ga0307406_10016456 Ga0307406_100164566 92
206 3300031901 Ga0307406_10237009 Ga0307406_102370094 92
207 3300031901 Ga0307406_10433414 Ga0307406_104334141 92
208 3300031995 Ga0307409_100041457 Ga0307409_1000414574 92
209 3300032002 Ga0307416_100058454 Ga0307416_1000584543 92
210 3300032002 Ga0307416_100561517 Ga0307416_1005615172 92
211 3300032002 Ga0307416_103421466 Ga0307416_1034214662 92
212 3300032005 Ga0307411_10860595 Ga0307411_108605952 92
213 3300032126 Ga0307415_100006463 Ga0307415_1000064634 92
214 3300032126 Ga0307415_100224354 Ga0307415_1002243543 92
215 3300032126 Ga0307415_100548649 Ga0307415_1005486491 92
216 3300032126 Ga0307415_101238428 Ga0307415_1012384282 92
217 3300033179 Ga0307507_10224618 Ga0307507_102246182 92
218 3300035083 Ga0373926_0239144 Ga0373926_0239144_288_575 92
219 3300035091 Ga0373951_0000058 Ga0373951_0000058_3773_4051 92
220 3300035114 Ga0373939_0466369 Ga0373939_0466369_105_392 92
221 3300035691 Ga0373931_0902912 Ga0373931_0902912_153_440 92
222 3300035692 Ga0373935_0014090 Ga0373935_0014090_1216_1503 92
223 3300036401 Ga0373937_1941998 Ga0373937_1941998_200_487 92
224 3300037418 Ga0395900_0169377 Ga0395900_0169377_56_349 92
225 3300037466 Ga0395898_0197554 Ga0395898_0197554_709_1002 92
226 3300037471 Ga0395905_0099567 Ga0395905_0099567_1182_1475 92
227 3300037853 Ga0436364_0310403 Ga0436364_0310403_37_324 92
228 3300038443 Ga0395901_0054322 Ga0395901_0054322_2172_2465 92
229 3300041441 Ga0451787_785072 Ga0451787_785072_127_414 92
230 3300041443 Ga0451789_1268452 Ga0451789_1268452_19_306 92
231 3300041451 Ga0451791_0244710 Ga0451791_0244710_200_487 92
232 3300041453 Ga0451797_0345596 Ga0451797_0345596_278_565 92
233 3300041459 Ga0451800_1101153 Ga0451800_1101153_285_569 92
234 3300041460 Ga0451802_0698277 Ga0451802_0698277_378_665 92
235 3300041460 Ga0451802_1373457 Ga0451802_1373457_303_590 92
236 3300041463 Ga0451804_0048006 Ga0451804_0048006_340_627 92
237 3300041486 Ga0451807_0232236 Ga0451807_0232236_62_349 92
238 3300041494 Ga0451837_1821234 Ga0451837_1821234_819_1106 92
239 3300041509 Ga0451843_1374275 Ga0451843_1374275_78_362 92
240 3300041512 Ga0451853_2951295 Ga0451853_2951295_560_844 92
241 3300041512 Ga0451853_3311038 Ga0451853_3311038_396_683 92
242 3300042016 Ga0439463_021080 Ga0439463_021080_1267_1545 92
243 3300045976 Ga0466967_1605966 Ga0466967_1605966_243_521 92
244 3300046519 Ga0495632_0019459 Ga0495632_0019459_3205_3492 92
245 3300046519 Ga0495632_0127259 Ga0495632_0127259_715_1002 92
246 3300046694 Ga0495649_0452750 Ga0495649_0452750_320_607 92
247 3300048911 Ga0496108_0000010 Ga0496108_0000010_150511_150798 92
248 3300049824 Ga0501045_0449293 Ga0501045_0449293_492_776 92
249 3300050491 nmdc:mga00v17_256823_c1 nmdc:mga00v17_256823_c1_538_825 92
250 3300050507 nmdc:mga05p37_2088_c1 nmdc:mga05p37_2088_c1_14337_14621 92
251 3300050507 nmdc:mga05p37_614655_c1 nmdc:mga05p37_614655_c1_13_306 92
252 3300050508 nmdc:mga09592_70_c1 nmdc:mga09592_70_c1_41221_41505 92
253 3300050509 nmdc:mga0qj67_15_c2 nmdc:mga0qj67_15_c2_32161_32445 92
254 3300050510 nmdc:mga06r32_1364129_c1 nmdc:mga06r32_1364129_c1_268_561 92
255 3300050510 nmdc:mga06r32_60_c2 nmdc:mga06r32_60_c2_15935_16219 92
256 3300053086 Ga0500578_0387459 Ga0500578_0387459_319_606 92
257 3300053088 Ga0500644_0059340 Ga0500644_0059340_446_730 92
258 3300053090 Ga0500646_0092882 Ga0500646_0092882_638_925 92
259 3300053093 Ga0500651_0312961 Ga0500651_0312961_374_661 92
260 3300053096 Ga0500641_0143329 Ga0500641_0143329_70_357 92
261 3300053118 Ga0500594_0026709 Ga0500594_0026709_98_385 92
262 3300053131 Ga0500652_015449 Ga0500652_015449_1929_2216 92
263 3300053146 Ga0500588_0325399 Ga0500588_0325399_218_505 92
264 3300054114 Ga0501084_0624585 Ga0501084_0624585_54_338 92
265 3300059492 Ga0587073_0072338 Ga0587073_0072338_411_689 92
266 3300059492 Ga0587073_0276834 Ga0587073_0276834_96_374 92
267 3300059493 Ga0587077_077773 Ga0587077_077773_67_345 92
268 3300059504 Ga0587082_027055 Ga0587082_027055_392_670 92
269 3300059505 Ga0587083_0048943 Ga0587083_0048943_89_367 92
270 3300059505 Ga0587083_0050803 Ga0587083_0050803_520_804 92
271 3300059505 Ga0587083_0217054 Ga0587083_0217054_137_415 92
272 3300059505 Ga0587083_0231037 Ga0587083_0231037_89_367 92
273 3300059508 Ga0587088_116396 Ga0587088_116396_176_454 92
274 3300059604 Ga0587098_017456 Ga0587098_017456_418_696 92
275 3300059605 Ga0587106_040673 Ga0587106_040673_470_748 92
276 3300059644 Ga0587075_047408 Ga0587075_047408_211_489 92
277 3300059644 Ga0587075_047496 Ga0587075_047496_61_339 92
278 3300059644 Ga0587075_125609 Ga0587075_125609_89_367 92
279 3300059647 Ga0587079_037797 Ga0587079_037797_593_871 92
280 3300059652 Ga0587107_116783 Ga0587107_116783_211_489 92
281 3300059655 Ga0587114_132391 Ga0587114_132391_170_469 92
282 3300060344 Ga0587071_119950 Ga0587071_119950_175_453 92
283 3300060344 Ga0587071_148531 Ga0587071_148531_129_407 92
284 3300060344 Ga0587071_154831 Ga0587071_154831_38_322 92
285 3300060346 Ga0587111_0248594 Ga0587111_0248594_54_332 92

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13490

zf-HC2

Putative zinc-finger

29

63

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5frh-assembly1.cif.gz_A solution structure of oxidised rsra 0.7293 4 83
5frh-assembly1.cif.gz_A solution structure of oxidised rsra 0.6435 4 83
2lch-assembly1.cif.gz_A solution nmr structure of a protein with a redesigned hydrophobic core, northeast structural genomics consortium target or38 0.5593 10 88
2lch-assembly1.cif.gz_A solution nmr structure of a protein with a redesigned hydrophobic core, northeast structural genomics consortium target or38 0.4957 10 88
3u3b-assembly2.cif.gz_B crystal structure of computationally redesigned four-helix bundle 0.4723 7 87
ID Description Score Start End Superfamily
af_I1JAW9_541_693_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.5598 3 64 1.25.10.10
2lchA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain 0.5593 10 88 1.20.120.160
af_G5EGK1_1078_1232_1.20.1420.10 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain 0.498 7 79 1.20.1420.10
2lchA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain 0.4957 10 88 1.20.120.160
3u3bB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain 0.4723 7 87 1.20.120.160
ID Description Score Start End GO Terms
AF-A0A810L0B1-F1-model_v4 Putative zinc-finger domain-containing protein 0.8654 14 84
AF-A0A2X0KGQ7-F1-model_v4 Mycothiol system anti-sigma-R factor 0.8372 10 83
AF-A0A6N7I8I2-F1-model_v4 Mycothiol system anti-sigma-R factor 0.8349 6 84
AF-A0A7W1B156-F1-model_v4 Mycothiol system anti-sigma-R factor 0.8336 5 85
AF-A0A3D4WUJ6-F1-model_v4 Mycothiol system anti-sigma-R factor 0.8321 2 86

Feature Viewer

pLDDT pTM Quality
67.5 0.5 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map