F386625

General Info

Members Datasets Scaffolds Average Seq Length
285 212 272 188

Family's Representative Sequence

Representative Sequence 3300005406|Ga0070703_10085926|Ga0070703_100859262
Length 219
Sequence MASAGFFYLFAVLAVAAGAMVVLAKNPVHAVLFLILAFFNSAGLFVLLGAEFLAMVLVVVYVGAVSVLFLFVVMRLDVDFAALKAGFIKNAKVGALVGGIVLAELVLLFTYRGLTVAPMSNAASPMPAAGSAVTNTEALGLILYTKYIYFFQGAGMILLVAMIGAIVLTLKHRENVKRQSVAEQVARTPKTTLEVIKVPSGGSVIPVAAKRSKRTEAAE

Samples

Sample ID Description Type Environment
1 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
2 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
3 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
4 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
5 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
6 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
7 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
8 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
9 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
10 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
11 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
12 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
13 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
14 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
15 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
16 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
17 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
18 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
96 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
137 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
138 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
139 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
143 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
144 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
145 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
146 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
147 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
148 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
149 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
150 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
151 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
152 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
153 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
154 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
155 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
156 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
172 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
173 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
174 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
175 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
176 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
177 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
184 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
185 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
186 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
187 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
188 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
189 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
190 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
191 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
192 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
193 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
196 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
197 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
198 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
199 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
205 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
206 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
207 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
208 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
209 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
210 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
211 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
212 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.44
Metatranscriptomes 0
Isolates 4.56

Biome Distribution

Category Percentage (%)
Aerial Root 1.75
Bulb 0
Endosphere 13.33
Nodule 0
Rhizoplane 7.37
Rhizosphere 72.98
Stem 0
Stem Tuber 0
Unclassified 4.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1013030 3300001904 Bacteria 1343
2 JGI24735J21928_10034446 3300002067 Bacteria 1493
3 JGI24751J29686_10000119 3300002459 Bacteria 40044
4 JGI24751J29686_10008294 3300002459 Bacteria 2126
5 JGI25150J39212_1000431 3300002774 Bacteria 19083
6 JGI25406J46586_10000156 3300003203 Bacteria 30235
7 JGI25153J46596_10023323 3300003215 Bacteria 2259
8 Ga0055526_1035814 3300003771 Bacteria 1329
9 Ga0055530_10020955 3300003791 Bacteria 1938
10 JGI25405J52794_10014303 3300003911 Bacteria 1548
11 Ga0065165_1024601 3300005262 Bacteria 2019
12 Ga0065707_10083512 3300005295 Bacteria 8901
13 Ga0065707_10133901 3300005295 Bacteria 1873
14 Ga0070670_100000047 3300005331 Bacteria 136625
15 Ga0070670_100001598 3300005331 Bacteria 18297
16 Ga0070680_100033247 3300005336 Bacteria 4155
17 Ga0070682_100003745 3300005337 Bacteria 8453
18 Ga0070660_100011261 3300005339 Bacteria 6348
19 Ga0070691_10032323 3300005341 Bacteria 2458
20 Ga0070661_100623773 3300005344 Bacteria 873
21 Ga0070668_100000025 3300005347 Bacteria 93131
22 Ga0070668_100046041 3300005347 Bacteria 3348
23 Ga0070668_100135902 3300005347 Bacteria 1977
24 Ga0070669_100000072 3300005353 Bacteria 99184
25 Ga0070669_100315348 3300005353 Bacteria 1261
26 Ga0070671_100007399 3300005355 Bacteria 8773
27 Ga0070659_100006341 3300005366 Bacteria 8543
28 Ga0070659_100277558 3300005366 Bacteria 1393
29 Ga0070667_100000006 3300005367 Bacteria 336732
30 Ga0070667_100000188 3300005367 Bacteria 74225
31 Ga0070667_100007504 3300005367 Bacteria 9045
32 Ga0070703_10085926 3300005406 Bacteria 1081
33 Ga0070700_100155152 3300005441 Bacteria 1570
34 Ga0070694_100019654 3300005444 Bacteria 4299
35 Ga0070663_100011513 3300005455 Bacteria 5558
36 Ga0070678_100058730 3300005456 Bacteria 2825
37 Ga0070662_100057854 3300005457 Bacteria 2818
38 Ga0070681_10047118 3300005458 Bacteria 4308
39 Ga0068867_100151115 3300005459 Bacteria 1824
40 Ga0070679_100037045 3300005530 Bacteria 4842
41 Ga0068853_100023821 3300005539 Bacteria 5130
42 Ga0068853_100267782 3300005539 Bacteria 1572
43 Ga0070695_100527907 3300005545 Bacteria 917
44 Ga0070696_100025206 3300005546 Bacteria 4042
45 Ga0070704_100025883 3300005549 Bacteria 3868
46 Ga0068855_100012936 3300005563 Bacteria 10067
47 Ga0070664_100232387 3300005564 Bacteria 1653
48 Ga0068854_100014250 3300005578 Bacteria 5237
49 Ga0068854_100759446 3300005578 Bacteria 842
50 Ga0068856_101261294 3300005614 Bacteria 755
51 Ga0070702_100019099 3300005615 Bacteria 3567
52 Ga0068852_100377077 3300005616 Bacteria 1391
53 Ga0068859_100017970 3300005617 Bacteria 7106
54 Ga0068859_100093363 3300005617 Bacteria 3061
55 Ga0068864_100000051 3300005618 Bacteria 136621
56 Ga0068864_100003848 3300005618 Bacteria 12367
57 Ga0068864_100249920 3300005618 Bacteria 1646
58 Ga0068861_100205684 3300005719 Bacteria 1655
59 Ga0068851_10171090 3300005834 Bacteria 1199
60 Ga0068863_100007348 3300005841 Bacteria 10785
61 Ga0068863_100060675 3300005841 Bacteria 3576
62 Ga0068858_100000969 3300005842 Bacteria 29675
63 Ga0068858_100055296 3300005842 Bacteria 3669
64 Ga0068860_100000013 3300005843 Bacteria 323055
65 Ga0068860_100000074 3300005843 Bacteria 173022
66 Ga0068862_100000036 3300005844 Bacteria 173453
67 Ga0068862_100010523 3300005844 Bacteria 7641
68 Ga0068862_100282495 3300005844 Bacteria 1522
69 Ga0081455_10001182 3300005937 Bacteria 32680
70 Ga0081540_1144950 3300005983 Bacteria 947
71 Ga0081539_10000076 3300005985 Bacteria 229037
72 Ga0075365_10016285 3300006038 Bacteria 4518
73 Ga0075365_10025462 3300006038 Bacteria 3746
74 Ga0075365_10399590 3300006038 Bacteria 970
75 Ga0075368_10022618 3300006042 Bacteria 2394
76 Ga0075363_100164445 3300006048 Bacteria 1257
77 Ga0075432_10227997 3300006058 Bacteria 748
78 Ga0075367_10010137 3300006178 Bacteria 4942
79 Ga0075367_10245090 3300006178 Bacteria 1123
80 Ga0075366_10019421 3300006195 Bacteria 3932
81 Ga0075366_10035460 3300006195 Bacteria 2940
82 Ga0075370_10071310 3300006353 Bacteria 1987
83 Ga0075370_10331922 3300006353 Bacteria 907
84 Ga0068871_100204470 3300006358 Bacteria 1706
85 Ga0075431_100194606 3300006847 Bacteria 2076
86 Ga0075429_100263617 3300006880 Bacteria 1509
87 Ga0097620_100017970 3300006931 Bacteria 7106
88 Ga0097620_100093362 3300006931 Bacteria 3061
89 Ga0105240_10165920 3300009093 Bacteria 2619
90 Ga0111539_10027363 3300009094 Bacteria 6964
91 Ga0111539_10050304 3300009094 Bacteria 4964
92 Ga0105245_10424564 3300009098 Bacteria 1333
93 Ga0114129_10080638 3300009147 Bacteria 4523
94 Ga0114129_10820792 3300009147 Bacteria 1184
95 Ga0114129_11211094 3300009147 Bacteria 940
96 Ga0105243_10131907 3300009148 Bacteria 2121
97 Ga0105241_10014507 3300009174 Bacteria 5771
98 Ga0105248_10001208 3300009177 Bacteria 28863
99 Ga0105248_10007006 3300009177 Bacteria 12346
100 Ga0105237_10041000 3300009545 Bacteria 4670
101 Ga0105238_10041875 3300009551 Bacteria 4639
102 Ga0105238_10047227 3300009551 Bacteria 4343
103 Ga0105238_10195740 3300009551 Bacteria 1997
104 Ga0105249_10274715 3300009553 Bacteria 1680
105 Ga0157371_10245441 3300013102 Bacteria 1289
106 Ga0157369_10230792 3300013105 Bacteria 1935
107 Ga0157378_10739761 3300013297 Bacteria 1005
108 Ga0157372_11360287 3300013307 Bacteria 819
109 Ga0157375_10075900 3300013308 Bacteria 3386
110 Ga0163163_10109471 3300014325 Bacteria 2790
111 Ga0157380_10000238 3300014326 Bacteria 33156
112 Ga0157380_10439914 3300014326 Bacteria 1249
113 Ga0157376_10219741 3300014969 Bacteria 1759
114 Ga0213875_10036713 3300021388 Bacteria 2310
115 Ga0209564_1001724 3300025295 Bacteria 20518
116 Ga0207647_10018443 3300025904 Bacteria 4719
117 Ga0207647_10077128 3300025904 Bacteria 2003
118 Ga0207654_10007580 3300025911 Bacteria 5472
119 Ga0207707_10041585 3300025912 Bacteria 4013
120 Ga0207657_10041904 3300025919 Bacteria 4044
121 Ga0207649_10552694 3300025920 Bacteria 881
122 Ga0207652_10033196 3300025921 Bacteria 4345
123 Ga0207652_10240519 3300025921 Bacteria 1632
124 Ga0207681_10000061 3300025923 Bacteria 102257
125 Ga0207681_10107379 3300025923 Bacteria 2024
126 Ga0207694_10095805 3300025924 Bacteria 2347
127 Ga0207694_10143633 3300025924 Bacteria 1920
128 Ga0207694_10226361 3300025924 Bacteria 1526
129 Ga0207650_10000038 3300025925 Bacteria 206081
130 Ga0207650_10002143 3300025925 Bacteria 13794
131 Ga0207687_10317350 3300025927 Bacteria 1260
132 Ga0207644_10000421 3300025931 Bacteria 27476
133 Ga0207690_10028704 3300025932 Bacteria 3528
134 Ga0207706_10032887 3300025933 Bacteria 4614
135 Ga0207709_10089709 3300025935 Bacteria 2005
136 Ga0207711_10008193 3300025941 Bacteria 8749
137 Ga0207711_10013715 3300025941 Bacteria 6729
138 Ga0207679_10130289 3300025945 Bacteria 2017
139 Ga0207667_10008339 3300025949 Bacteria 12323
140 Ga0207667_11225431 3300025949 Bacteria 729
141 Ga0207668_10000009 3300025972 Bacteria 188071
142 Ga0207668_10111344 3300025972 Bacteria 2055
143 Ga0207640_10044496 3300025981 Bacteria 2845
144 Ga0207658_10000105 3300025986 Bacteria 91475
145 Ga0207658_10000145 3300025986 Bacteria 74256
146 Ga0207658_10004894 3300025986 Bacteria 9240
147 Ga0207703_10000420 3300026035 Bacteria 44903
148 Ga0207703_10041003 3300026035 Bacteria 3708
149 Ga0207639_10059944 3300026041 Bacteria 2934
150 Ga0207678_10000104 3300026067 Bacteria 69027
151 Ga0207708_10176699 3300026075 Bacteria 1694
152 Ga0207702_10296284 3300026078 Bacteria 1534
153 Ga0207641_10000288 3300026088 Bacteria 63229
154 Ga0207641_10002010 3300026088 Bacteria 19383
155 Ga0207676_10000034 3300026095 Bacteria 206058
156 Ga0207676_10001201 3300026095 Bacteria 19447
157 Ga0207676_10391490 3300026095 Bacteria 1296
158 Ga0207675_100001428 3300026118 Bacteria 23957
159 Ga0207675_100041425 3300026118 Bacteria 4301
160 Ga0207683_10044669 3300026121 Bacteria 3873
161 Ga0209974_10084779 3300027876 Bacteria 1094
162 Ga0207428_10102416 3300027907 Bacteria 2211
163 Ga0268265_10000052 3300028380 Bacteria 174254
164 Ga0268265_10001399 3300028380 Bacteria 20452
165 Ga0268264_10000039 3300028381 Bacteria 376641
166 Ga0268264_10000070 3300028381 Bacteria 268524
167 Ga0307408_100415084 3300031548 Bacteria 1159
168 Ga0316576_10075593 3300031727 Bacteria 2492
169 Ga0307410_10386602 3300031852 Bacteria 1127
170 Ga0307406_10048986 3300031901 Bacteria 2672
171 Ga0307412_10007671 3300031911 Bacteria 6129
172 Ga0307411_10508675 3300032005 Bacteria 1020
173 Ga0373950_0027485 3300034818 Bacteria 1038
174 Ga0373954_0273747 3300035118 Bacteria 832
175 Ga0373961_0016861 3300035241 Bacteria 1886
176 Ga0316584_0112334 3300036712 Bacteria 2039
177 Ga0395900_0176337 3300037418 Bacteria 2174
178 Ga0395905_0316732 3300037471 Bacteria 1449
179 Ga0436364_0766756 3300037853 Bacteria 917
180 Ga0436364_0986946 3300037853 Bacteria 208509
181 Ga0436363_1414565 3300039450 Bacteria 1280
182 Ga0451793_1228122 3300041452 Bacteria 730
183 Ga0439448_0043215 3300042005 Bacteria 1462
184 Ga0439458_0011567 3300042157 Bacteria 1975
185 Ga0466972_0113673 3300044658 Bacteria 1279
186 Ga0466973_0222980 3300044659 Bacteria 1366
187 Ga0453684_0012492 3300044712 Bacteria 13986
188 Ga0466968_0233620 3300044735 Bacteria 869
189 Ga0495603_0314219 3300046455 Bacteria 900
190 Ga0495638_0146898 3300046460 Bacteria 1371
191 Ga0495583_0000426 3300046506 Bacteria 63627
192 Ga0495611_0209059 3300046648 Bacteria 909
193 Ga0495661_0296038 3300046665 Bacteria 811
194 Ga0495649_0108327 3300046694 Bacteria 1474
195 Ga0495686_0002646 3300047472 Bacteria 16531
196 Ga0495686_0057081 3300047472 Bacteria 2437
197 Ga0496100_0276038 3300048903 Bacteria 1251
198 Ga0496101_0134867 3300048904 Bacteria 1878
199 Ga0496102_0170745 3300048905 Bacteria 2047
200 Ga0496102_0301447 3300048905 Bacteria 1510
201 Ga0496103_0007374 3300048906 Bacteria 6554
202 Ga0496104_0001212 3300048907 Bacteria 22189
203 Ga0496104_0017945 3300048907 Bacteria 6452
204 Ga0496104_0331743 3300048907 Bacteria 1434
205 Ga0496105_0033061 3300048908 Bacteria 4246
206 Ga0496105_0098186 3300048908 Bacteria 2419
207 Ga0496106_0094174 3300048909 Bacteria 2315
208 Ga0496106_0298462 3300048909 Bacteria 1292
209 Ga0496107_0042655 3300048910 Bacteria 3259
210 Ga0496108_0137573 3300048911 Bacteria 2103
211 Ga0496110_0003203 3300048913 Bacteria 12463
212 Ga0496112_0176585 3300048915 Bacteria 2100
213 Ga0496113_0099204 3300048916 Bacteria 2255
214 Ga0496113_0333294 3300048916 Bacteria 1217
215 Ga0496115_0018167 3300048918 Bacteria 5392
216 Ga0496115_0077838 3300048918 Bacteria 2697
217 Ga0496124_0573060 3300048927 Bacteria 740
218 Ga0496125_0388738 3300048928 Bacteria 820
219 Ga0495682_0310108 3300049460 Bacteria 556
220 Ga0501290_010965 3300049513 Bacteria 1162
221 Ga0501292_000445 3300049515 Bacteria 5368
222 Ga0501294_000687 3300049517 Bacteria 3788
223 Ga0501032_0081002 3300049569 Bacteria 2160
224 Ga0501034_0073901 3300049571 Bacteria 3418
225 Ga0501038_0212772 3300049574 Bacteria 1546
226 Ga0501038_0328709 3300049574 Bacteria 1194
227 Ga0501039_0236380 3300049575 Bacteria 1437
228 Ga0501046_0593720 3300049580 Bacteria 786
229 Ga0501047_0049043 3300049581 Bacteria 4077
230 Ga0501206_017021 3300049653 Bacteria 1014
231 Ga0501222_012931 3300049662 Bacteria 1100
232 Ga0501224_005763 3300049664 Bacteria 1785
233 Ga0501227_016389 3300049665 Bacteria 1665
234 Ga0501261_000971 3300049690 Bacteria 3518
235 Ga0501245_001923 3300049708 Bacteria 2738
236 Ga0501279_000502 3300049775 Bacteria 5128
237 Ga0501280_000525 3300049776 Bacteria 9001
238 Ga0501282_002683 3300049778 Bacteria 1928
239 Ga0501283_017289 3300049779 Bacteria 1127
240 Ga0501035_1153536 3300049822 Bacteria 603
241 Ga0501044_0035407 3300049823 Bacteria 5228
242 nmdc:mga03n38_119358_c1 3300050490 Bacteria 1294
243 nmdc:mga03n38_28562_c1 3300050490 Bacteria 2326
244 nmdc:mga0yw44_114067_c1 3300050492 Bacteria 1734
245 nmdc:mga0yw44_418436_c1 3300050492 Bacteria 907
246 nmdc:mga06z11_158351_c1 3300050494 Bacteria 1293
247 nmdc:mga06z11_240295_c1 3300050494 Bacteria 1063
248 nmdc:mga06z11_2729_c1 3300050494 Bacteria 6218
249 nmdc:mga04h51_59139_c1 3300050495 Bacteria 1309
250 nmdc:mga04h51_7819_c1 3300050495 Bacteria 2839
251 nmdc:mga07m45_329073_c1 3300050496 Bacteria 888
252 nmdc:mga05p37_139365_c1 3300050507 Bacteria 2972
253 nmdc:mga05p37_549797_c1 3300050507 Bacteria 1314
254 nmdc:mga09592_218694_c1 3300050508 Bacteria 1651
255 nmdc:mga06r32_126566_c1 3300050510 Bacteria 2524
256 nmdc:mga06r32_353138_c1 3300050510 Bacteria 1455
257 nmdc:mga06r32_64041_c1 3300050510 Bacteria 3545
258 nmdc:mga08y16_364943_c1 3300050511 Bacteria 1482
259 nmdc:mga08y16_44710_c1 3300050511 Bacteria 4641
260 nmdc:mga08y16_78189_c1 3300050511 Bacteria 3449
261 Ga0500643_000703 3300053087 Bacteria 22226
262 Ga0500643_035782 3300053087 Bacteria 1486
263 Ga0500566_0063102 3300053094 Bacteria 2093
264 Ga0500555_012059 3300053103 Bacteria 2484
265 Ga0500592_000827 3300053116 Bacteria 5070
266 Ga0500568_0214345 3300053139 Bacteria 704
267 Ga0500573_0001876 3300053140 Bacteria 10257
268 Ga0500616_0051260 3300053153 Bacteria 2175
269 Ga0500616_0095800 3300053153 Bacteria 1460
270 Ga0500627_0002065 3300053158 Bacteria 5816
271 Ga0500627_0248033 3300053158 Bacteria 788
272 Ga0501082_0168253 3300060353 Bacteria 1905

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050510 nmdc:mga06r32_64041_c1 nmdc:mga06r32_64041_c1_2602_3243 146
2 3300049460 Ga0495682_0310108 Ga0495682_0310108_97_543 148
3 3300049574 Ga0501038_0328709 Ga0501038_0328709_653_1171 148
4 3300006847 Ga0075431_100194606 Ga0075431_1001946062 155
5 3300009147 Ga0114129_10820792 Ga0114129_108207922 155
6 3300049569 Ga0501032_0081002 Ga0501032_0081002_64_714 163
7 3300049575 Ga0501039_0236380 Ga0501039_0236380_623_1273 163
8 3300049822 Ga0501035_1153536 Ga0501035_1153536_22_591 163
9 3300049823 Ga0501044_0035407 Ga0501044_0035407_2616_3266 163
10 3300006038 Ga0075365_10399590 Ga0075365_103995902 166
11 3300049708 Ga0501245_001923 Ga0501245_001923_1076_1648 166
12 3300050492 nmdc:mga0yw44_418436_c1 nmdc:mga0yw44_418436_c1_71_742 166
13 3300050507 nmdc:mga05p37_549797_c1 nmdc:mga05p37_549797_c1_307_963 168
14 3300046694 Ga0495649_0108327 Ga0495649_0108327_83_694 172
15 3300048927 Ga0496124_0573060 Ga0496124_0573060_49_657 172
16 3300050511 nmdc:mga08y16_364943_c1 nmdc:mga08y16_364943_c1_730_1386 172
17 3300047472 Ga0495686_0002646 Ga0495686_0002646_3102_3710 175
18 3300048909 Ga0496106_0298462 Ga0496106_0298462_355_1014 175
19 3300003203 JGI25406J46586_10000156 JGI25406J46586_1000015618 176
20 3300005983 Ga0081540_1144950 Ga0081540_11449502 176
21 3300005985 Ga0081539_10000076 Ga0081539_10000076164 176
22 3300031727 Ga0316576_10075593 Ga0316576_100755933 176
23 3300036712 Ga0316584_0112334 Ga0316584_0112334_510_1127 176
24 3300048904 Ga0496101_0134867 Ga0496101_0134867_428_1066 176
25 3300005545 Ga0070695_100527907 Ga0070695_1005279072 178
26 3300037853 Ga0436364_0766756 Ga0436364_0766756_99_710 178
27 3300048907 Ga0496104_0331743 Ga0496104_0331743_658_1296 178
28 3300044735 Ga0466968_0233620 Ga0466968_0233620_88_699 179
29 3300053087 Ga0500643_035782 Ga0500643_035782_533_1144 179
30 3300002459 JGI24751J29686_10000119 JGI24751J29686_1000011923 180
31 3300002459 JGI24751J29686_10008294 JGI24751J29686_100082943 180
32 3300005295 Ga0065707_10083512 Ga0065707_100835126 180
33 3300005331 Ga0070670_100000047 Ga0070670_10000004752 180
34 3300005331 Ga0070670_100001598 Ga0070670_10000159819 180
35 3300005347 Ga0070668_100000025 Ga0070668_10000002544 180
36 3300005347 Ga0070668_100046041 Ga0070668_1000460413 180
37 3300005347 Ga0070668_100135902 Ga0070668_1001359022 180
38 3300005353 Ga0070669_100000072 Ga0070669_10000007224 180
39 3300005353 Ga0070669_100315348 Ga0070669_1003153482 180
40 3300005355 Ga0070671_100007399 Ga0070671_1000073999 180
41 3300005367 Ga0070667_100000006 Ga0070667_100000006288 180
42 3300005367 Ga0070667_100000188 Ga0070667_1000001889 180
43 3300005367 Ga0070667_100007504 Ga0070667_1000075046 180
44 3300005578 Ga0068854_100759446 Ga0068854_1007594461 180
45 3300005617 Ga0068859_100017970 Ga0068859_1000179704 180
46 3300005617 Ga0068859_100093363 Ga0068859_1000933632 180
47 3300005618 Ga0068864_100000051 Ga0068864_10000005152 180
48 3300005719 Ga0068861_100205684 Ga0068861_1002056842 180
49 3300005841 Ga0068863_100007348 Ga0068863_1000073485 180
50 3300005841 Ga0068863_100060675 Ga0068863_1000606753 180
51 3300005842 Ga0068858_100000969 Ga0068858_1000009699 180
52 3300005843 Ga0068860_100000013 Ga0068860_100000013338 180
53 3300005843 Ga0068860_100000074 Ga0068860_100000074129 180
54 3300005844 Ga0068862_100000036 Ga0068862_10000003691 180
55 3300005844 Ga0068862_100010523 Ga0068862_1000105236 180
56 3300005844 Ga0068862_100282495 Ga0068862_1002824952 180
57 3300006038 Ga0075365_10016285 Ga0075365_100162854 180
58 3300006042 Ga0075368_10022618 Ga0075368_100226183 180
59 3300006048 Ga0075363_100164445 Ga0075363_1001644451 180
60 3300006178 Ga0075367_10010137 Ga0075367_100101375 180
61 3300006178 Ga0075367_10245090 Ga0075367_102450903 180
62 3300006353 Ga0075370_10071310 Ga0075370_100713102 180
63 3300006353 Ga0075370_10331922 Ga0075370_103319221 180
64 3300006880 Ga0075429_100263617 Ga0075429_1002636173 180
65 3300006931 Ga0097620_100017970 Ga0097620_1000179704 180
66 3300006931 Ga0097620_100093362 Ga0097620_1000933624 180
67 3300009094 Ga0111539_10027363 Ga0111539_100273634 180
68 3300009147 Ga0114129_10080638 Ga0114129_100806384 180
69 3300009177 Ga0105248_10001208 Ga0105248_1000120822 180
70 3300009177 Ga0105248_10007006 Ga0105248_100070066 180
71 3300014325 Ga0163163_10109471 Ga0163163_101094712 180
72 3300014326 Ga0157380_10000238 Ga0157380_1000023819 180
73 3300025923 Ga0207681_10000061 Ga0207681_1000006172 180
74 3300025923 Ga0207681_10107379 Ga0207681_101073792 180
75 3300025925 Ga0207650_10000038 Ga0207650_1000003845 180
76 3300025925 Ga0207650_10002143 Ga0207650_100021433 180
77 3300025931 Ga0207644_10000421 Ga0207644_100004219 180
78 3300025941 Ga0207711_10008193 Ga0207711_100081936 180
79 3300025941 Ga0207711_10013715 Ga0207711_100137153 180
80 3300025972 Ga0207668_10000009 Ga0207668_10000009214 180
81 3300025972 Ga0207668_10111344 Ga0207668_101113444 180
82 3300025986 Ga0207658_10000105 Ga0207658_1000010544 180
83 3300025986 Ga0207658_10000145 Ga0207658_1000014571 180
84 3300025986 Ga0207658_10004894 Ga0207658_100048944 180
85 3300026035 Ga0207703_10000420 Ga0207703_1000042035 180
86 3300026088 Ga0207641_10002010 Ga0207641_1000201013 180
87 3300026095 Ga0207676_10000034 Ga0207676_10000034138 180
88 3300026118 Ga0207675_100001428 Ga0207675_1000014285 180
89 3300026118 Ga0207675_100041425 Ga0207675_1000414255 180
90 3300027907 Ga0207428_10102416 Ga0207428_101024163 180
91 3300028380 Ga0268265_10000052 Ga0268265_1000005285 180
92 3300028380 Ga0268265_10001399 Ga0268265_100013993 180
93 3300028381 Ga0268264_10000039 Ga0268264_10000039333 180
94 3300028381 Ga0268264_10000070 Ga0268264_10000070225 180
95 3300031548 Ga0307408_100415084 Ga0307408_1004150842 180
96 3300031852 Ga0307410_10386602 Ga0307410_103866022 180
97 3300031901 Ga0307406_10048986 Ga0307406_100489863 180
98 3300031911 Ga0307412_10007671 Ga0307412_100076714 180
99 3300032005 Ga0307411_10508675 Ga0307411_105086752 180
100 3300034818 Ga0373950_0027485 Ga0373950_0027485_198_845 180
101 3300035118 Ga0373954_0273747 Ga0373954_0273747_197_808 180
102 3300037418 Ga0395900_0176337 Ga0395900_0176337_652_1260 180
103 3300037471 Ga0395905_0316732 Ga0395905_0316732_196_804 180
104 3300044658 Ga0466972_0113673 Ga0466972_0113673_454_1062 180
105 3300044659 Ga0466973_0222980 Ga0466973_0222980_597_1208 180
106 3300048916 Ga0496113_0333294 Ga0496113_0333294_166_807 180
107 3300049513 Ga0501290_010965 Ga0501290_010965_34_645 180
108 3300049515 Ga0501292_000445 Ga0501292_000445_1488_2099 180
109 3300049517 Ga0501294_000687 Ga0501294_000687_2902_3513 180
110 3300049571 Ga0501034_0073901 Ga0501034_0073901_2082_2723 180
111 3300049580 Ga0501046_0593720 Ga0501046_0593720_156_767 180
112 3300049581 Ga0501047_0049043 Ga0501047_0049043_633_1244 180
113 3300049653 Ga0501206_017021 Ga0501206_017021_26_637 180
114 3300049662 Ga0501222_012931 Ga0501222_012931_354_965 180
115 3300049664 Ga0501224_005763 Ga0501224_005763_798_1409 180
116 3300049665 Ga0501227_016389 Ga0501227_016389_1033_1644 180
117 3300049690 Ga0501261_000971 Ga0501261_000971_1527_2138 180
118 3300049775 Ga0501279_000502 Ga0501279_000502_3333_3944 180
119 3300049776 Ga0501280_000525 Ga0501280_000525_5320_5931 180
120 3300049778 Ga0501282_002683 Ga0501282_002683_1137_1748 180
121 3300049779 Ga0501283_017289 Ga0501283_017289_81_692 180
122 3300050490 nmdc:mga03n38_119358_c1 nmdc:mga03n38_119358_c1_603_1247 180
123 3300050490 nmdc:mga03n38_28562_c1 nmdc:mga03n38_28562_c1_1549_2199 180
124 3300050494 nmdc:mga06z11_158351_c1 nmdc:mga06z11_158351_c1_53_697 180
125 3300050494 nmdc:mga06z11_2729_c1 nmdc:mga06z11_2729_c1_255_905 180
126 3300050495 nmdc:mga04h51_59139_c1 nmdc:mga04h51_59139_c1_48_692 180
127 3300050495 nmdc:mga04h51_7819_c1 nmdc:mga04h51_7819_c1_1801_2451 180
128 3300050496 nmdc:mga07m45_329073_c1 nmdc:mga07m45_329073_c1_119_769 180
129 3300050507 nmdc:mga05p37_139365_c1 nmdc:mga05p37_139365_c1_1814_2455 180
130 3300050510 nmdc:mga06r32_126566_c1 nmdc:mga06r32_126566_c1_362_1003 180
131 3300050511 nmdc:mga08y16_78189_c1 nmdc:mga08y16_78189_c1_1029_1670 180
132 3300053116 Ga0500592_000827 Ga0500592_000827_1326_1937 180
133 3300053158 Ga0500627_0002065 Ga0500627_0002065_4772_5383 180
134 3300053158 Ga0500627_0248033 Ga0500627_0248033_145_756 180
135 3300060353 Ga0501082_0168253 Ga0501082_0168253_548_1189 180
136 iso_pu_bacteria 2582581305 2585261904 180
137 iso_pu_bacteria 2643221541 2643730906 180
138 iso_pu_bacteria 2643221605 2644040210 180
139 iso_pu_bacteria 2643221606 2644044441 180
140 iso_pu_bacteria 2643221622 2644126545 180
141 iso_pu_bacteria 2643221671 2644391635 180
142 iso_pu_bacteria 2885429604 2885431406 180
143 iso_pu_bacteria 2928027323 2928028944 180
144 iso_pu_bacteria 2984555340 2984557824 180
145 iso_pu_bacteria 2984564862 2984567810 180
146 iso_pu_bacteria 2990265787 2990266346 180
147 iso_pu_bacteria 2993356040 2993358861 180
148 iso_pu_bacteria 2993693658 2993695861 180
149 3300003911 JGI25405J52794_10014303 JGI25405J52794_100143032 181
150 3300005295 Ga0065707_10133901 Ga0065707_101339012 181
151 3300005578 Ga0068854_100014250 Ga0068854_1000142502 181
152 3300005618 Ga0068864_100003848 Ga0068864_1000038486 181
153 3300005937 Ga0081455_10001182 Ga0081455_1000118220 181
154 3300006038 Ga0075365_10025462 Ga0075365_100254621 181
155 3300006195 Ga0075366_10019421 Ga0075366_100194214 181
156 3300006195 Ga0075366_10035460 Ga0075366_100354602 181
157 3300009094 Ga0111539_10050304 Ga0111539_100503044 181
158 3300009147 Ga0114129_11211094 Ga0114129_112110942 181
159 3300009551 Ga0105238_10041875 Ga0105238_100418755 181
160 3300009553 Ga0105249_10274715 Ga0105249_102747153 181
161 3300014326 Ga0157380_10439914 Ga0157380_104399142 181
162 3300021388 Ga0213875_10036713 Ga0213875_100367131 181
163 3300025924 Ga0207694_10143633 Ga0207694_101436332 181
164 3300025981 Ga0207640_10044496 Ga0207640_100444963 181
165 3300026088 Ga0207641_10000288 Ga0207641_1000028832 181
166 3300026095 Ga0207676_10001201 Ga0207676_1000120114 181
167 3300035241 Ga0373961_0016861 Ga0373961_0016861_851_1498 181
168 3300037853 Ga0436364_0986946 Ga0436364_0986946_193040_193651 181
169 3300039450 Ga0436363_1414565 Ga0436363_1414565_515_1126 181
170 3300041452 Ga0451793_1228122 Ga0451793_1228122_96_707 181
171 3300046455 Ga0495603_0314219 Ga0495603_0314219_213_869 181
172 3300048905 Ga0496102_0301447 Ga0496102_0301447_223_882 181
173 3300048907 Ga0496104_0001212 Ga0496104_0001212_8419_9075 181
174 3300048908 Ga0496105_0033061 Ga0496105_0033061_2323_2979 181
175 3300048911 Ga0496108_0137573 Ga0496108_0137573_389_1039 181
176 3300048913 Ga0496110_0003203 Ga0496110_0003203_9890_10546 181
177 3300048915 Ga0496112_0176585 Ga0496112_0176585_255_908 181
178 3300048916 Ga0496113_0099204 Ga0496113_0099204_145_801 181
179 3300049574 Ga0501038_0212772 Ga0501038_0212772_203_868 181
180 3300050492 nmdc:mga0yw44_114067_c1 nmdc:mga0yw44_114067_c1_801_1493 181
181 3300050494 nmdc:mga06z11_240295_c1 nmdc:mga06z11_240295_c1_194_850 181
182 3300050508 nmdc:mga09592_218694_c1 nmdc:mga09592_218694_c1_769_1410 181
183 3300050510 nmdc:mga06r32_353138_c1 nmdc:mga06r32_353138_c1_523_1164 181
184 3300050511 nmdc:mga08y16_44710_c1 nmdc:mga08y16_44710_c1_2741_3382 181
185 3300005336 Ga0070680_100033247 Ga0070680_1000332473 182
186 3300005337 Ga0070682_100003745 Ga0070682_1000037456 182
187 3300005339 Ga0070660_100011261 Ga0070660_1000112613 182
188 3300005341 Ga0070691_10032323 Ga0070691_100323233 182
189 3300005344 Ga0070661_100623773 Ga0070661_1006237732 182
190 3300005366 Ga0070659_100006341 Ga0070659_1000063416 182
191 3300005441 Ga0070700_100155152 Ga0070700_1001551522 182
192 3300005444 Ga0070694_100019654 Ga0070694_1000196543 182
193 3300005455 Ga0070663_100011513 Ga0070663_1000115135 182
194 3300005456 Ga0070678_100058730 Ga0070678_1000587303 182
195 3300005458 Ga0070681_10047118 Ga0070681_100471183 182
196 3300005459 Ga0068867_100151115 Ga0068867_1001511152 182
197 3300005530 Ga0070679_100037045 Ga0070679_1000370454 182
198 3300005539 Ga0068853_100023821 Ga0068853_1000238214 182
199 3300005539 Ga0068853_100267782 Ga0068853_1002677823 182
200 3300005546 Ga0070696_100025206 Ga0070696_1000252063 182
201 3300005549 Ga0070704_100025883 Ga0070704_1000258833 182
202 3300005563 Ga0068855_100012936 Ga0068855_10001293611 182
203 3300005564 Ga0070664_100232387 Ga0070664_1002323872 182
204 3300005614 Ga0068856_101261294 Ga0068856_1012612941 182
205 3300005615 Ga0070702_100019099 Ga0070702_1000190994 182
206 3300005618 Ga0068864_100249920 Ga0068864_1002499203 182
207 3300005834 Ga0068851_10171090 Ga0068851_101710902 182
208 3300005842 Ga0068858_100055296 Ga0068858_1000552963 182
209 3300006058 Ga0075432_10227997 Ga0075432_102279971 182
210 3300006358 Ga0068871_100204470 Ga0068871_1002044702 182
211 3300009093 Ga0105240_10165920 Ga0105240_101659201 182
212 3300009098 Ga0105245_10424564 Ga0105245_104245641 182
213 3300009148 Ga0105243_10131907 Ga0105243_101319073 182
214 3300009174 Ga0105241_10014507 Ga0105241_100145073 182
215 3300009545 Ga0105237_10041000 Ga0105237_100410004 182
216 3300009551 Ga0105238_10047227 Ga0105238_100472273 182
217 3300009551 Ga0105238_10195740 Ga0105238_101957405 182
218 3300013105 Ga0157369_10230792 Ga0157369_102307923 182
219 3300013297 Ga0157378_10739761 Ga0157378_107397612 182
220 3300013308 Ga0157375_10075900 Ga0157375_100759004 182
221 3300014969 Ga0157376_10219741 Ga0157376_102197413 182
222 3300025904 Ga0207647_10077128 Ga0207647_100771283 182
223 3300025911 Ga0207654_10007580 Ga0207654_100075803 182
224 3300025912 Ga0207707_10041585 Ga0207707_100415853 182
225 3300025919 Ga0207657_10041904 Ga0207657_100419043 182
226 3300025920 Ga0207649_10552694 Ga0207649_105526941 182
227 3300025921 Ga0207652_10033196 Ga0207652_100331963 182
228 3300025921 Ga0207652_10240519 Ga0207652_102405193 182
229 3300025924 Ga0207694_10095805 Ga0207694_100958052 182
230 3300025924 Ga0207694_10226361 Ga0207694_102263612 182
231 3300025927 Ga0207687_10317350 Ga0207687_103173503 182
232 3300025932 Ga0207690_10028704 Ga0207690_100287044 182
233 3300025935 Ga0207709_10089709 Ga0207709_100897093 182
234 3300025945 Ga0207679_10130289 Ga0207679_101302893 182
235 3300025949 Ga0207667_10008339 Ga0207667_100083394 182
236 3300026035 Ga0207703_10041003 Ga0207703_100410034 182
237 3300026041 Ga0207639_10059944 Ga0207639_100599443 182
238 3300026067 Ga0207678_10000104 Ga0207678_1000010412 182
239 3300026075 Ga0207708_10176699 Ga0207708_101766993 182
240 3300026078 Ga0207702_10296284 Ga0207702_102962843 182
241 3300026095 Ga0207676_10391490 Ga0207676_103914903 182
242 3300026121 Ga0207683_10044669 Ga0207683_100446693 182
243 3300027876 Ga0209974_10084779 Ga0209974_100847791 182
244 3300044712 Ga0453684_0012492 Ga0453684_0012492_7758_8366 182
245 3300048903 Ga0496100_0276038 Ga0496100_0276038_495_1154 182
246 3300048905 Ga0496102_0170745 Ga0496102_0170745_1202_1861 182
247 3300048906 Ga0496103_0007374 Ga0496103_0007374_3533_4192 182
248 3300048907 Ga0496104_0017945 Ga0496104_0017945_2076_2735 182
249 3300048908 Ga0496105_0098186 Ga0496105_0098186_894_1553 182
250 3300048909 Ga0496106_0094174 Ga0496106_0094174_889_1548 182
251 3300048910 Ga0496107_0042655 Ga0496107_0042655_1063_1722 182
252 3300048918 Ga0496115_0018167 Ga0496115_0018167_4054_4713 182
253 3300048928 Ga0496125_0388738 Ga0496125_0388738_85_696 182
254 3300002774 JGI25150J39212_1000431 JGI25150J39212_100043113 183
255 3300003771 Ga0055526_1035814 Ga0055526_10358143 183
256 3300003791 Ga0055530_10020955 Ga0055530_100209553 183
257 3300005406 Ga0070703_10085926 Ga0070703_100859262 183
258 3300005616 Ga0068852_100377077 Ga0068852_1003770772 183
259 3300025295 Ga0209564_1001724 Ga0209564_10017243 183
260 3300025949 Ga0207667_11225431 Ga0207667_112254312 183
261 3300048918 Ga0496115_0077838 Ga0496115_0077838_1004_1615 183
262 3300053094 Ga0500566_0063102 Ga0500566_0063102_882_1493 183
263 3300053139 Ga0500568_0214345 Ga0500568_0214345_25_636 183
264 3300053153 Ga0500616_0051260 Ga0500616_0051260_307_918 183
265 3300053153 Ga0500616_0095800 Ga0500616_0095800_366_1016 183
266 3300001904 JGI24736J21556_1013030 JGI24736J21556_10130302 184
267 3300002067 JGI24735J21928_10034446 JGI24735J21928_100344463 184
268 3300003215 JGI25153J46596_10023323 JGI25153J46596_100233233 184
269 3300005262 Ga0065165_1024601 Ga0065165_10246013 184
270 3300005366 Ga0070659_100277558 Ga0070659_1002775582 184
271 3300005457 Ga0070662_100057854 Ga0070662_1000578543 184
272 3300013102 Ga0157371_10245441 Ga0157371_102454412 184
273 3300013307 Ga0157372_11360287 Ga0157372_113602872 184
274 3300025904 Ga0207647_10018443 Ga0207647_100184434 184
275 3300025933 Ga0207706_10032887 Ga0207706_100328873 184
276 3300042005 Ga0439448_0043215 Ga0439448_0043215_25_633 184
277 3300042157 Ga0439458_0011567 Ga0439458_0011567_851_1459 184
278 3300046460 Ga0495638_0146898 Ga0495638_0146898_682_1290 184
279 3300046506 Ga0495583_0000426 Ga0495583_0000426_11895_12503 184
280 3300046648 Ga0495611_0209059 Ga0495611_0209059_67_675 184
281 3300046665 Ga0495661_0296038 Ga0495661_0296038_115_723 184
282 3300047472 Ga0495686_0057081 Ga0495686_0057081_841_1449 184
283 3300053087 Ga0500643_000703 Ga0500643_000703_16101_16712 184
284 3300053103 Ga0500555_012059 Ga0500555_012059_505_1113 184
285 3300053140 Ga0500573_0001876 Ga0500573_0001876_1242_1853 184

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00499

Oxidored_q3

NADH-ubiquinone/plastoquinone oxidoreductase chain 6

17

168

0.88

Feature Viewer

pLDDT pTM Quality
71.38 0.33 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map