F386449

General Info

Members Datasets Scaffolds Average Seq Length
284 169 568 136

Family's Representative Sequence

Representative Sequence 3300049680|Ga0501250_051599|Ga0501250_051599_72_539
Length 155
Sequence VRRADRERRHDRAHRRIAVPDDTIDRAFLGVGWAFPLAGDASGEVNLAAAEEDIRQSVRIILGTAPGERVMRPDFGAGLQALVFEPISATLTALVKHRVEEALVVWEPRIDTITVGVTADPPRGRLLIAIDYRVRATNTFYNLVYPFYLMEGREP

Samples

Sample ID Description Type Environment
1 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
98 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
99 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
100 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
111 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
114 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
115 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
116 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
121 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
122 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
123 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
124 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
125 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
126 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
127 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
128 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
129 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
130 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
131 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
132 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
133 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
134 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
139 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
140 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
141 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
142 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
143 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
152 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
153 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
154 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
155 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
156 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
157 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
165 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
166 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
167 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
168 2643221641 Nocardioides sp. Root122 Isolate Unclassified
169 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.3
Metatranscriptomes 0
Isolates 0.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.63
Rhizosphere 91.9
Stem 0
Stem Tuber 0
Unclassified 16.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501250_051599 3300049680 Bacteria 633
2 rootH1_10134973 3300003323 Bacteria 3172
3 Ga0065707_10207108 3300005295 Bacteria 1283
4 Ga0070658_11512864 3300005327 Bacteria 582
5 Ga0070683_100009786 3300005329 Bacteria 8215
6 Ga0070683_100086360 3300005329 Bacteria 2941
7 Ga0070690_100011081 3300005330 Bacteria 5265
8 Ga0070680_101017198 3300005336 Bacteria 716
9 Ga0070689_100593846 3300005340 Viruses 958
10 Ga0070675_100047516 3300005354 Unclassified 3517
11 Ga0070671_100006085 3300005355 Bacteria 9616
12 Ga0070671_100317516 3300005355 Bacteria 1327
13 Ga0070671_100539706 3300005355 Bacteria 1005
14 Ga0070671_101588146 3300005355 Unclassified 580
15 Ga0070674_100578513 3300005356 Bacteria 946
16 Ga0070674_101028638 3300005356 Bacteria 724
17 Ga0070673_100000353 3300005364 Bacteria 24161
18 Ga0070673_101832345 3300005364 Bacteria 575
19 Ga0070673_101902563 3300005364 Unclassified 564
20 Ga0070659_100185778 3300005366 Bacteria 1707
21 Ga0070659_100668694 3300005366 Bacteria 896
22 Ga0070713_101444400 3300005436 Bacteria 667
23 Ga0070711_100616946 3300005439 Unclassified 906
24 Ga0070708_102008309 3300005445 Bacteria 535
25 Ga0070663_100283275 3300005455 Bacteria 1321
26 Ga0070678_102331994 3300005456 Bacteria 508
27 Ga0070662_100022428 3300005457 Bacteria 4323
28 Ga0070662_100435629 3300005457 Unclassified 1086
29 Ga0070662_100903904 3300005457 Bacteria 753
30 Ga0068867_101935581 3300005459 Unclassified 556
31 Ga0070685_10155119 3300005466 Bacteria 1454
32 Ga0070707_100001707 3300005468 Bacteria 21190
33 Ga0070679_100029711 3300005530 Bacteria 5392
34 Ga0070684_100002519 3300005535 Bacteria 13508
35 Ga0070684_100211569 3300005535 Viruses 1767
36 Ga0070672_100009589 3300005543 Bacteria 6680
37 Ga0070672_100057922 3300005543 Unclassified 3043
38 Ga0070672_100103516 3300005543 Bacteria 2312
39 Ga0070672_100885539 3300005543 Bacteria 788
40 Ga0070686_100000343 3300005544 Bacteria 30108
41 Ga0070686_100098169 3300005544 Bacteria 1973
42 Ga0070686_101081446 3300005544 Bacteria 661
43 Ga0070665_101226177 3300005548 Viruses 761
44 Ga0070704_102145324 3300005549 Unclassified 519
45 Ga0068855_100322865 3300005563 Bacteria 1706
46 Ga0068855_100753485 3300005563 Bacteria 1038
47 Ga0070664_100038338 3300005564 Bacteria 4033
48 Ga0070664_100184591 3300005564 Bacteria 1855
49 Ga0070664_101716019 3300005564 Bacteria 595
50 Ga0070702_100916093 3300005615 Unclassified 687
51 Ga0070702_101389292 3300005615 Unclassified 574
52 Ga0070702_101455013 3300005615 Viruses 562
53 Ga0068852_100505991 3300005616 Bacteria 1203
54 Ga0068859_100169036 3300005617 Bacteria 2267
55 Ga0068859_100702298 3300005617 Bacteria 1102
56 Ga0068864_100044916 3300005618 Bacteria 3789
57 Ga0068861_100008623 3300005719 Bacteria 7008
58 Ga0068870_11139014 3300005840 Unclassified 562
59 Ga0068858_100163093 3300005842 Bacteria 2099
60 Ga0068860_100134734 3300005843 Bacteria 2372
61 Ga0068860_100555235 3300005843 Bacteria 1151
62 Ga0068862_101547260 3300005844 Bacteria 669
63 Ga0070712_100232652 3300006175 Bacteria 1464
64 Ga0068871_100116736 3300006358 Bacteria 2250
65 Ga0068871_100835923 3300006358 Bacteria 851
66 Ga0068871_101690162 3300006358 Bacteria 600
67 Ga0075428_100001043 3300006844 Bacteria 29404
68 Ga0075428_100421322 3300006844 Archaea 1430
69 Ga0075430_100000500 3300006846 Bacteria 29427
70 Ga0075430_100007778 3300006846 Bacteria 9053
71 Ga0075430_100204232 3300006846 Viruses 1640
72 Ga0075430_100445715 3300006846 Viruses 1068
73 Ga0075431_100000610 3300006847 Bacteria 30160
74 Ga0075431_100072216 3300006847 Archaea 3561
75 Ga0075431_100085880 3300006847 Bacteria 3248
76 Ga0075433_10309450 3300006852 Viruses 1398
77 Ga0075433_10836711 3300006852 Bacteria 803
78 Ga0075434_100048368 3300006871 Bacteria 4220
79 Ga0075434_100195914 3300006871 Bacteria 2040
80 Ga0075434_101418669 3300006871 Bacteria 704
81 Ga0075429_100000290 3300006880 Bacteria 35432
82 Ga0075429_100030796 3300006880 Viruses 4662
83 Ga0075429_100177409 3300006880 Bacteria 1867
84 Ga0097620_100169037 3300006931 Bacteria 2267
85 Ga0097620_100702285 3300006931 Bacteria 1102
86 Ga0075435_100602851 3300007076 Bacteria 952
87 Ga0105240_10302733 3300009093 Unclassified 1828
88 Ga0105240_10586210 3300009093 Bacteria 1229
89 Ga0105240_11823448 3300009093 Bacteria 634
90 Ga0111539_10000518 3300009094 Bacteria 48829
91 Ga0111539_10326583 3300009094 Bacteria 1786
92 Ga0111539_10378483 3300009094 Unclassified 1648
93 Ga0111539_11562080 3300009094 Bacteria 765
94 Ga0114129_10001739 3300009147 Bacteria 29644
95 Ga0114129_10574385 3300009147 Unclassified 1464
96 Ga0105243_10175356 3300009148 Bacteria 1860
97 Ga0105248_10007541 3300009177 Bacteria 11946
98 Ga0105248_10091673 3300009177 Bacteria 3422
99 Ga0105248_10624717 3300009177 Unclassified 1215
100 Ga0105248_10697497 3300009177 Bacteria 1145
101 Ga0105237_10136195 3300009545 Bacteria 2450
102 Ga0105249_12678057 3300009553 Bacteria 571
103 Ga0157373_11463771 3300013100 Bacteria 521
104 Ga0157369_10205031 3300013105 Viruses 2068
105 Ga0157374_12402382 3300013296 Unclassified 554
106 Ga0157378_13284590 3300013297 Unclassified 502
107 Ga0157375_10389414 3300013308 Bacteria 1561
108 Ga0163163_10557481 3300014325 Bacteria 1208
109 Ga0157377_10920323 3300014745 Bacteria 655
110 Ga0213875_10229114 3300021388 Bacteria 875
111 Ga0207707_10013864 3300025912 Bacteria 7030
112 Ga0207695_10062374 3300025913 Bacteria 3848
113 Ga0207695_10366727 3300025913 Bacteria 1326
114 Ga0207693_10228111 3300025915 Bacteria 1463
115 Ga0207660_10954922 3300025917 Bacteria 699
116 Ga0207652_11579905 3300025921 Bacteria 560
117 Ga0207681_10519327 3300025923 Bacteria 977
118 Ga0207681_11418472 3300025923 Viruses 583
119 Ga0207659_10439783 3300025926 Bacteria 1097
120 Ga0207700_11102538 3300025928 Bacteria 710
121 Ga0207644_10023326 3300025931 Bacteria 4237
122 Ga0207644_10508948 3300025931 Unclassified 994
123 Ga0207690_10191236 3300025932 Bacteria 1548
124 Ga0207690_10544615 3300025932 Bacteria 943
125 Ga0207706_10036430 3300025933 Bacteria 4370
126 Ga0207706_10079494 3300025933 Bacteria 2884
127 Ga0207709_10286928 3300025935 Bacteria 1218
128 Ga0207669_10185039 3300025937 Bacteria 1497
129 Ga0207704_10986876 3300025938 Unclassified 712
130 Ga0207691_10073872 3300025940 Unclassified 3076
131 Ga0207691_10447540 3300025940 Bacteria 1099
132 Ga0207711_10028888 3300025941 Bacteria 4671
133 Ga0207711_10092443 3300025941 Bacteria 2662
134 Ga0207711_10276284 3300025941 Bacteria 1546
135 Ga0207689_10449169 3300025942 Bacteria 1077
136 Ga0207661_10061822 3300025944 Bacteria 3027
137 Ga0207661_10292480 3300025944 Unclassified 1458
138 Ga0207661_10451417 3300025944 Bacteria 1171
139 Ga0207679_10025985 3300025945 Bacteria 4033
140 Ga0207679_10228118 3300025945 Bacteria 1570
141 Ga0207679_11427422 3300025945 Bacteria 635
142 Ga0207667_10239031 3300025949 Bacteria 1859
143 Ga0207667_10960911 3300025949 Bacteria 843
144 Ga0207667_11100155 3300025949 Viruses 778
145 Ga0207651_10011473 3300025960 Bacteria 4963
146 Ga0207651_10662764 3300025960 Bacteria 917
147 Ga0207640_11671608 3300025981 Unclassified 574
148 Ga0207703_10117899 3300026035 Bacteria 2275
149 Ga0207703_10980558 3300026035 Bacteria 811
150 Ga0207676_10035359 3300026095 Bacteria 3791
151 Ga0207676_10379338 3300026095 Bacteria 1316
152 Ga0207675_100094862 3300026118 Bacteria 2807
153 Ga0207683_11160766 3300026121 Unclassified 716
154 Ga0207683_11905704 3300026121 Bacteria 543
155 Ga0207698_10236429 3300026142 Bacteria 1662
156 Ga0207698_11498260 3300026142 Unclassified 690
157 Ga0268266_11056360 3300028379 Viruses 786
158 Ga0268265_10242676 3300028380 Bacteria 1591
159 Ga0268265_11720243 3300028380 Bacteria 633
160 Ga0268264_10218333 3300028381 Bacteria 1754
161 Ga0268264_10503331 3300028381 Bacteria 1182
162 Ga0268264_10600805 3300028381 Bacteria 1084
163 Ga0265336_10119541 3300028666 Unclassified 785
164 Ga0307408_100088769 3300031548 Bacteria 2329
165 Ga0307408_100114166 3300031548 Unclassified 2080
166 Ga0316576_10007605 3300031727 Bacteria 6836
167 Ga0316576_10546195 3300031727 Bacteria 849
168 Ga0307405_10045155 3300031731 Viruses 2698
169 Ga0307405_10098794 3300031731 Bacteria 1952
170 Ga0307405_10119253 3300031731 Bacteria 1802
171 Ga0307405_11413747 3300031731 Bacteria 609
172 Ga0307405_12045447 3300031731 Unclassified 513
173 Ga0307413_10036964 3300031824 Bacteria 2816
174 Ga0307413_10060594 3300031824 Bacteria 2330
175 Ga0307413_10662576 3300031824 Unclassified 862
176 Ga0307410_10000061 3300031852 Bacteria 38521
177 Ga0307410_10005753 3300031852 Bacteria 6606
178 Ga0307410_10039461 3300031852 Bacteria 3100
179 Ga0307410_10043115 3300031852 Unclassified 2988
180 Ga0307406_10000301 3300031901 Bacteria 29054
181 Ga0307406_10014853 3300031901 Bacteria 4489
182 Ga0307407_10001350 3300031903 Bacteria 8824
183 Ga0307407_10013866 3300031903 Bacteria 3926
184 Ga0307407_10025699 3300031903 Bacteria 3107
185 Ga0307412_10088325 3300031911 Bacteria 2162
186 Ga0307409_100000092 3300031995 Bacteria 32386
187 Ga0307409_100059855 3300031995 Bacteria 2966
188 Ga0307409_100611254 3300031995 Bacteria 1078
189 Ga0307416_100000101 3300032002 Bacteria 53409
190 Ga0307416_100020347 3300032002 Bacteria 4733
191 Ga0307416_100046881 3300032002 Bacteria 3415
192 Ga0307416_102003052 3300032002 Bacteria 682
193 Ga0307414_10020022 3300032004 Bacteria 4160
194 Ga0307415_100000251 3300032126 Bacteria 23221
195 Ga0307415_100009586 3300032126 Bacteria 5439
196 Ga0307415_100113586 3300032126 Bacteria 2014
197 Ga0307415_100163946 3300032126 Bacteria 1726
198 Ga0307415_101188774 3300032126 Unclassified 718
199 Ga0373943_0323798 3300035170 Bacteria 879
200 Ga0373947_0198799 3300035725 Bacteria 1311
201 Ga0316582_0020473 3300036647 Bacteria 3890
202 Ga0316584_0233341 3300036712 Bacteria 1348
203 Ga0316584_0355353 3300036712 Bacteria 1051
204 Ga0395898_0846829 3300037466 Unclassified 854
205 Ga0436364_0564431 3300037853 Bacteria 4919
206 Ga0451807_0096793 3300041486 Unclassified 1297
207 Ga0453683_0055321 3300044673 Unclassified 2484
208 Ga0466963_0158644 3300044694 Bacteria 1574
209 Ga0466963_0858646 3300044694 Bacteria 640
210 Ga0451576_0947006 3300045051 Bacteria 903
211 Ga0466958_0913147 3300045836 Bacteria 573
212 Ga0466967_0438839 3300045976 Unclassified 1275
213 Ga0466967_0569232 3300045976 Bacteria 1116
214 Ga0466967_2570738 3300045976 Unclassified 504
215 Ga0495641_0158783 3300046461 Unclassified 1011
216 Ga0495651_0993243 3300046462 Bacteria 510
217 Ga0495652_0209286 3300046529 Bacteria 1474
218 Ga0495640_0438221 3300046533 Bacteria 799
219 Ga0495621_0025549 3300046539 Bacteria 1985
220 Ga0495621_0355618 3300046539 Unclassified 615
221 Ga0495625_0017717 3300046660 Bacteria 5571
222 Ga0495599_0057755 3300046678 Bacteria 2428
223 Ga0495604_0917986 3300047317 Bacteria 546
224 Ga0495674_0022584 3300047319 Bacteria 5801
225 Ga0495680_0147269 3300047322 Bacteria 1719
226 Ga0496100_1189375 3300048903 Unclassified 601
227 Ga0496101_0234593 3300048904 Unclassified 1427
228 Ga0496103_0004116 3300048906 Bacteria 8829
229 Ga0496106_0297082 3300048909 Unclassified 1295
230 Ga0496108_0242692 3300048911 Unclassified 1567
231 Ga0496108_0247377 3300048911 Bacteria 1551
232 Ga0496109_0555038 3300048912 Bacteria 1084
233 Ga0496109_0617004 3300048912 Unclassified 1021
234 Ga0496110_0311818 3300048913 Bacteria 1433
235 Ga0496110_0875433 3300048913 Bacteria 804
236 Ga0496112_0000811 3300048915 Bacteria 22087
237 Ga0496112_0061574 3300048915 Bacteria 3700
238 Ga0496113_0003545 3300048916 Bacteria 9362
239 Ga0496114_0017430 3300048917 Bacteria 5797
240 Ga0496115_0013558 3300048918 Bacteria 6168
241 Ga0496117_0002332 3300048920 Bacteria 24283
242 Ga0496118_0000126 3300048921 Bacteria 135644
243 Ga0501033_0091407 3300049570 Unclassified 2226
244 Ga0501036_0027465 3300049572 Bacteria 4809
245 Ga0501038_0074470 3300049574 Bacteria 2872
246 Ga0501039_0008791 3300049575 Bacteria 7695
247 Ga0501039_0907343 3300049575 Bacteria 686
248 Ga0501041_0058482 3300049577 Unclassified 2358
249 Ga0501042_0056379 3300049578 Bacteria 2804
250 Ga0501072_0010043 3300049588 Bacteria 7203
251 Ga0501074_0111718 3300049590 Bacteria 1955
252 Ga0501075_0000265 3300049591 Bacteria 28570
253 Ga0501076_0000132 3300049592 Bacteria 41750
254 Ga0501077_0129139 3300049593 Unclassified 1602
255 Ga0501079_0076307 3300049741 Bacteria 2592
256 Ga0501080_0081087 3300049742 Bacteria 3015
257 Ga0501081_0034776 3300049743 Bacteria 3429
258 Ga0501083_0113611 3300049744 Bacteria 1779
259 nmdc:mga05p37_1208_c1 3300050507 Bacteria 29907
260 nmdc:mga05p37_1561_c1 3300050507 Bacteria 26611
261 nmdc:mga09592_127038_c1 3300050508 Archaea 2192
262 nmdc:mga09592_202321_c1 3300050508 Bacteria 1720
263 nmdc:mga09592_296_c1 3300050508 Bacteria 36100
264 nmdc:mga0qj67_333_c1 3300050509 Bacteria 32503
265 nmdc:mga0qj67_490100_c1 3300050509 Unclassified 988
266 nmdc:mga0qj67_610862_c1 3300050509 Viruses 872
267 nmdc:mga0qj67_922108_c1 3300050509 Viruses 688
268 nmdc:mga06r32_230581_c1 3300050510 Archaea 1840
269 nmdc:mga06r32_426_c1 3300050510 Bacteria 35460
270 nmdc:mga06r32_65121_c1 3300050510 Bacteria 3515
271 nmdc:mga08y16_1066363_c1 3300050511 Bacteria 785
272 nmdc:mga08y16_163_c1 3300050511 Bacteria 57931
273 nmdc:mga08y16_248070_c1 3300050511 Bacteria 1840
274 nmdc:mga08y16_384037_c1 3300050511 Bacteria 1439
275 nmdc:mga08y16_516784_c1 3300050511 Unclassified 1211
276 nmdc:mga0n895_184271_c1 3300050512 Bacteria 2119
277 nmdc:mga0n895_60078_c1 3300050512 Bacteria 3750
278 nmdc:mga0a205_748719_c1 3300050515 Bacteria 826
279 Ga0501084_0003024 3300054114 Bacteria 13623
280 Ga0501084_1501627 3300054114 Bacteria 564
281 Ga0501082_0003636 3300060353 Bacteria 13469
282 Ga0530510_0000011 3300061734 Bacteria 125603
283 2644228924 2643221641 Bacteria 4490190
284 2691329830 2690315857 Bacteria 4396207
285 Ga0501250_051599
286 rootH1_10134973
287 Ga0065707_10207108
288 Ga0070658_11512864
289 Ga0070683_100009786
290 Ga0070683_100086360
291 Ga0070690_100011081
292 Ga0070680_101017198
293 Ga0070689_100593846
294 Ga0070675_100047516
295 Ga0070671_100006085
296 Ga0070671_100317516
297 Ga0070671_100539706
298 Ga0070671_101588146
299 Ga0070674_100578513
300 Ga0070674_101028638
301 Ga0070673_100000353
302 Ga0070673_101832345
303 Ga0070673_101902563
304 Ga0070659_100185778
305 Ga0070659_100668694
306 Ga0070713_101444400
307 Ga0070711_100616946
308 Ga0070708_102008309
309 Ga0070663_100283275
310 Ga0070678_102331994
311 Ga0070662_100022428
312 Ga0070662_100435629
313 Ga0070662_100903904
314 Ga0068867_101935581
315 Ga0070685_10155119
316 Ga0070707_100001707
317 Ga0070679_100029711
318 Ga0070684_100002519
319 Ga0070684_100211569
320 Ga0070672_100009589
321 Ga0070672_100057922
322 Ga0070672_100103516
323 Ga0070672_100885539
324 Ga0070686_100000343
325 Ga0070686_100098169
326 Ga0070686_101081446
327 Ga0070665_101226177
328 Ga0070704_102145324
329 Ga0068855_100322865
330 Ga0068855_100753485
331 Ga0070664_100038338
332 Ga0070664_100184591
333 Ga0070664_101716019
334 Ga0070702_100916093
335 Ga0070702_101389292
336 Ga0070702_101455013
337 Ga0068852_100505991
338 Ga0068859_100169036
339 Ga0068859_100702298
340 Ga0068864_100044916
341 Ga0068861_100008623
342 Ga0068870_11139014
343 Ga0068858_100163093
344 Ga0068860_100134734
345 Ga0068860_100555235
346 Ga0068862_101547260
347 Ga0070712_100232652
348 Ga0068871_100116736
349 Ga0068871_100835923
350 Ga0068871_101690162
351 Ga0075428_100001043
352 Ga0075428_100421322
353 Ga0075430_100000500
354 Ga0075430_100007778
355 Ga0075430_100204232
356 Ga0075430_100445715
357 Ga0075431_100000610
358 Ga0075431_100072216
359 Ga0075431_100085880
360 Ga0075433_10309450
361 Ga0075433_10836711
362 Ga0075434_100048368
363 Ga0075434_100195914
364 Ga0075434_101418669
365 Ga0075429_100000290
366 Ga0075429_100030796
367 Ga0075429_100177409
368 Ga0097620_100169037
369 Ga0097620_100702285
370 Ga0075435_100602851
371 Ga0105240_10302733
372 Ga0105240_10586210
373 Ga0105240_11823448
374 Ga0111539_10000518
375 Ga0111539_10326583
376 Ga0111539_10378483
377 Ga0111539_11562080
378 Ga0114129_10001739
379 Ga0114129_10574385
380 Ga0105243_10175356
381 Ga0105248_10007541
382 Ga0105248_10091673
383 Ga0105248_10624717
384 Ga0105248_10697497
385 Ga0105237_10136195
386 Ga0105249_12678057
387 Ga0157373_11463771
388 Ga0157369_10205031
389 Ga0157374_12402382
390 Ga0157378_13284590
391 Ga0157375_10389414
392 Ga0163163_10557481
393 Ga0157377_10920323
394 Ga0213875_10229114
395 Ga0207707_10013864
396 Ga0207695_10062374
397 Ga0207695_10366727
398 Ga0207693_10228111
399 Ga0207660_10954922
400 Ga0207652_11579905
401 Ga0207681_10519327
402 Ga0207681_11418472
403 Ga0207659_10439783
404 Ga0207700_11102538
405 Ga0207644_10023326
406 Ga0207644_10508948
407 Ga0207690_10191236
408 Ga0207690_10544615
409 Ga0207706_10036430
410 Ga0207706_10079494
411 Ga0207709_10286928
412 Ga0207669_10185039
413 Ga0207704_10986876
414 Ga0207691_10073872
415 Ga0207691_10447540
416 Ga0207711_10028888
417 Ga0207711_10092443
418 Ga0207711_10276284
419 Ga0207689_10449169
420 Ga0207661_10061822
421 Ga0207661_10292480
422 Ga0207661_10451417
423 Ga0207679_10025985
424 Ga0207679_10228118
425 Ga0207679_11427422
426 Ga0207667_10239031
427 Ga0207667_10960911
428 Ga0207667_11100155
429 Ga0207651_10011473
430 Ga0207651_10662764
431 Ga0207640_11671608
432 Ga0207703_10117899
433 Ga0207703_10980558
434 Ga0207676_10035359
435 Ga0207676_10379338
436 Ga0207675_100094862
437 Ga0207683_11160766
438 Ga0207683_11905704
439 Ga0207698_10236429
440 Ga0207698_11498260
441 Ga0268266_11056360
442 Ga0268265_10242676
443 Ga0268265_11720243
444 Ga0268264_10218333
445 Ga0268264_10503331
446 Ga0268264_10600805
447 Ga0265336_10119541
448 Ga0307408_100088769
449 Ga0307408_100114166
450 Ga0316576_10007605
451 Ga0316576_10546195
452 Ga0307405_10045155
453 Ga0307405_10098794
454 Ga0307405_10119253
455 Ga0307405_11413747
456 Ga0307405_12045447
457 Ga0307413_10036964
458 Ga0307413_10060594
459 Ga0307413_10662576
460 Ga0307410_10000061
461 Ga0307410_10005753
462 Ga0307410_10039461
463 Ga0307410_10043115
464 Ga0307406_10000301
465 Ga0307406_10014853
466 Ga0307407_10001350
467 Ga0307407_10013866
468 Ga0307407_10025699
469 Ga0307412_10088325
470 Ga0307409_100000092
471 Ga0307409_100059855
472 Ga0307409_100611254
473 Ga0307416_100000101
474 Ga0307416_100020347
475 Ga0307416_100046881
476 Ga0307416_102003052
477 Ga0307414_10020022
478 Ga0307415_100000251
479 Ga0307415_100009586
480 Ga0307415_100113586
481 Ga0307415_100163946
482 Ga0307415_101188774
483 Ga0373943_0323798
484 Ga0373947_0198799
485 Ga0316582_0020473
486 Ga0316584_0233341
487 Ga0316584_0355353
488 Ga0395898_0846829
489 Ga0436364_0564431
490 Ga0451807_0096793
491 Ga0453683_0055321
492 Ga0466963_0158644
493 Ga0466963_0858646
494 Ga0451576_0947006
495 Ga0466958_0913147
496 Ga0466967_0438839
497 Ga0466967_0569232
498 Ga0466967_2570738
499 Ga0495641_0158783
500 Ga0495651_0993243
501 Ga0495652_0209286
502 Ga0495640_0438221
503 Ga0495621_0025549
504 Ga0495621_0355618
505 Ga0495625_0017717
506 Ga0495599_0057755
507 Ga0495604_0917986
508 Ga0495674_0022584
509 Ga0495680_0147269
510 Ga0496100_1189375
511 Ga0496101_0234593
512 Ga0496103_0004116
513 Ga0496106_0297082
514 Ga0496108_0242692
515 Ga0496108_0247377
516 Ga0496109_0555038
517 Ga0496109_0617004
518 Ga0496110_0311818
519 Ga0496110_0875433
520 Ga0496112_0000811
521 Ga0496112_0061574
522 Ga0496113_0003545
523 Ga0496114_0017430
524 Ga0496115_0013558
525 Ga0496117_0002332
526 Ga0496118_0000126
527 Ga0501033_0091407
528 Ga0501036_0027465
529 Ga0501038_0074470
530 Ga0501039_0008791
531 Ga0501039_0907343
532 Ga0501041_0058482
533 Ga0501042_0056379
534 Ga0501072_0010043
535 Ga0501074_0111718
536 Ga0501075_0000265
537 Ga0501076_0000132
538 Ga0501077_0129139
539 Ga0501079_0076307
540 Ga0501080_0081087
541 Ga0501081_0034776
542 Ga0501083_0113611
543 nmdc:mga05p37_1208_c1
544 nmdc:mga05p37_1561_c1
545 nmdc:mga09592_127038_c1
546 nmdc:mga09592_202321_c1
547 nmdc:mga09592_296_c1
548 nmdc:mga0qj67_333_c1
549 nmdc:mga0qj67_490100_c1
550 nmdc:mga0qj67_610862_c1
551 nmdc:mga0qj67_922108_c1
552 nmdc:mga06r32_230581_c1
553 nmdc:mga06r32_426_c1
554 nmdc:mga06r32_65121_c1
555 nmdc:mga08y16_1066363_c1
556 nmdc:mga08y16_163_c1
557 nmdc:mga08y16_248070_c1
558 nmdc:mga08y16_384037_c1
559 nmdc:mga08y16_516784_c1
560 nmdc:mga0n895_184271_c1
561 nmdc:mga0n895_60078_c1
562 nmdc:mga0a205_748719_c1
563 Ga0501084_0003024
564 Ga0501084_1501627
565 Ga0501082_0003636
566 Ga0530510_0000011
567 2644228924
568 2691329830

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04965

GPW_gp25

Baseplate wedge protein gp25

48

139

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5iw9-assembly1.cif.gz_B structure of bacteriophage t4 gp25, sheath polymerization initiator 0.9089 38 118
6j0n-assembly1.cif.gz_D cryo-em structure of an extracellular contractile injection system, baseplate in extended state, refined in c6 symmetry 0.8799 7 119
6gj1-assembly1.cif.gz_D the baseplate complex from the type vi secretion system 0.815 38 124
8d05-assembly1.cif.gz_A-2 hallucinated c2 protein assembly halc2_065 0.8124 99 117
6rao-assembly1.cif.gz_H cryo-em structure of the anti-feeding prophage (afp) baseplate, 6-fold symmetrised 0.8042 9 126
ID Description Score Start End Superfamily
5iw9B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9095 38 118 3.10.450.40
2ia7A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7673 32 123 3.10.450.40
af_P39375_19_108_3.10.450.40 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7657 64 118 3.10.450.40
af_O01584_103_363_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7496 83 118 3.40.50.1820
af_A0A0N4SUK7_5_137_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7006 95 114 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A6J4JY87-F1-model_v4 IraD/Gp25-like domain-containing protein 0.9759 17 92
AF-A0A524GYU7-F1-model_v4 Baseplate protein 0.9713 10 91
AF-A0A524GKG0-F1-model_v4 IraD/Gp25-like domain-containing protein 0.9669 14 90
AF-A0A3D2C224-F1-model_v4 IraD/Gp25-like domain-containing protein 0.9655 10 96
AF-A0A1Q7Z6P2-F1-model_v4 IraD/Gp25-like domain-containing protein 0.9633 8 104

Map