F386725

General Info

Members Datasets Scaffolds Average Seq Length
285 183 277 516

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100009422|Ga0075431_1000094228
Length 604
Sequence MQSPTRTTFAGFAACSFTSTFPPSHASLASDRVLNTRAAHSHLSTRTDCPSSSTVRTVSWRPLLGFARAILGGGSEGGTKSRSELNKYMWEDDVEELKRRMELARAMGGAENVERQHKAGRLTVRERIERLLDAGSFHETGALAGAAQYEGERLVAIRPANFVMGTGRIDGRRVVVGGDDFTVRGGANDASIGGKQGYSERMARELRLPLVRLVDGTGGGGSVKTYEITGRTYVPGNPAWDIVVASMSEIPVVAAALGPVAGLGAARVACSHFSLMVRGLSQVFVAGPPVVERAFGTPIEKEALGGSDIQGKAGGVDNVVDSEDEAFEQIRRFLSYLPRNVWEAPPRGPAEDDPHRRDEALLSLIPRNRRRGYDVRKLVGHVVDRASFFEIGPKYGPSLVVGVARLDGYPVGVVANDPAHAGGALTAAGSEKLTRFVDLCDTFHLPVVNIVDNPGFLIGTQAERDGTIRKGVRALQAIYQATVPWITVIVRRVFGVAGAGHANVQALNLRYAWPSADWGSLPLEGGIEAAYKRELQAAADPAALXXXXEARLNVFRSPFRTAEAFSVEEIIDPRDTRPLLTDWVSLAYDNEATRLGPKSRGMRP

Samples

Sample ID Description Type Environment
1 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
2 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
3 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
4 2643221569 Achromobacter sp. Root565 Isolate Unclassified
5 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
6 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
7 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
11 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
105 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
106 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
107 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
110 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
111 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
112 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
118 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
119 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
121 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
129 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
132 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
133 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
134 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
135 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
136 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
145 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
146 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
156 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
157 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
158 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
159 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
160 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
161 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
162 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
163 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
164 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
165 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
166 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
167 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
168 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
171 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
174 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
175 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
176 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
177 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
178 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
179 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
180 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
181 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
182 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
183 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.84
Metatranscriptomes 0.35
Isolates 2.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.86
Nodule 1.4
Rhizoplane 3.51
Rhizosphere 89.47
Stem 0
Stem Tuber 0
Unclassified 1.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10006879 3300003187 Bacteria 5646
2 JGI25406J46586_10007708 3300003203 Bacteria 4895
3 Ga0055537_1001928 3300003773 Bacteria 7430
4 Ga0055534_1002099 3300003784 Bacteria 7153
5 Ga0070677_10003353 3300005333 Bacteria 5162
6 Ga0068869_100018973 3300005334 Bacteria 4689
7 Ga0068868_100062529 3300005338 Bacteria 2951
8 Ga0070689_100003927 3300005340 Bacteria 9972
9 Ga0070687_100007791 3300005343 Bacteria 4494
10 Ga0070669_100050282 3300005353 Bacteria 3044
11 Ga0070674_100083601 3300005356 Bacteria 2287
12 Ga0070673_100002554 3300005364 Bacteria 11108
13 Ga0070688_100027934 3300005365 Bacteria 3363
14 Ga0070709_10018385 3300005434 Bacteria 4024
15 Ga0070714_100000470 3300005435 Bacteria 29292
16 Ga0070714_100010669 3300005435 Bacteria 7269
17 Ga0070714_100021403 3300005435 Bacteria 5292
18 Ga0070714_100036594 3300005435 Bacteria 4117
19 Ga0070713_100000363 3300005436 Bacteria 29193
20 Ga0070701_10034986 3300005438 Bacteria 2520
21 Ga0070705_100058948 3300005440 Bacteria 2271
22 Ga0070694_100035465 3300005444 Bacteria 3298
23 Ga0068867_100018011 3300005459 Bacteria 5019
24 Ga0068867_100028786 3300005459 Bacteria 3999
25 Ga0070706_100000441 3300005467 Bacteria 50029
26 Ga0070706_100003882 3300005467 Bacteria 14599
27 Ga0070706_100014785 3300005467 Bacteria 7212
28 Ga0070707_100002891 3300005468 Bacteria 16316
29 Ga0070707_100004412 3300005468 Bacteria 13185
30 Ga0070707_100015997 3300005468 Bacteria 7040
31 Ga0070707_100019832 3300005468 Bacteria 6338
32 Ga0070698_100078264 3300005471 Bacteria 3305
33 Ga0070679_100090860 3300005530 Bacteria 3041
34 Ga0070684_100001574 3300005535 Bacteria 16472
35 Ga0070697_100044250 3300005536 Bacteria 3606
36 Ga0070672_100018048 3300005543 Bacteria 5092
37 Ga0070686_100008714 3300005544 Bacteria 5684
38 Ga0070686_100066722 3300005544 Bacteria 2341
39 Ga0070704_100007530 3300005549 Bacteria 6483
40 Ga0070704_100063065 3300005549 Bacteria 2659
41 Ga0070704_100074682 3300005549 Bacteria 2474
42 Ga0070664_100041746 3300005564 Bacteria 3871
43 Ga0070702_100025346 3300005615 Bacteria 3176
44 Ga0068859_100038848 3300005617 Bacteria 4774
45 Ga0068863_100032083 3300005841 Bacteria 5009
46 Ga0068860_100068711 3300005843 Bacteria 3366
47 Ga0068860_100083409 3300005843 Bacteria 3040
48 Ga0068862_100002764 3300005844 Bacteria 15373
49 Ga0068862_100002808 3300005844 Bacteria 15261
50 Ga0081538_10003805 3300005981 Bacteria 14109
51 Ga0081538_10054003 3300005981 Bacteria 2381
52 Ga0081539_10000920 3300005985 Bacteria 55416
53 Ga0070717_10000407 3300006028 Bacteria 27592
54 Ga0070717_10032358 3300006028 Bacteria 4214
55 Ga0075365_10019443 3300006038 Bacteria 4193
56 Ga0070716_100013193 3300006173 Bacteria 4208
57 Ga0070712_100007175 3300006175 Bacteria 6949
58 Ga0075428_100009078 3300006844 Bacteria 11036
59 Ga0075428_100021006 3300006844 Bacteria 7232
60 Ga0075428_100045034 3300006844 Bacteria 4848
61 Ga0075430_100004904 3300006846 Bacteria 11253
62 Ga0075430_100032596 3300006846 Bacteria 4423
63 Ga0075431_100001042 3300006847 Bacteria 24720
64 Ga0075431_100009422 3300006847 Bacteria 9801
65 Ga0075431_100026354 3300006847 Bacteria 5964
66 Ga0075431_100029597 3300006847 Bacteria 5639
67 Ga0075431_100065972 3300006847 Bacteria 3737
68 Ga0075431_100258242 3300006847 Bacteria 1769
69 Ga0075433_10019404 3300006852 Bacteria 5665
70 Ga0075429_100010810 3300006880 Bacteria 7894
71 Ga0075429_100019170 3300006880 Bacteria 5927
72 Ga0075429_100032162 3300006880 Bacteria 4560
73 Ga0075429_100046352 3300006880 Bacteria 3782
74 Ga0075436_100008871 3300006914 Bacteria 6879
75 Ga0097620_100038845 3300006931 Bacteria 4774
76 Ga0111539_10106373 3300009094 Bacteria 3291
77 Ga0111539_10202462 3300009094 Bacteria 2315
78 Ga0111539_10229285 3300009094 Bacteria 2163
79 Ga0105245_10014066 3300009098 Bacteria 6970
80 Ga0105245_10229674 3300009098 Bacteria 1794
81 Ga0114129_10001698 3300009147 Bacteria 30035
82 Ga0114129_10002668 3300009147 Bacteria 24836
83 Ga0114129_10021873 3300009147 Bacteria 9077
84 Ga0114129_10035569 3300009147 Bacteria 7037
85 Ga0114129_10049369 3300009147 Bacteria 5912
86 Ga0114129_10148954 3300009147 Bacteria 3203
87 Ga0114129_10270431 3300009147 Bacteria 2274
88 Ga0105242_10001678 3300009176 Bacteria 17530
89 Ga0105242_10178020 3300009176 Bacteria 1874
90 Ga0105248_10001612 3300009177 Bacteria 25083
91 Ga0157378_10009904 3300013297 Bacteria 8309
92 Ga0157372_10184431 3300013307 Bacteria 2416
93 Ga0157375_10100471 3300013308 Bacteria 2973
94 Ga0157377_10001759 3300014745 Bacteria 9438
95 Ga0157377_10070602 3300014745 Bacteria 2018
96 Ga0209565_1000021 3300025263 Bacteria 406281
97 Ga0209675_1001421 3300025291 Bacteria 13835
98 Ga0209025_1012020 3300025294 Bacteria 5613
99 Ga0209564_1000452 3300025295 Bacteria 69505
100 Ga0209256_1001235 3300025299 Bacteria 28367
101 Ga0209051_1010613 3300025303 Bacteria 4625
102 Ga0207682_10006950 3300025893 Bacteria 4537
103 Ga0207688_10003816 3300025901 Bacteria 8219
104 Ga0207699_10000077 3300025906 Bacteria 78246
105 Ga0207643_10015320 3300025908 Bacteria 4173
106 Ga0207684_10000427 3300025910 Bacteria 55866
107 Ga0207684_10004276 3300025910 Bacteria 13536
108 Ga0207693_10001605 3300025915 Bacteria 20004
109 Ga0207662_10003456 3300025918 Bacteria 8134
110 Ga0207662_10023582 3300025918 Bacteria 3536
111 Ga0207657_10093422 3300025919 Bacteria 2506
112 Ga0207652_10027701 3300025921 Bacteria 4724
113 Ga0207646_10005952 3300025922 Bacteria 12720
114 Ga0207646_10006434 3300025922 Bacteria 12126
115 Ga0207646_10007381 3300025922 Bacteria 11186
116 Ga0207650_10010170 3300025925 Bacteria 6447
117 Ga0207650_10064284 3300025925 Bacteria 2746
118 Ga0207659_10005222 3300025926 Bacteria 7862
119 Ga0207664_10000350 3300025929 Bacteria 33653
120 Ga0207664_10017131 3300025929 Bacteria 5302
121 Ga0207664_10044995 3300025929 Bacteria 3459
122 Ga0207706_10049452 3300025933 Bacteria 3715
123 Ga0207706_10054281 3300025933 Bacteria 3537
124 Ga0207686_10015701 3300025934 Bacteria 4239
125 Ga0207709_10059539 3300025935 Bacteria 2378
126 Ga0207670_10017498 3300025936 Bacteria 4332
127 Ga0207670_10098230 3300025936 Bacteria 2086
128 Ga0207665_10053012 3300025939 Bacteria 2733
129 Ga0207691_10044763 3300025940 Bacteria 4072
130 Ga0207689_10004483 3300025942 Bacteria 12654
131 Ga0207679_10026828 3300025945 Bacteria 3976
132 Ga0207677_10015230 3300026023 Bacteria 4516
133 Ga0207703_10157473 3300026035 Bacteria 1986
134 Ga0207708_10004304 3300026075 Bacteria 10480
135 Ga0207641_10044070 3300026088 Bacteria 3750
136 Ga0207648_10011387 3300026089 Bacteria 8382
137 Ga0207648_10087408 3300026089 Bacteria 2720
138 Ga0207675_100004147 3300026118 Bacteria 14027
139 Ga0207675_100007281 3300026118 Bacteria 10458
140 Ga0207683_10021093 3300026121 Bacteria 5576
141 Ga0207683_10021242 3300026121 Bacteria 5555
142 Ga0207683_10029179 3300026121 Bacteria 4775
143 Ga0209282_1000078 3300027666 Bacteria 76811
144 Ga0207428_10083243 3300027907 Bacteria 2496
145 Ga0268266_10121893 3300028379 Bacteria 2321
146 Ga0268264_10022081 3300028381 Bacteria 5194
147 Ga0265760_10017672 3300031090 Unclassified 2049
148 Ga0265332_10004029 3300031238 Bacteria 6989
149 Ga0265328_10002074 3300031239 Bacteria 9051
150 Ga0265329_10017420 3300031242 Bacteria 2472
151 Ga0265331_10001392 3300031250 Bacteria 17766
152 Ga0307408_100035026 3300031548 Bacteria 3520
153 Ga0316575_10010117 3300031665 Bacteria 3460
154 Ga0265314_10000660 3300031711 Bacteria 42242
155 Ga0316576_10013856 3300031727 Bacteria 5373
156 Ga0316576_10018246 3300031727 Unclassified 4786
157 Ga0316577_10014889 3300031733 Bacteria 4276
158 Ga0307410_10013395 3300031852 Bacteria 4783
159 Ga0307409_100046696 3300031995 Bacteria 3281
160 Ga0307409_100138607 3300031995 Bacteria 2092
161 Ga0307416_100224828 3300032002 Bacteria 1804
162 Ga0307415_100115452 3300032126 Bacteria 2001
163 Ga0316580_10004759 3300032139 Unclassified 3947
164 Ga0316574_0000097 3300035398 Bacteria 25418
165 Ga0316574_0004164 3300035398 Bacteria 7537
166 Ga0316574_0016144 3300035398 Unclassified 4345
167 Ga0373924_0042593 3300035410 Bacteria 1863
168 Ga0373931_0017417 3300035691 Bacteria 3554
169 Ga0373927_0086373 3300035695 Bacteria 2036
170 Ga0373937_0115637 3300036401 Bacteria 2498
171 Ga0316584_0132515 3300036712 Unclassified 1861
172 Ga0395900_0287096 3300037418 Bacteria 1635
173 Ga0395898_0007351 3300037466 Bacteria 11693
174 Ga0395905_0034765 3300037471 Bacteria 4732
175 Ga0395901_0001837 3300038443 Bacteria 21942
176 Ga0395901_0161158 3300038443 Bacteria 2356
177 Ga0451577_0007988 3300042876 Bacteria 10330
178 Ga0451577_0014258 3300042876 Bacteria 7409
179 Ga0453684_0052836 3300044712 Bacteria 5309
180 Ga0451576_0048093 3300045051 Bacteria 4482
181 Ga0451576_0207371 3300045051 Bacteria 2046
182 Ga0495605_0003185 3300046474 Bacteria 9850
183 Ga0495596_0000624 3300046500 Bacteria 22231
184 Ga0495616_0004854 3300046513 Bacteria 8415
185 Ga0495661_0021153 3300046665 Bacteria 4244
186 Ga0495658_0055843 3300046683 Bacteria 2250
187 Ga0496101_0034823 3300048904 Bacteria 3559
188 Ga0496102_0035882 3300048905 Bacteria 4466
189 Ga0496102_0097887 3300048905 Bacteria 2721
190 Ga0496103_0009414 3300048906 Bacteria 5788
191 Ga0496106_0005405 3300048909 Bacteria 9447
192 Ga0496107_0010555 3300048910 Bacteria 6420
193 Ga0496108_0046677 3300048911 Bacteria 3619
194 Ga0496112_0027301 3300048915 Bacteria 5504
195 Ga0496114_0020283 3300048917 Bacteria 5393
196 Ga0496116_0011913 3300048919 Bacteria 7148
197 Ga0496122_0009339 3300048925 Bacteria 10357
198 Ga0501034_0000128 3300049571 Bacteria 140568
199 Ga0501036_0033763 3300049572 Bacteria 4327
200 Ga0501038_0008451 3300049574 Bacteria 9469
201 Ga0501038_0018727 3300049574 Bacteria 6251
202 Ga0501039_0155989 3300049575 Bacteria 1793
203 Ga0501040_0009098 3300049576 Bacteria 6465
204 Ga0501040_0028845 3300049576 Unclassified 3743
205 Ga0501042_0021313 3300049578 Bacteria 4514
206 Ga0501043_0089678 3300049579 Bacteria 2417
207 Ga0501046_0021598 3300049580 Bacteria 5311
208 Ga0501047_0001021 3300049581 Bacteria 28247
209 Ga0501067_0006150 3300049583 Bacteria 6654
210 Ga0501068_0000205 3300049584 Bacteria 28373
211 Ga0501069_0010564 3300049585 Bacteria 4890
212 Ga0501071_0000316 3300049587 Bacteria 23302
213 Ga0501071_0018294 3300049587 Bacteria 4850
214 Ga0501071_0027625 3300049587 Bacteria 3994
215 Ga0501072_0000041 3300049588 Bacteria 108384
216 Ga0501072_0032343 3300049588 Bacteria 4097
217 Ga0501072_0059070 3300049588 Bacteria 3023
218 Ga0501072_0067441 3300049588 Bacteria 2823
219 Ga0501073_0000968 3300049589 Bacteria 20679
220 Ga0501074_0000536 3300049590 Bacteria 23375
221 Ga0501075_0000087 3300049591 Bacteria 42072
222 Ga0501075_0013179 3300049591 Bacteria 5895
223 Ga0501075_0036400 3300049591 Bacteria 3673
224 Ga0501076_0000193 3300049592 Bacteria 36447
225 Ga0501076_0003008 3300049592 Bacteria 11709
226 Ga0501076_0099754 3300049592 Bacteria 2340
227 Ga0501077_0002025 3300049593 Bacteria 12230
228 Ga0501077_0004514 3300049593 Bacteria 8462
229 Ga0501079_0006954 3300049741 Bacteria 8529
230 Ga0501079_0009360 3300049741 Bacteria 7422
231 Ga0501079_0026360 3300049741 Bacteria 4456
232 Ga0501079_0053612 3300049741 Bacteria 3111
233 Ga0501080_0005242 3300049742 Bacteria 11550
234 Ga0501080_0006518 3300049742 Bacteria 10485
235 Ga0501080_0032648 3300049742 Bacteria 4856
236 Ga0501081_0010946 3300049743 Bacteria 5928
237 Ga0501081_0044807 3300049743 Bacteria 3037
238 Ga0501083_0056169 3300049744 Bacteria 2638
239 Ga0501083_0087000 3300049744 Bacteria 2067
240 Ga0501044_0097181 3300049823 Bacteria 2966
241 Ga0501045_0013075 3300049824 Bacteria 5855
242 nmdc:mga0yw44_8493_c1 3300050492 Bacteria 5122
243 nmdc:mga05p37_1261_c1 3300050507 Bacteria 29344
244 nmdc:mga05p37_219996_c1 3300050507 Bacteria 2292
245 nmdc:mga05p37_32141_c1 3300050507 Bacteria 6417
246 nmdc:mga05p37_4555_c1 3300050507 Bacteria 16203
247 nmdc:mga05p37_5347_c1 3300050507 Bacteria 15086
248 nmdc:mga09592_1081_c1 3300050508 Bacteria 21649
249 nmdc:mga09592_3974_c1 3300050508 Bacteria 11909
250 nmdc:mga09592_9059_c1 3300050508 Bacteria 8091
251 nmdc:mga09592_96063_c1 3300050508 Bacteria 2535
252 nmdc:mga0qj67_58196_c1 3300050509 Bacteria 3064
253 nmdc:mga06r32_21207_c1 3300050510 Bacteria 5997
254 nmdc:mga06r32_344043_c1 3300050510 Bacteria 1476
255 nmdc:mga06r32_35642_c1 3300050510 Bacteria 4695
256 nmdc:mga06r32_3673_c1 3300050510 Bacteria 13707
257 nmdc:mga06r32_37451_c1 3300050510 Bacteria 4587
258 nmdc:mga06r32_40572_c1 3300050510 Bacteria 4420
259 nmdc:mga08y16_10988_c1 3300050511 Bacteria 9505
260 nmdc:mga08y16_195086_c1 3300050511 Bacteria 2099
261 nmdc:mga08y16_195727_c1 3300050511 Bacteria 2095
262 nmdc:mga08y16_47484_c1 3300050511 Bacteria 4493
263 nmdc:mga0n895_147977_c1 3300050512 Bacteria 2378
264 nmdc:mga0n895_5911_c1 3300050512 Bacteria 10287
265 nmdc:mga0rr50_2322_c1 3300050513 Bacteria 10676
266 nmdc:mga0a205_179627_c1 3300050515 Bacteria 2010
267 nmdc:mga0a205_2067_c1 3300050515 Bacteria 17558
268 Ga0501084_0000124 3300054114 Bacteria 57833
269 Ga0501084_0001122 3300054114 Bacteria 20895
270 Ga0501084_0034904 3300054114 Bacteria 4206
271 Ga0501084_0181791 3300054114 Bacteria 1775
272 Ga0501082_0005053 3300060353 Bacteria 11503
273 Ga0501082_0010907 3300060353 Bacteria 7819
274 Ga0501082_0014516 3300060353 Bacteria 6781
275 Ga0501082_0020097 3300060353 Bacteria 5755
276 Ga0530510_0000531 3300061734 Bacteria 24430
277 Ga0530510_0057188 3300061734 Bacteria 2818

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050510 nmdc:mga06r32_344043_c1 nmdc:mga06r32_344043_c1_129_1454 431
2 3300042876 Ga0451577_0014258 Ga0451577_0014258_295_1845 485
3 3300037418 Ga0395900_0287096 Ga0395900_0287096_74_1579 491
4 3300042876 Ga0451577_0007988 Ga0451577_0007988_3015_4562 491
5 3300044712 Ga0453684_0052836 Ga0453684_0052836_2390_3937 491
6 3300031995 Ga0307409_100138607 Ga0307409_1001386072 492
7 3300037466 Ga0395898_0007351 Ga0395898_0007351_8541_10124 495
8 3300037471 Ga0395905_0034765 Ga0395905_0034765_269_1852 495
9 3300038443 Ga0395901_0001837 Ga0395901_0001837_1443_3026 495
10 3300005435 Ga0070714_100000470 Ga0070714_10000047023 496
11 3300005468 Ga0070707_100002891 Ga0070707_10000289112 496
12 3300025921 Ga0207652_10027701 Ga0207652_100277012 496
13 3300025922 Ga0207646_10006434 Ga0207646_100064343 496
14 3300025929 Ga0207664_10000350 Ga0207664_1000035022 496
15 3300048905 Ga0496102_0035882 Ga0496102_0035882_2963_4453 496
16 3300049588 Ga0501072_0067441 Ga0501072_0067441_1309_2805 496
17 3300005444 Ga0070694_100035465 Ga0070694_1000354652 497
18 3300009094 Ga0111539_10229285 Ga0111539_102292852 497
19 3300050511 nmdc:mga08y16_195727_c1 nmdc:mga08y16_195727_c1_177_1676 497
20 3300031665 Ga0316575_10010117 Ga0316575_100101172 499
21 3300031727 Ga0316576_10013856 Ga0316576_100138563 499
22 3300031733 Ga0316577_10014889 Ga0316577_100148892 499
23 3300032139 Ga0316580_10004759 Ga0316580_100047592 499
24 3300035398 Ga0316574_0016144 Ga0316574_0016144_2747_4303 499
25 3300050507 nmdc:mga05p37_5347_c1 nmdc:mga05p37_5347_c1_9429_10991 500
26 3300006847 Ga0075431_100065972 Ga0075431_1000659723 502
27 3300009147 Ga0114129_10035569 Ga0114129_100355696 502
28 3300049576 Ga0501040_0009098 Ga0501040_0009098_1081_2634 503
29 3300049580 Ga0501046_0021598 Ga0501046_0021598_1692_3245 503
30 3300049587 Ga0501071_0027625 Ga0501071_0027625_345_1898 503
31 3300049588 Ga0501072_0032343 Ga0501072_0032343_535_2088 503
32 3300049591 Ga0501075_0013179 Ga0501075_0013179_508_2061 503
33 3300049741 Ga0501079_0026360 Ga0501079_0026360_693_2246 503
34 3300049743 Ga0501081_0044807 Ga0501081_0044807_365_1918 503
35 3300049824 Ga0501045_0013075 Ga0501045_0013075_4039_5592 503
36 3300060353 Ga0501082_0020097 Ga0501082_0020097_3999_5552 503
37 3300061734 Ga0530510_0057188 Ga0530510_0057188_222_1775 503
38 3300005981 Ga0081538_10003805 Ga0081538_1000380511 504
39 3300006880 Ga0075429_100032162 Ga0075429_1000321625 505
40 3300031727 Ga0316576_10018246 Ga0316576_100182465 505
41 3300035398 Ga0316574_0000097 Ga0316574_0000097_15745_17301 505
42 3300036712 Ga0316584_0132515 Ga0316584_0132515_202_1758 505
43 3300050508 nmdc:mga09592_9059_c1 nmdc:mga09592_9059_c1_909_2462 505
44 3300031852 Ga0307410_10013395 Ga0307410_100133952 506
45 3300032126 Ga0307415_100115452 Ga0307415_1001154522 506
46 3300006880 Ga0075429_100046352 Ga0075429_1000463522 507
47 3300009094 Ga0111539_10106373 Ga0111539_101063731 507
48 3300009147 Ga0114129_10021873 Ga0114129_100218737 507
49 3300050511 nmdc:mga08y16_10988_c1 nmdc:mga08y16_10988_c1_6927_8474 507
50 iso_pu_bacteria 2816332139 2816508124 508
51 3300006846 Ga0075430_100004904 Ga0075430_1000049045 509
52 3300009147 Ga0114129_10270431 Ga0114129_102704311 509
53 3300050507 nmdc:mga05p37_219996_c1 nmdc:mga05p37_219996_c1_56_1615 509
54 3300050510 nmdc:mga06r32_21207_c1 nmdc:mga06r32_21207_c1_1180_2739 509
55 iso_pu_bacteria 2599185292 2599903175 510
56 iso_pu_bacteria 2643221569 2643862333 510
57 iso_pu_bacteria 2899359706 2899368236 510
58 3300005467 Ga0070706_100000441 Ga0070706_10000044121 511
59 3300005468 Ga0070707_100019832 Ga0070707_1000198323 511
60 3300005471 Ga0070698_100078264 Ga0070698_1000782643 511
61 3300006028 Ga0070717_10000407 Ga0070717_1000040721 511
62 3300025910 Ga0207684_10000427 Ga0207684_1000042721 511
63 iso_pu_bacteria 2513237165 2514040496 512
64 iso_pu_bacteria 2881644220 2881647199 512
65 iso_pu_bacteria 644736347 644751903 512
66 3300031995 Ga0307409_100046696 Ga0307409_1000466962 514
67 3300032002 Ga0307416_100224828 Ga0307416_1002248282 514
68 3300050508 nmdc:mga09592_96063_c1 nmdc:mga09592_96063_c1_571_2121 514
69 3300050510 nmdc:mga06r32_35642_c1 nmdc:mga06r32_35642_c1_3018_4568 514
70 3300003203 JGI25406J46586_10007708 JGI25406J46586_100077083 515
71 3300005333 Ga0070677_10003353 Ga0070677_100033533 515
72 3300005334 Ga0068869_100018973 Ga0068869_1000189732 515
73 3300005340 Ga0070689_100003927 Ga0070689_1000039276 515
74 3300005343 Ga0070687_100007791 Ga0070687_1000077913 515
75 3300005353 Ga0070669_100050282 Ga0070669_1000502822 515
76 3300005364 Ga0070673_100002554 Ga0070673_1000025542 515
77 3300005365 Ga0070688_100027934 Ga0070688_1000279342 515
78 3300005434 Ga0070709_10018385 Ga0070709_100183852 515
79 3300005435 Ga0070714_100010669 Ga0070714_1000106697 515
80 3300005435 Ga0070714_100036594 Ga0070714_1000365943 515
81 3300005436 Ga0070713_100000363 Ga0070713_10000036317 515
82 3300005438 Ga0070701_10034986 Ga0070701_100349862 515
83 3300005440 Ga0070705_100058948 Ga0070705_1000589483 515
84 3300005459 Ga0068867_100018011 Ga0068867_1000180113 515
85 3300005459 Ga0068867_100028786 Ga0068867_1000287862 515
86 3300005467 Ga0070706_100003882 Ga0070706_1000038827 515
87 3300005468 Ga0070707_100004412 Ga0070707_1000044127 515
88 3300005468 Ga0070707_100015997 Ga0070707_1000159971 515
89 3300005535 Ga0070684_100001574 Ga0070684_10000157412 515
90 3300005536 Ga0070697_100044250 Ga0070697_1000442502 515
91 3300005543 Ga0070672_100018048 Ga0070672_1000180483 515
92 3300005544 Ga0070686_100008714 Ga0070686_1000087144 515
93 3300005544 Ga0070686_100066722 Ga0070686_1000667222 515
94 3300005549 Ga0070704_100007530 Ga0070704_1000075305 515
95 3300005549 Ga0070704_100063065 Ga0070704_1000630652 515
96 3300005564 Ga0070664_100041746 Ga0070664_1000417463 515
97 3300005615 Ga0070702_100025346 Ga0070702_1000253462 515
98 3300005617 Ga0068859_100038848 Ga0068859_1000388484 515
99 3300005841 Ga0068863_100032083 Ga0068863_1000320834 515
100 3300005843 Ga0068860_100068711 Ga0068860_1000687112 515
101 3300005843 Ga0068860_100083409 Ga0068860_1000834092 515
102 3300005844 Ga0068862_100002764 Ga0068862_1000027646 515
103 3300005844 Ga0068862_100002808 Ga0068862_1000028083 515
104 3300005985 Ga0081539_10000920 Ga0081539_1000092019 515
105 3300006028 Ga0070717_10032358 Ga0070717_100323584 515
106 3300006173 Ga0070716_100013193 Ga0070716_1000131932 515
107 3300006844 Ga0075428_100009078 Ga0075428_1000090782 515
108 3300006844 Ga0075428_100045034 Ga0075428_1000450343 515
109 3300006846 Ga0075430_100032596 Ga0075430_1000325963 515
110 3300006847 Ga0075431_100001042 Ga0075431_10000104212 515
111 3300006847 Ga0075431_100009422 Ga0075431_1000094228 515
112 3300006847 Ga0075431_100026354 Ga0075431_1000263543 515
113 3300006847 Ga0075431_100258242 Ga0075431_1002582421 515
114 3300006852 Ga0075433_10019404 Ga0075433_100194046 515
115 3300006880 Ga0075429_100010810 Ga0075429_1000108104 515
116 3300006880 Ga0075429_100019170 Ga0075429_1000191706 515
117 3300006914 Ga0075436_100008871 Ga0075436_1000088712 515
118 3300006931 Ga0097620_100038845 Ga0097620_1000388454 515
119 3300009094 Ga0111539_10202462 Ga0111539_102024622 515
120 3300009098 Ga0105245_10014066 Ga0105245_100140665 515
121 3300009098 Ga0105245_10229674 Ga0105245_102296741 515
122 3300009147 Ga0114129_10001698 Ga0114129_1000169812 515
123 3300009147 Ga0114129_10002668 Ga0114129_1000266813 515
124 3300009147 Ga0114129_10049369 Ga0114129_100493696 515
125 3300009147 Ga0114129_10148954 Ga0114129_101489543 515
126 3300009176 Ga0105242_10001678 Ga0105242_1000167818 515
127 3300009176 Ga0105242_10178020 Ga0105242_101780202 515
128 3300009177 Ga0105248_10001612 Ga0105248_1000161222 515
129 3300013297 Ga0157378_10009904 Ga0157378_100099042 515
130 3300013308 Ga0157375_10100471 Ga0157375_101004713 515
131 3300014745 Ga0157377_10001759 Ga0157377_100017593 515
132 3300014745 Ga0157377_10070602 Ga0157377_100706022 515
133 3300025893 Ga0207682_10006950 Ga0207682_100069503 515
134 3300025901 Ga0207688_10003816 Ga0207688_100038162 515
135 3300025906 Ga0207699_10000077 Ga0207699_1000007769 515
136 3300025908 Ga0207643_10015320 Ga0207643_100153202 515
137 3300025910 Ga0207684_10004276 Ga0207684_100042767 515
138 3300025918 Ga0207662_10003456 Ga0207662_100034566 515
139 3300025918 Ga0207662_10023582 Ga0207662_100235822 515
140 3300025922 Ga0207646_10005952 Ga0207646_100059524 515
141 3300025922 Ga0207646_10007381 Ga0207646_100073817 515
142 3300025925 Ga0207650_10010170 Ga0207650_100101703 515
143 3300025925 Ga0207650_10064284 Ga0207650_100642841 515
144 3300025926 Ga0207659_10005222 Ga0207659_100052226 515
145 3300025929 Ga0207664_10044995 Ga0207664_100449953 515
146 3300025933 Ga0207706_10049452 Ga0207706_100494523 515
147 3300025933 Ga0207706_10054281 Ga0207706_100542813 515
148 3300025934 Ga0207686_10015701 Ga0207686_100157012 515
149 3300025935 Ga0207709_10059539 Ga0207709_100595392 515
150 3300025936 Ga0207670_10017498 Ga0207670_100174982 515
151 3300025936 Ga0207670_10098230 Ga0207670_100982302 515
152 3300025939 Ga0207665_10053012 Ga0207665_100530122 515
153 3300025940 Ga0207691_10044763 Ga0207691_100447632 515
154 3300025942 Ga0207689_10004483 Ga0207689_100044834 515
155 3300025945 Ga0207679_10026828 Ga0207679_100268283 515
156 3300026035 Ga0207703_10157473 Ga0207703_101574732 515
157 3300026075 Ga0207708_10004304 Ga0207708_100043042 515
158 3300026088 Ga0207641_10044070 Ga0207641_100440703 515
159 3300026089 Ga0207648_10011387 Ga0207648_100113876 515
160 3300026089 Ga0207648_10087408 Ga0207648_100874083 515
161 3300026118 Ga0207675_100004147 Ga0207675_1000041475 515
162 3300026118 Ga0207675_100007281 Ga0207675_1000072812 515
163 3300026121 Ga0207683_10021093 Ga0207683_100210933 515
164 3300026121 Ga0207683_10029179 Ga0207683_100291794 515
165 3300027666 Ga0209282_1000078 Ga0209282_100007843 515
166 3300027907 Ga0207428_10083243 Ga0207428_100832432 515
167 3300028379 Ga0268266_10121893 Ga0268266_101218932 515
168 3300028381 Ga0268264_10022081 Ga0268264_100220812 515
169 3300031090 Ga0265760_10017672 Ga0265760_100176722 515
170 3300031238 Ga0265332_10004029 Ga0265332_100040293 515
171 3300031239 Ga0265328_10002074 Ga0265328_100020745 515
172 3300031242 Ga0265329_10017420 Ga0265329_100174202 515
173 3300031250 Ga0265331_10001392 Ga0265331_1000139218 515
174 3300031548 Ga0307408_100035026 Ga0307408_1000350264 515
175 3300031711 Ga0265314_10000660 Ga0265314_100006605 515
176 3300035398 Ga0316574_0004164 Ga0316574_0004164_5383_6930 515
177 3300035410 Ga0373924_0042593 Ga0373924_0042593_32_1579 515
178 3300035691 Ga0373931_0017417 Ga0373931_0017417_1844_3391 515
179 3300035695 Ga0373927_0086373 Ga0373927_0086373_205_1752 515
180 3300036401 Ga0373937_0115637 Ga0373937_0115637_140_1810 515
181 3300045051 Ga0451576_0048093 Ga0451576_0048093_1493_3040 515
182 3300045051 Ga0451576_0207371 Ga0451576_0207371_396_1967 515
183 3300046474 Ga0495605_0003185 Ga0495605_0003185_4937_6484 515
184 3300046500 Ga0495596_0000624 Ga0495596_0000624_11934_13481 515
185 3300046513 Ga0495616_0004854 Ga0495616_0004854_4311_5858 515
186 3300046665 Ga0495661_0021153 Ga0495661_0021153_2331_3878 515
187 3300046683 Ga0495658_0055843 Ga0495658_0055843_327_1874 515
188 3300048919 Ga0496116_0011913 Ga0496116_0011913_3879_5426 515
189 3300048925 Ga0496122_0009339 Ga0496122_0009339_8294_9841 515
190 3300049574 Ga0501038_0018727 Ga0501038_0018727_3815_5365 515
191 3300049575 Ga0501039_0155989 Ga0501039_0155989_78_1625 515
192 3300049576 Ga0501040_0028845 Ga0501040_0028845_1226_2782 515
193 3300049579 Ga0501043_0089678 Ga0501043_0089678_453_2003 515
194 3300049581 Ga0501047_0001021 Ga0501047_0001021_16322_17872 515
195 3300049583 Ga0501067_0006150 Ga0501067_0006150_30_1580 515
196 3300049584 Ga0501068_0000205 Ga0501068_0000205_15001_16551 515
197 3300049585 Ga0501069_0010564 Ga0501069_0010564_2928_4478 515
198 3300049587 Ga0501071_0000316 Ga0501071_0000316_4516_6156 515
199 3300049588 Ga0501072_0000041 Ga0501072_0000041_84309_85859 515
200 3300049589 Ga0501073_0000968 Ga0501073_0000968_902_2452 515
201 3300049590 Ga0501074_0000536 Ga0501074_0000536_5967_7517 515
202 3300049591 Ga0501075_0036400 Ga0501075_0036400_2077_3633 515
203 3300049592 Ga0501076_0003008 Ga0501076_0003008_5504_7054 515
204 3300049592 Ga0501076_0099754 Ga0501076_0099754_483_2036 515
205 3300049593 Ga0501077_0002025 Ga0501077_0002025_5906_7456 515
206 3300049593 Ga0501077_0004514 Ga0501077_0004514_5724_7280 515
207 3300049741 Ga0501079_0006954 Ga0501079_0006954_5905_7452 515
208 3300049741 Ga0501079_0009360 Ga0501079_0009360_2418_3974 515
209 3300049741 Ga0501079_0053612 Ga0501079_0053612_912_2468 515
210 3300049742 Ga0501080_0005242 Ga0501080_0005242_1965_3605 515
211 3300049742 Ga0501080_0006518 Ga0501080_0006518_1679_3229 515
212 3300049743 Ga0501081_0010946 Ga0501081_0010946_3966_5522 515
213 3300049744 Ga0501083_0056169 Ga0501083_0056169_307_1854 515
214 3300049744 Ga0501083_0087000 Ga0501083_0087000_167_1717 515
215 3300049823 Ga0501044_0097181 Ga0501044_0097181_963_2513 515
216 3300050507 nmdc:mga05p37_1261_c1 nmdc:mga05p37_1261_c1_15246_16799 515
217 3300050507 nmdc:mga05p37_32141_c1 nmdc:mga05p37_32141_c1_1928_3499 515
218 3300050507 nmdc:mga05p37_4555_c1 nmdc:mga05p37_4555_c1_12158_13711 515
219 3300050508 nmdc:mga09592_1081_c1 nmdc:mga09592_1081_c1_5776_7347 515
220 3300050508 nmdc:mga09592_3974_c1 nmdc:mga09592_3974_c1_1478_3031 515
221 3300050509 nmdc:mga0qj67_58196_c1 nmdc:mga0qj67_58196_c1_1182_2729 515
222 3300050510 nmdc:mga06r32_3673_c1 nmdc:mga06r32_3673_c1_1642_3195 515
223 3300050510 nmdc:mga06r32_37451_c1 nmdc:mga06r32_37451_c1_1743_3314 515
224 3300050510 nmdc:mga06r32_40572_c1 nmdc:mga06r32_40572_c1_1589_3142 515
225 3300050511 nmdc:mga08y16_195086_c1 nmdc:mga08y16_195086_c1_182_1729 515
226 3300050511 nmdc:mga08y16_47484_c1 nmdc:mga08y16_47484_c1_720_2291 515
227 3300050512 nmdc:mga0n895_147977_c1 nmdc:mga0n895_147977_c1_100_1656 515
228 3300050512 nmdc:mga0n895_5911_c1 nmdc:mga0n895_5911_c1_1702_3255 515
229 3300050513 nmdc:mga0rr50_2322_c1 nmdc:mga0rr50_2322_c1_1001_2554 515
230 3300050515 nmdc:mga0a205_179627_c1 nmdc:mga0a205_179627_c1_302_1873 515
231 3300050515 nmdc:mga0a205_2067_c1 nmdc:mga0a205_2067_c1_761_2314 515
232 3300054114 Ga0501084_0000124 Ga0501084_0000124_18773_20323 515
233 3300054114 Ga0501084_0001122 Ga0501084_0001122_13844_15400 515
234 3300054114 Ga0501084_0181791 Ga0501084_0181791_175_1728 515
235 3300060353 Ga0501082_0010907 Ga0501082_0010907_3944_5491 515
236 3300060353 Ga0501082_0014516 Ga0501082_0014516_3914_5464 515
237 3300003187 JGI25151J46595_10006879 JGI25151J46595_100068793 516
238 3300003773 Ga0055537_1001928 Ga0055537_10019282 516
239 3300003784 Ga0055534_1002099 Ga0055534_10020992 516
240 3300005338 Ga0068868_100062529 Ga0068868_1000625292 516
241 3300005356 Ga0070674_100083601 Ga0070674_1000836012 516
242 3300005435 Ga0070714_100021403 Ga0070714_1000214032 516
243 3300005467 Ga0070706_100014785 Ga0070706_1000147855 516
244 3300005530 Ga0070679_100090860 Ga0070679_1000908602 516
245 3300005549 Ga0070704_100074682 Ga0070704_1000746822 516
246 3300005981 Ga0081538_10054003 Ga0081538_100540032 516
247 3300006038 Ga0075365_10019443 Ga0075365_100194434 516
248 3300006175 Ga0070712_100007175 Ga0070712_1000071752 516
249 3300006844 Ga0075428_100021006 Ga0075428_1000210066 516
250 3300006847 Ga0075431_100029597 Ga0075431_1000295972 516
251 3300013307 Ga0157372_10184431 Ga0157372_101844312 516
252 3300025263 Ga0209565_1000021 Ga0209565_1000021110 516
253 3300025291 Ga0209675_1001421 Ga0209675_10014217 516
254 3300025294 Ga0209025_1012020 Ga0209025_10120204 516
255 3300025295 Ga0209564_1000452 Ga0209564_100045218 516
256 3300025299 Ga0209256_1001235 Ga0209256_100123521 516
257 3300025303 Ga0209051_1010613 Ga0209051_10106132 516
258 3300025915 Ga0207693_10001605 Ga0207693_1000160517 516
259 3300025919 Ga0207657_10093422 Ga0207657_100934222 516
260 3300025929 Ga0207664_10017131 Ga0207664_100171313 516
261 3300026023 Ga0207677_10015230 Ga0207677_100152303 516
262 3300026121 Ga0207683_10021242 Ga0207683_100212425 516
263 3300038443 Ga0395901_0161158 Ga0395901_0161158_296_1858 516
264 3300048904 Ga0496101_0034823 Ga0496101_0034823_1831_3414 516
265 3300048905 Ga0496102_0097887 Ga0496102_0097887_570_2153 516
266 3300048906 Ga0496103_0009414 Ga0496103_0009414_3837_5420 516
267 3300048909 Ga0496106_0005405 Ga0496106_0005405_377_1960 516
268 3300048910 Ga0496107_0010555 Ga0496107_0010555_562_2145 516
269 3300048911 Ga0496108_0046677 Ga0496108_0046677_566_2149 516
270 3300048915 Ga0496112_0027301 Ga0496112_0027301_3722_5305 516
271 3300048917 Ga0496114_0020283 Ga0496114_0020283_3362_4945 516
272 3300049571 Ga0501034_0000128 Ga0501034_0000128_22278_23828 516
273 3300049572 Ga0501036_0033763 Ga0501036_0033763_1957_3513 516
274 3300049574 Ga0501038_0008451 Ga0501038_0008451_696_2252 516
275 3300049578 Ga0501042_0021313 Ga0501042_0021313_1853_3409 516
276 3300049587 Ga0501071_0018294 Ga0501071_0018294_349_1905 516
277 3300049588 Ga0501072_0059070 Ga0501072_0059070_593_2149 516
278 3300049591 Ga0501075_0000087 Ga0501075_0000087_25534_27090 516
279 3300049592 Ga0501076_0000193 Ga0501076_0000193_2360_3916 516
280 3300049742 Ga0501080_0032648 Ga0501080_0032648_650_2206 516
281 3300050492 nmdc:mga0yw44_8493_c1 nmdc:mga0yw44_8493_c1_3293_4876 516
282 3300054114 Ga0501084_0034904 Ga0501084_0034904_1219_2775 516
283 3300060353 Ga0501082_0005053 Ga0501082_0005053_1829_3385 516
284 3300061734 Ga0530510_0000531 Ga0530510_0000531_16537_18093 516
285 iso_pu_bacteria 2513237150 2513956140 516

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01039

Carboxyl_trans

Carboxyl transferase domain

115

602

0.93

PF03255

ACCA

Acetyl co-enzyme A carboxylase carboxyltransferase-like

394

504

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
8pn8-assembly1.cif.gz_F engineered glycolyl-coa carboxylase (l100n variant) with bound coa 0.8949 8 508
8pn7-assembly1.cif.gz_E engineered glycolyl-coa carboxylase (g20r variant) with bound coa 0.8945 8 508
6ybq-assembly1.cif.gz_F engineered glycolyl-coa carboxylase (quintuple mutant) with bound coa 0.8892 8 508
1on3-assembly1.cif.gz_D transcarboxylase 12s crystal structure: hexamer assembly and substrate binding to a multienzyme core (with methylmalonyl-coenzyme a and methylmalonic acid bound) 0.8892 1 512
7w5u-assembly1.cif.gz_F acetyl-coa carboxylase-accb 0.8862 5 508
ID Description Score Start End Superfamily
af_Q9XUC3_1361_1542_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9231 296 402 3.90.226.10
5fifB02 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.899 274 512 3.90.226.10
4g2rA02 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8943 266 502 3.90.226.10
af_O53578_265_515_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8727 267 502 3.90.226.10
af_O53578_4_260_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8688 1 262 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A850SSD5-F1-model_v4 Methylmalonyl-CoA carboxyltransferase 0.9852 1 434 GO:0004658
GO:0016740
AF-A0A2D7XS51-F1-model_v4 Methylmalonyl-CoA carboxyltransferase 0.9828 20 512 GO:0004658
GO:0016740
AF-X1VRZ5-F1-model_v4 CoA carboxyltransferase C-terminal domain-containing protein 0.9801 272 363 GO:0004658
AF-A0A382EZT9-F1-model_v4 CoA carboxyltransferase N-terminal domain-containing protein 0.98 1 389 GO:0004658
AF-A0A7K1IN13-F1-model_v4 deleted 0.9786 266 402

Feature Viewer

pLDDT pTM Quality
92.07 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map