F386357

General Info

Members Datasets Scaffolds Average Seq Length
284 167 284 76

Family's Representative Sequence

Representative Sequence 3300045836|Ga0466958_0011469|Ga0466958_0011469_2063_2335
Length 90
Sequence MPQAIVSHATKGRMMGSQETGQTTGTKDKDYNLLWFTEQSLSNVLRLETYIEDAERDGDSELADFFRRAQEASRRGGEQGKEQLRKRLAA

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
64 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
65 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
66 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
96 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
97 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
98 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
102 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
103 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
108 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
109 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
110 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
111 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
112 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
113 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
114 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
115 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
116 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
117 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
118 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
119 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
120 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
121 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
122 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
123 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
124 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
129 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
130 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
131 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
132 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
133 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
134 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
135 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
136 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
137 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
138 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
158 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
159 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
160 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
161 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
162 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
163 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
164 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
165 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
166 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
167 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.18
Metatranscriptomes 2.82
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.7
Nodule 0
Rhizoplane 9.15
Rhizosphere 82.04
Stem 0
Stem Tuber 0
Unclassified 8.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000010 3300001977 Bacteria 18578
2 JGI24751J29686_10054428 3300002459 Bacteria 825
3 Ga0070683_100000534 3300005329 Bacteria 26797
4 Ga0070683_100042035 3300005329 Bacteria 4208
5 Ga0070683_100066423 3300005329 Bacteria 3360
6 Ga0070683_100609905 3300005329 Bacteria 1045
7 Ga0070683_101711816 3300005329 Bacteria 605
8 Ga0070670_100012696 3300005331 Bacteria 7212
9 Ga0070677_10000016 3300005333 Bacteria 52044
10 Ga0070682_100000011 3300005337 Bacteria 266253
11 Ga0068868_100000634 3300005338 Bacteria 23652
12 Ga0068868_100003834 3300005338 Bacteria 10495
13 Ga0070689_100035506 3300005340 Bacteria 3809
14 Ga0070661_100000004 3300005344 Bacteria 243876
15 Ga0070692_10249464 3300005345 Bacteria 1062
16 Ga0070668_100229753 3300005347 Bacteria 1533
17 Ga0070675_100000078 3300005354 Bacteria 56469
18 Ga0070688_100000705 3300005365 Bacteria 16441
19 Ga0070688_100000989 3300005365 Bacteria 14241
20 Ga0070688_100038370 3300005365 Bacteria 2925
21 Ga0070714_100056443 3300005435 Bacteria 3359
22 Ga0070714_101418106 3300005435 Bacteria 678
23 Ga0070711_101980285 3300005439 Bacteria 512
24 Ga0070663_100255156 3300005455 Bacteria 1389
25 Ga0070678_100758567 3300005456 Bacteria 878
26 Ga0070685_10000012 3300005466 Bacteria 128823
27 Ga0070685_10001134 3300005466 Bacteria 14241
28 Ga0070685_10009582 3300005466 Bacteria 5009
29 Ga0070679_100434295 3300005530 Bacteria 1258
30 Ga0070684_100010265 3300005535 Bacteria 7413
31 Ga0070684_100108799 3300005535 Bacteria 2484
32 Ga0070684_100299780 3300005535 Bacteria 1475
33 Ga0068853_100489064 3300005539 Bacteria 1161
34 Ga0070672_100000049 3300005543 Bacteria 52233
35 Ga0070693_100000307 3300005547 Bacteria 22748
36 Ga0070664_100107085 3300005564 Bacteria 2437
37 Ga0070664_100391299 3300005564 Bacteria 1270
38 Ga0068854_100000062 3300005578 Bacteria 78159
39 Ga0068856_100000377 3300005614 Bacteria 48877
40 Ga0068856_100007632 3300005614 Bacteria 10556
41 Ga0068852_100000022 3300005616 Bacteria 125196
42 Ga0068864_100000023 3300005618 Bacteria 257064
43 Ga0068851_10000297 3300005834 Bacteria 22748
44 Ga0068870_10060649 3300005840 Bacteria 2031
45 Ga0081538_10003665 3300005981 Bacteria 14434
46 Ga0081538_10021381 3300005981 Bacteria 4725
47 Ga0070717_10655261 3300006028 Bacteria 953
48 Ga0070715_10494277 3300006163 Bacteria 699
49 Ga0070716_100596321 3300006173 Bacteria 830
50 Ga0075370_10446601 3300006353 Bacteria 778
51 Ga0075428_100022919 3300006844 Bacteria 6911
52 Ga0075428_100153368 3300006844 Bacteria 2503
53 Ga0075428_101071749 3300006844 Bacteria 852
54 Ga0075428_101910052 3300006844 Bacteria 617
55 Ga0075430_100041528 3300006846 Bacteria 3891
56 Ga0075430_100207375 3300006846 Bacteria 1627
57 Ga0075431_100046387 3300006847 Bacteria 4481
58 Ga0075431_100181733 3300006847 Bacteria 2158
59 Ga0075429_100001934 3300006880 Bacteria 17175
60 Ga0075429_101567087 3300006880 Bacteria 573
61 Ga0075429_101662113 3300006880 Bacteria 555
62 Ga0068865_100000135 3300006881 Bacteria 38521
63 Ga0068865_101203008 3300006881 Unclassified 671
64 Ga0111539_10511488 3300009094 Bacteria 1399
65 Ga0105245_10004839 3300009098 Bacteria 11864
66 Ga0114129_10371040 3300009147 Bacteria 1891
67 Ga0114129_11619702 3300009147 Bacteria 792
68 Ga0114129_13302564 3300009147 Unclassified 522
69 Ga0105243_10032044 3300009148 Bacteria 4057
70 Ga0105243_12570181 3300009148 Bacteria 549
71 Ga0105248_12549506 3300009177 Bacteria 583
72 Ga0099796_10298833 3300010159 Bacteria 682
73 Ga0105239_10048810 3300010375 Bacteria 4641
74 Ga0105239_10118827 3300010375 Bacteria 2934
75 Ga0157342_1031294 3300012507 Bacteria 671
76 Ga0157371_10004879 3300013102 Bacteria 11527
77 Ga0157370_10245860 3300013104 Bacteria 1655
78 Ga0157369_10000014 3300013105 Bacteria 266411
79 Ga0157378_10001375 3300013297 Bacteria 21833
80 Ga0157378_12565241 3300013297 Bacteria 562
81 Ga0163162_10571135 3300013306 Bacteria 1258
82 Ga0157372_10000550 3300013307 Bacteria 41234
83 Ga0157372_10902846 3300013307 Bacteria 1025
84 Ga0163163_10796426 3300014325 Bacteria 1008
85 Ga0157380_10807002 3300014326 Bacteria 956
86 Ga0157376_10008488 3300014969 Bacteria 7417
87 Ga0197907_10402958 3300020069 Bacteria 501
88 Ga0206356_10730229 3300020070 Bacteria 528
89 Ga0206356_11112838 3300020070 Bacteria 4456
90 Ga0206356_11522892 3300020070 Bacteria 541
91 Ga0206350_11222552 3300020080 Bacteria 736
92 Ga0206354_11508322 3300020081 Bacteria 828
93 Ga0206353_11526258 3300020082 Bacteria 1969
94 Ga0213874_10002023 3300021377 Bacteria 4284
95 Ga0213874_10467397 3300021377 Bacteria 500
96 Ga0213876_10015706 3300021384 Bacteria 4007
97 Ga0213876_10039437 3300021384 Bacteria 2495
98 Ga0213876_10663072 3300021384 Bacteria 555
99 Ga0213875_10008642 3300021388 Bacteria 5201
100 Ga0213875_10012434 3300021388 Bacteria 4207
101 Ga0224712_10003498 3300022467 Bacteria 4092
102 Ga0207656_10000084 3300025321 Bacteria 35284
103 Ga0207682_10000008 3300025893 Bacteria 87020
104 Ga0207654_10514160 3300025911 Bacteria 847
105 Ga0207649_10000003 3300025920 Bacteria 388908
106 Ga0207652_10800946 3300025921 Bacteria 837
107 Ga0207650_10052709 3300025925 Bacteria 3014
108 Ga0207659_10000018 3300025926 Bacteria 156920
109 Ga0207687_10007940 3300025927 Bacteria 6948
110 Ga0207664_10099589 3300025929 Bacteria 2399
111 Ga0207709_10019423 3300025935 Bacteria 3821
112 Ga0207670_10011901 3300025936 Bacteria 5066
113 Ga0207704_10000026 3300025938 Bacteria 123892
114 Ga0207704_11007057 3300025938 Bacteria 705
115 Ga0207691_10000002 3300025940 Bacteria 189785
116 Ga0207711_10000192 3300025941 Bacteria 65599
117 Ga0207661_10000247 3300025944 Bacteria 35222
118 Ga0207661_10036898 3300025944 Bacteria 3819
119 Ga0207661_10087085 3300025944 Bacteria 2593
120 Ga0207661_10646601 3300025944 Bacteria 972
121 Ga0207679_10125964 3300025945 Bacteria 2047
122 Ga0207679_10359070 3300025945 Bacteria 1272
123 Ga0207668_10013940 3300025972 Bacteria 4966
124 Ga0207640_10000074 3300025981 Bacteria 78164
125 Ga0207677_10000308 3300026023 Bacteria 35929
126 Ga0207677_10000534 3300026023 Bacteria 24018
127 Ga0207639_10147348 3300026041 Bacteria 1968
128 Ga0207678_10265616 3300026067 Bacteria 1471
129 Ga0207708_11420455 3300026075 Bacteria 609
130 Ga0207702_10000085 3300026078 Bacteria 106728
131 Ga0207702_10003306 3300026078 Bacteria 14840
132 Ga0207702_12055762 3300026078 Bacteria 561
133 Ga0207641_11422311 3300026088 Bacteria 695
134 Ga0207648_11976455 3300026089 Bacteria 544
135 Ga0207676_10000025 3300026095 Bacteria 261714
136 Ga0207698_10000043 3300026142 Bacteria 96553
137 Ga0268265_10180062 3300028380 Bacteria 1815
138 Ga0307405_11079910 3300031731 Bacteria 689
139 Ga0307405_11545933 3300031731 Bacteria 584
140 Ga0307413_12044459 3300031824 Unclassified 517
141 Ga0307410_10532874 3300031852 Bacteria 971
142 Ga0307406_10819830 3300031901 Bacteria 787
143 Ga0307409_100861027 3300031995 Bacteria 918
144 Ga0307409_101737045 3300031995 Bacteria 653
145 Ga0307409_102607849 3300031995 Bacteria 534
146 Ga0307416_100114724 3300032002 Bacteria 2384
147 Ga0307416_100214075 3300032002 Bacteria 1841
148 Ga0307416_100958318 3300032002 Bacteria 958
149 Ga0307416_101756751 3300032002 Bacteria 724
150 Ga0307414_10393171 3300032004 Bacteria 1202
151 Ga0307411_10458940 3300032005 Bacteria 1068
152 Ga0307415_100117828 3300032126 Bacteria 1984
153 Ga0307415_100157517 3300032126 Bacteria 1756
154 Ga0307415_100181510 3300032126 Bacteria 1652
155 Ga0307415_100351615 3300032126 Bacteria 1241
156 Ga0307415_101024542 3300032126 Bacteria 769
157 Ga0395898_1501755 3300037466 Bacteria 600
158 Ga0436364_0024637 3300037853 Bacteria 831
159 Ga0436364_0376890 3300037853 Bacteria 32731
160 Ga0436364_0783784 3300037853 Bacteria 776
161 Ga0395901_1865672 3300038443 Bacteria 549
162 Ga0436365_0202901 3300039437 Bacteria 32522
163 Ga0436365_0769762 3300039437 Bacteria 837
164 Ga0436365_1109014 3300039437 Bacteria 1156
165 Ga0436365_1113673 3300039437 Bacteria 953
166 Ga0436365_1367936 3300039437 Bacteria 12358
167 Ga0436365_1454726 3300039437 Bacteria 1018
168 Ga0436365_1625495 3300039437 Bacteria 557
169 Ga0436365_1772279 3300039437 Bacteria 1960
170 Ga0436363_0002721 3300039450 Bacteria 11912
171 Ga0436363_0224773 3300039450 Bacteria 584
172 Ga0436363_1719013 3300039450 Bacteria 1019
173 Ga0436362_0474970 3300039453 Unclassified 758
174 Ga0436362_0660486 3300039453 Bacteria 2011
175 Ga0436362_0865685 3300039453 Bacteria 832
176 Ga0436362_1266156 3300039453 Bacteria 527
177 Ga0451800_1689789 3300041459 Bacteria 817
178 Ga0451845_0296743 3300041501 Bacteria 705
179 Ga0451853_2063636 3300041512 Bacteria 781
180 Ga0466969_0422727 3300044656 Bacteria 605
181 Ga0466965_0047352 3300044683 Bacteria 2129
182 Ga0466966_0286948 3300044684 Bacteria 989
183 Ga0466966_0352600 3300044684 Bacteria 884
184 Ga0466961_0042396 3300044693 Bacteria 2917
185 Ga0466961_0214049 3300044693 Bacteria 1189
186 Ga0466961_0911558 3300044693 Bacteria 523
187 Ga0466963_0000318 3300044694 Bacteria 21719
188 Ga0466963_0007267 3300044694 Bacteria 6604
189 Ga0466963_0027453 3300044694 Bacteria 3645
190 Ga0466963_0030956 3300044694 Bacteria 3456
191 Ga0466963_0356178 3300044694 Bacteria 1031
192 Ga0466963_0812167 3300044694 Bacteria 659
193 Ga0466964_0391051 3300044706 Bacteria 724
194 Ga0466964_0458787 3300044706 Bacteria 677
195 Ga0466964_0679647 3300044706 Bacteria 572
196 Ga0466971_0051386 3300044719 Bacteria 1855
197 Ga0466971_0132944 3300044719 Bacteria 1156
198 Ga0466968_0055746 3300044735 Bacteria 1697
199 Ga0466968_0624750 3300044735 Bacteria 545
200 Ga0466970_0698179 3300044765 Bacteria 591
201 Ga0466957_0002012 3300044842 Bacteria 10830
202 Ga0466957_0571530 3300044842 Bacteria 789
203 Ga0466957_1344515 3300044842 Bacteria 519
204 Ga0466959_0094236 3300045049 Bacteria 2148
205 Ga0466959_0194628 3300045049 Bacteria 1414
206 Ga0466959_0264652 3300045049 Bacteria 1183
207 Ga0466959_0367798 3300045049 Bacteria 979
208 Ga0466959_0394904 3300045049 Bacteria 940
209 Ga0466958_0011469 3300045836 Bacteria 4990
210 Ga0466958_0033777 3300045836 Bacteria 3049
211 Ga0466958_0060440 3300045836 Bacteria 2307
212 Ga0466958_0127199 3300045836 Bacteria 1598
213 Ga0466958_0132538 3300045836 Bacteria 1566
214 Ga0466958_0593476 3300045836 Bacteria 720
215 Ga0466958_0603451 3300045836 Bacteria 714
216 Ga0466967_0000006 3300045976 Bacteria 144065
217 Ga0466967_0003124 3300045976 Bacteria 10658
218 Ga0466967_0017758 3300045976 Bacteria 5662
219 Ga0466967_0469523 3300045976 Bacteria 1231
220 Ga0466967_0641688 3300045976 Bacteria 1050
221 Ga0466967_1484690 3300045976 Bacteria 675
222 Ga0466967_1582638 3300045976 Bacteria 653
223 Ga0466967_1637910 3300045976 Bacteria 641
224 Ga0466967_2033990 3300045976 Bacteria 571
225 Ga0495582_0268485 3300046473 Bacteria 979
226 Ga0495630_0001103 3300046517 Bacteria 18562
227 Ga0495644_0000618 3300046523 Bacteria 14879
228 Ga0495665_0028459 3300046531 Bacteria 2996
229 Ga0495645_0011486 3300046543 Bacteria 6234
230 Ga0495658_0001081 3300046683 Bacteria 14347
231 Ga0495669_0000335 3300046684 Bacteria 24890
232 Ga0495581_0039060 3300047315 Bacteria 2748
233 Ga0495679_030237 3300047446 Bacteria 1760
234 Ga0495593_0229284 3300047673 Bacteria 931
235 Ga0495602_0541485 3300048088 Bacteria 808
236 Ga0496100_0000007 3300048903 Bacteria 261266
237 Ga0496101_0000013 3300048904 Bacteria 261266
238 Ga0496104_0303896 3300048907 Bacteria 1508
239 Ga0496105_0027709 3300048908 Bacteria 4631
240 Ga0496106_0000006 3300048909 Bacteria 251855
241 Ga0496107_0000007 3300048910 Bacteria 257113
242 Ga0496108_0000005 3300048911 Bacteria 535059
243 Ga0496108_0017081 3300048911 Bacteria 5933
244 Ga0496108_0226842 3300048911 Bacteria 1624
245 Ga0496108_0852014 3300048911 Bacteria 784
246 Ga0496109_0000002 3300048912 Bacteria 443393
247 Ga0496110_0001478 3300048913 Bacteria 17029
248 Ga0496110_0273341 3300048913 Bacteria 1538
249 Ga0496111_0000011 3300048914 Bacteria 88409
250 Ga0496111_0865055 3300048914 Bacteria 652
251 Ga0496111_0899855 3300048914 Bacteria 637
252 Ga0496112_0000006 3300048915 Bacteria 365227
253 Ga0496112_0001978 3300048915 Bacteria 16196
254 Ga0496112_1334951 3300048915 Bacteria 632
255 Ga0496113_0000001 3300048916 Bacteria 224977
256 Ga0496113_0002405 3300048916 Bacteria 10875
257 Ga0496113_0020389 3300048916 Bacteria 4660
258 Ga0496113_0103252 3300048916 Bacteria 2211
259 Ga0496113_0321449 3300048916 Bacteria 1240
260 Ga0496114_0022999 3300048917 Bacteria 5080
261 Ga0501037_0612039 3300049573 Bacteria 731
262 Ga0501067_0287194 3300049583 Bacteria 916
263 Ga0501070_0855364 3300049586 Bacteria 711
264 Ga0501070_0939182 3300049586 Bacteria 673
265 Ga0501071_0621217 3300049587 Bacteria 831
266 Ga0501073_0199297 3300049589 Bacteria 1385
267 Ga0501075_1330742 3300049591 Bacteria 544
268 Ga0501076_0688219 3300049592 Bacteria 844
269 Ga0501081_1516970 3300049743 Bacteria 509
270 Ga0501045_0836917 3300049824 Bacteria 677
271 nmdc:mga03n38_277193_c1 3300050490 Bacteria 894
272 nmdc:mga05p37_387894_c1 3300050507 Bacteria 1634
273 nmdc:mga05p37_717741_c1 3300050507 Bacteria 1108
274 nmdc:mga09592_102911_c1 3300050508 Bacteria 2447
275 nmdc:mga0qj67_496353_c1 3300050509 Bacteria 981
276 nmdc:mga0qj67_87160_c1 3300050509 Bacteria 2505
277 nmdc:mga06r32_110326_c1 3300050510 Bacteria 2706
278 nmdc:mga06r32_849327_c1 3300050510 Bacteria 872
279 Ga0495619_0000054 3300053085 Bacteria 97928
280 Ga0495619_0000564 3300053085 Bacteria 24556
281 Ga0501084_1061558 3300054114 Bacteria 680
282 Ga0590071_126902 3300059421 Bacteria 654
283 Ga0466962_0113396 3300061719 Bacteria 1306
284 Ga0466962_0552261 3300061719 Bacteria 585

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045049 Ga0466959_0394904 Ga0466959_0394904_143_361 72
2 3300045976 Ga0466967_0469523 Ga0466967_0469523_524_745 73
3 3300005337 Ga0070682_100000011 Ga0070682_100000011263 74
4 3300005435 Ga0070714_101418106 Ga0070714_1014181061 74
5 3300005578 Ga0068854_100000062 Ga0068854_10000006233 74
6 3300005834 Ga0068851_10000297 Ga0068851_100002979 74
7 3300006163 Ga0070715_10494277 Ga0070715_104942773 74
8 3300009098 Ga0105245_10004839 Ga0105245_100048399 74
9 3300010159 Ga0099796_10298833 Ga0099796_102988332 74
10 3300010375 Ga0105239_10118827 Ga0105239_101188275 74
11 3300013307 Ga0157372_10000550 Ga0157372_1000055032 74
12 3300020081 Ga0206354_11508322 Ga0206354_115083223 74
13 3300025321 Ga0207656_10000084 Ga0207656_1000008420 74
14 3300025911 Ga0207654_10514160 Ga0207654_105141603 74
15 3300025927 Ga0207687_10007940 Ga0207687_100079403 74
16 3300025981 Ga0207640_10000074 Ga0207640_1000007433 74
17 3300048911 Ga0496108_0852014 Ga0496108_0852014_304_567 74
18 3300048913 Ga0496110_0001478 Ga0496110_0001478_13131_13355 74
19 3300048914 Ga0496111_0000011 Ga0496111_0000011_75039_75263 74
20 3300048915 Ga0496112_0001978 Ga0496112_0001978_2520_2744 74
21 3300048916 Ga0496113_0000001 Ga0496113_0000001_49387_49611 74
22 3300053085 Ga0495619_0000054 Ga0495619_0000054_81404_81628 74
23 3300005981 Ga0081538_10003665 Ga0081538_1000366518 75
24 3300005981 Ga0081538_10021381 Ga0081538_100213812 75
25 3300006028 Ga0070717_10655261 Ga0070717_106552612 75
26 3300006846 Ga0075430_100207375 Ga0075430_1002073753 75
27 3300006881 Ga0068865_101203008 Ga0068865_1012030082 75
28 3300021377 Ga0213874_10002023 Ga0213874_100020236 75
29 3300021384 Ga0213876_10039437 Ga0213876_100394372 75
30 3300021388 Ga0213875_10008642 Ga0213875_100086422 75
31 3300025938 Ga0207704_11007057 Ga0207704_110070572 75
32 3300031731 Ga0307405_11079910 Ga0307405_110799102 75
33 3300031995 Ga0307409_100861027 Ga0307409_1008610272 75
34 3300032002 Ga0307416_100114724 Ga0307416_1001147243 75
35 3300032002 Ga0307416_100958318 Ga0307416_1009583182 75
36 3300032126 Ga0307415_100157517 Ga0307415_1001575172 75
37 3300032126 Ga0307415_100181510 Ga0307415_1001815102 75
38 3300037853 Ga0436364_0024637 Ga0436364_0024637_222_449 75
39 3300037853 Ga0436364_0376890 Ga0436364_0376890_15390_15620 75
40 3300037853 Ga0436364_0783784 Ga0436364_0783784_34_264 75
41 3300038443 Ga0395901_1865672 Ga0395901_1865672_99_326 75
42 3300039437 Ga0436365_1367936 Ga0436365_1367936_9351_9581 75
43 3300039450 Ga0436363_0002721 Ga0436363_0002721_2037_2267 75
44 3300039450 Ga0436363_0224773 Ga0436363_0224773_163_390 75
45 3300039453 Ga0436362_0474970 Ga0436362_0474970_293_520 75
46 3300039453 Ga0436362_0660486 Ga0436362_0660486_1547_1777 75
47 3300047673 Ga0495593_0229284 Ga0495593_0229284_40_267 75
48 3300048907 Ga0496104_0303896 Ga0496104_0303896_202_429 75
49 3300048908 Ga0496105_0027709 Ga0496105_0027709_2455_2682 75
50 3300049573 Ga0501037_0612039 Ga0501037_0612039_184_411 75
51 3300049583 Ga0501067_0287194 Ga0501067_0287194_645_872 75
52 3300049586 Ga0501070_0855364 Ga0501070_0855364_474_701 75
53 3300049589 Ga0501073_0199297 Ga0501073_0199297_132_359 75
54 3300054114 Ga0501084_1061558 Ga0501084_1061558_208_435 75
55 3300005329 Ga0070683_100000534 Ga0070683_10000053415 76
56 3300005329 Ga0070683_100042035 Ga0070683_1000420355 76
57 3300005329 Ga0070683_100066423 Ga0070683_1000664233 76
58 3300005329 Ga0070683_100609905 Ga0070683_1006099053 76
59 3300005329 Ga0070683_101711816 Ga0070683_1017118161 76
60 3300005331 Ga0070670_100012696 Ga0070670_1000126969 76
61 3300005333 Ga0070677_10000016 Ga0070677_1000001643 76
62 3300005338 Ga0068868_100000634 Ga0068868_10000063422 76
63 3300005340 Ga0070689_100035506 Ga0070689_1000355062 76
64 3300005344 Ga0070661_100000004 Ga0070661_10000000455 76
65 3300005345 Ga0070692_10249464 Ga0070692_102494642 76
66 3300005347 Ga0070668_100229753 Ga0070668_1002297533 76
67 3300005354 Ga0070675_100000078 Ga0070675_10000007816 76
68 3300005365 Ga0070688_100000705 Ga0070688_1000007057 76
69 3300005365 Ga0070688_100000989 Ga0070688_1000009894 76
70 3300005365 Ga0070688_100038370 Ga0070688_1000383702 76
71 3300005435 Ga0070714_100056443 Ga0070714_1000564434 76
72 3300005439 Ga0070711_101980285 Ga0070711_1019802851 76
73 3300005455 Ga0070663_100255156 Ga0070663_1002551561 76
74 3300005456 Ga0070678_100758567 Ga0070678_1007585671 76
75 3300005466 Ga0070685_10000012 Ga0070685_1000001221 76
76 3300005466 Ga0070685_10001134 Ga0070685_1000113414 76
77 3300005466 Ga0070685_10009582 Ga0070685_100095823 76
78 3300005530 Ga0070679_100434295 Ga0070679_1004342952 76
79 3300005535 Ga0070684_100010265 Ga0070684_10001026510 76
80 3300005535 Ga0070684_100108799 Ga0070684_1001087992 76
81 3300005535 Ga0070684_100299780 Ga0070684_1002997803 76
82 3300005539 Ga0068853_100489064 Ga0068853_1004890641 76
83 3300005543 Ga0070672_100000049 Ga0070672_10000004932 76
84 3300005564 Ga0070664_100107085 Ga0070664_1001070855 76
85 3300005564 Ga0070664_100391299 Ga0070664_1003912993 76
86 3300005614 Ga0068856_100000377 Ga0068856_10000037733 76
87 3300005614 Ga0068856_100007632 Ga0068856_1000076329 76
88 3300005616 Ga0068852_100000022 Ga0068852_100000022111 76
89 3300005618 Ga0068864_100000023 Ga0068864_100000023194 76
90 3300005840 Ga0068870_10060649 Ga0068870_100606492 76
91 3300006353 Ga0075370_10446601 Ga0075370_104466012 76
92 3300006880 Ga0075429_101662113 Ga0075429_1016621132 76
93 3300006881 Ga0068865_100000135 Ga0068865_10000013527 76
94 3300009148 Ga0105243_10032044 Ga0105243_100320446 76
95 3300009148 Ga0105243_12570181 Ga0105243_125701812 76
96 3300009177 Ga0105248_12549506 Ga0105248_125495061 76
97 3300010375 Ga0105239_10048810 Ga0105239_100488108 76
98 3300013102 Ga0157371_10004879 Ga0157371_100048795 76
99 3300013104 Ga0157370_10245860 Ga0157370_102458603 76
100 3300013105 Ga0157369_10000014 Ga0157369_10000014194 76
101 3300013297 Ga0157378_10001375 Ga0157378_1000137521 76
102 3300013297 Ga0157378_12565241 Ga0157378_125652412 76
103 3300013306 Ga0163162_10571135 Ga0163162_105711352 76
104 3300014969 Ga0157376_10008488 Ga0157376_100084884 76
105 3300020069 Ga0197907_10402958 Ga0197907_104029581 76
106 3300020070 Ga0206356_10730229 Ga0206356_107302292 76
107 3300020070 Ga0206356_11112838 Ga0206356_111128385 76
108 3300020070 Ga0206356_11522892 Ga0206356_115228921 76
109 3300020080 Ga0206350_11222552 Ga0206350_112225522 76
110 3300020082 Ga0206353_11526258 Ga0206353_115262583 76
111 3300022467 Ga0224712_10003498 Ga0224712_100034983 76
112 3300025893 Ga0207682_10000008 Ga0207682_1000000890 76
113 3300025920 Ga0207649_10000003 Ga0207649_10000003204 76
114 3300025921 Ga0207652_10800946 Ga0207652_108009461 76
115 3300025925 Ga0207650_10052709 Ga0207650_100527094 76
116 3300025926 Ga0207659_10000018 Ga0207659_10000018122 76
117 3300025929 Ga0207664_10099589 Ga0207664_100995891 76
118 3300025935 Ga0207709_10019423 Ga0207709_100194233 76
119 3300025936 Ga0207670_10011901 Ga0207670_100119013 76
120 3300025938 Ga0207704_10000026 Ga0207704_1000002679 76
121 3300025940 Ga0207691_10000002 Ga0207691_1000000286 76
122 3300025941 Ga0207711_10000192 Ga0207711_1000019256 76
123 3300025944 Ga0207661_10000247 Ga0207661_1000024719 76
124 3300025944 Ga0207661_10036898 Ga0207661_100368985 76
125 3300025944 Ga0207661_10087085 Ga0207661_100870852 76
126 3300025944 Ga0207661_10646601 Ga0207661_106466011 76
127 3300025945 Ga0207679_10125964 Ga0207679_101259645 76
128 3300025945 Ga0207679_10359070 Ga0207679_103590703 76
129 3300025972 Ga0207668_10013940 Ga0207668_100139403 76
130 3300026023 Ga0207677_10000534 Ga0207677_100005349 76
131 3300026041 Ga0207639_10147348 Ga0207639_101473483 76
132 3300026067 Ga0207678_10265616 Ga0207678_102656162 76
133 3300026075 Ga0207708_11420455 Ga0207708_114204552 76
134 3300026078 Ga0207702_10000085 Ga0207702_1000008544 76
135 3300026078 Ga0207702_10003306 Ga0207702_100033063 76
136 3300026078 Ga0207702_12055762 Ga0207702_120557622 76
137 3300026089 Ga0207648_11976455 Ga0207648_119764551 76
138 3300026095 Ga0207676_10000025 Ga0207676_1000002584 76
139 3300026142 Ga0207698_10000043 Ga0207698_1000004314 76
140 3300028380 Ga0268265_10180062 Ga0268265_101800624 76
141 3300031731 Ga0307405_11545933 Ga0307405_115459332 76
142 3300031852 Ga0307410_10532874 Ga0307410_105328742 76
143 3300031901 Ga0307406_10819830 Ga0307406_108198302 76
144 3300031995 Ga0307409_102607849 Ga0307409_1026078491 76
145 3300032002 Ga0307416_100214075 Ga0307416_1002140751 76
146 3300032004 Ga0307414_10393171 Ga0307414_103931712 76
147 3300032126 Ga0307415_100117828 Ga0307415_1001178283 76
148 3300032126 Ga0307415_100351615 Ga0307415_1003516152 76
149 3300032126 Ga0307415_101024542 Ga0307415_1010245422 76
150 3300039437 Ga0436365_1109014 Ga0436365_1109014_137_367 76
151 3300039437 Ga0436365_1454726 Ga0436365_1454726_267_497 76
152 3300039437 Ga0436365_1625495 Ga0436365_1625495_43_273 76
153 3300039437 Ga0436365_1772279 Ga0436365_1772279_59_328 76
154 3300039453 Ga0436362_0865685 Ga0436362_0865685_443_673 76
155 3300044694 Ga0466963_0000318 Ga0466963_0000318_11337_11567 76
156 3300044694 Ga0466963_0030956 Ga0466963_0030956_97_327 76
157 3300044706 Ga0466964_0458787 Ga0466964_0458787_166_396 76
158 3300044719 Ga0466971_0132944 Ga0466971_0132944_137_367 76
159 3300044842 Ga0466957_0571530 Ga0466957_0571530_49_279 76
160 3300044842 Ga0466957_1344515 Ga0466957_1344515_238_468 76
161 3300045049 Ga0466959_0194628 Ga0466959_0194628_437_667 76
162 3300045836 Ga0466958_0127199 Ga0466958_0127199_1267_1497 76
163 3300045976 Ga0466967_0000006 Ga0466967_0000006_5775_6005 76
164 3300045976 Ga0466967_0017758 Ga0466967_0017758_1041_1271 76
165 3300045976 Ga0466967_0641688 Ga0466967_0641688_546_782 76
166 3300045976 Ga0466967_1484690 Ga0466967_1484690_37_267 76
167 3300045976 Ga0466967_1637910 Ga0466967_1637910_175_405 76
168 3300046473 Ga0495582_0268485 Ga0495582_0268485_383_613 76
169 3300046517 Ga0495630_0001103 Ga0495630_0001103_5104_5334 76
170 3300046523 Ga0495644_0000618 Ga0495644_0000618_10870_11100 76
171 3300046531 Ga0495665_0028459 Ga0495665_0028459_1416_1652 76
172 3300046543 Ga0495645_0011486 Ga0495645_0011486_3085_3315 76
173 3300046683 Ga0495658_0001081 Ga0495658_0001081_5571_5801 76
174 3300047315 Ga0495581_0039060 Ga0495581_0039060_871_1107 76
175 3300047446 Ga0495679_030237 Ga0495679_030237_1267_1497 76
176 3300048088 Ga0495602_0541485 Ga0495602_0541485_486_716 76
177 3300048911 Ga0496108_0000005 Ga0496108_0000005_184670_184900 76
178 3300048911 Ga0496108_0017081 Ga0496108_0017081_1594_1824 76
179 3300048911 Ga0496108_0226842 Ga0496108_0226842_161_391 76
180 3300048912 Ga0496109_0000002 Ga0496109_0000002_350192_350422 76
181 3300048913 Ga0496110_0273341 Ga0496110_0273341_445_675 76
182 3300048914 Ga0496111_0865055 Ga0496111_0865055_348_578 76
183 3300048915 Ga0496112_0000006 Ga0496112_0000006_176371_176601 76
184 3300048915 Ga0496112_1334951 Ga0496112_1334951_126_356 76
185 3300048916 Ga0496113_0002405 Ga0496113_0002405_2357_2587 76
186 3300048916 Ga0496113_0020389 Ga0496113_0020389_3607_3837 76
187 3300048916 Ga0496113_0103252 Ga0496113_0103252_1947_2177 76
188 3300048916 Ga0496113_0321449 Ga0496113_0321449_158_388 76
189 3300049587 Ga0501071_0621217 Ga0501071_0621217_511_741 76
190 3300049592 Ga0501076_0688219 Ga0501076_0688219_410_640 76
191 3300049743 Ga0501081_1516970 Ga0501081_1516970_24_254 76
192 3300050490 nmdc:mga03n38_277193_c1 nmdc:mga03n38_277193_c1_273_509 76
193 3300050509 nmdc:mga0qj67_496353_c1 nmdc:mga0qj67_496353_c1_345_578 76
194 3300061719 Ga0466962_0552261 Ga0466962_0552261_183_413 76
195 3300001977 JGI24746J21847_1000010 JGI24746J21847_100001020 77
196 3300002459 JGI24751J29686_10054428 JGI24751J29686_100544282 77
197 3300005338 Ga0068868_100003834 Ga0068868_1000038348 77
198 3300005547 Ga0070693_100000307 Ga0070693_10000030726 77
199 3300006173 Ga0070716_100596321 Ga0070716_1005963212 77
200 3300006844 Ga0075428_100022919 Ga0075428_1000229194 77
201 3300006844 Ga0075428_100153368 Ga0075428_1001533683 77
202 3300006844 Ga0075428_101071749 Ga0075428_1010717492 77
203 3300006844 Ga0075428_101910052 Ga0075428_1019100522 77
204 3300006846 Ga0075430_100041528 Ga0075430_1000415285 77
205 3300006847 Ga0075431_100046387 Ga0075431_1000463872 77
206 3300006847 Ga0075431_100181733 Ga0075431_1001817331 77
207 3300006880 Ga0075429_100001934 Ga0075429_1000019346 77
208 3300006880 Ga0075429_101567087 Ga0075429_1015670872 77
209 3300009094 Ga0111539_10511488 Ga0111539_105114882 77
210 3300009147 Ga0114129_10371040 Ga0114129_103710401 77
211 3300009147 Ga0114129_11619702 Ga0114129_116197021 77
212 3300009147 Ga0114129_13302564 Ga0114129_133025642 77
213 3300012507 Ga0157342_1031294 Ga0157342_10312942 77
214 3300013307 Ga0157372_10902846 Ga0157372_109028461 77
215 3300014325 Ga0163163_10796426 Ga0163163_107964263 77
216 3300014326 Ga0157380_10807002 Ga0157380_108070022 77
217 3300021377 Ga0213874_10467397 Ga0213874_104673971 77
218 3300021384 Ga0213876_10015706 Ga0213876_100157063 77
219 3300021384 Ga0213876_10663072 Ga0213876_106630722 77
220 3300021388 Ga0213875_10012434 Ga0213875_100124341 77
221 3300026023 Ga0207677_10000308 Ga0207677_1000030818 77
222 3300026088 Ga0207641_11422311 Ga0207641_114223112 77
223 3300031824 Ga0307413_12044459 Ga0307413_120444591 77
224 3300031995 Ga0307409_101737045 Ga0307409_1017370451 77
225 3300032002 Ga0307416_101756751 Ga0307416_1017567511 77
226 3300032005 Ga0307411_10458940 Ga0307411_104589401 77
227 3300037466 Ga0395898_1501755 Ga0395898_1501755_195_428 77
228 3300039437 Ga0436365_0202901 Ga0436365_0202901_3974_4207 77
229 3300039437 Ga0436365_0769762 Ga0436365_0769762_302_538 77
230 3300039437 Ga0436365_1113673 Ga0436365_1113673_316_552 77
231 3300039450 Ga0436363_1719013 Ga0436363_1719013_513_746 77
232 3300039453 Ga0436362_1266156 Ga0436362_1266156_142_375 77
233 3300041459 Ga0451800_1689789 Ga0451800_1689789_301_534 77
234 3300041501 Ga0451845_0296743 Ga0451845_0296743_390_623 77
235 3300041512 Ga0451853_2063636 Ga0451853_2063636_183_419 77
236 3300044656 Ga0466969_0422727 Ga0466969_0422727_298_531 77
237 3300044683 Ga0466965_0047352 Ga0466965_0047352_1004_1237 77
238 3300044684 Ga0466966_0286948 Ga0466966_0286948_613_846 77
239 3300044684 Ga0466966_0352600 Ga0466966_0352600_560_796 77
240 3300044693 Ga0466961_0042396 Ga0466961_0042396_2380_2613 77
241 3300044693 Ga0466961_0214049 Ga0466961_0214049_457_693 77
242 3300044693 Ga0466961_0911558 Ga0466961_0911558_225_458 77
243 3300044694 Ga0466963_0007267 Ga0466963_0007267_3958_4194 77
244 3300044694 Ga0466963_0027453 Ga0466963_0027453_1095_1328 77
245 3300044694 Ga0466963_0356178 Ga0466963_0356178_498_731 77
246 3300044694 Ga0466963_0812167 Ga0466963_0812167_380_616 77
247 3300044706 Ga0466964_0391051 Ga0466964_0391051_215_451 77
248 3300044706 Ga0466964_0679647 Ga0466964_0679647_241_474 77
249 3300044719 Ga0466971_0051386 Ga0466971_0051386_132_365 77
250 3300044735 Ga0466968_0055746 Ga0466968_0055746_724_957 77
251 3300044735 Ga0466968_0624750 Ga0466968_0624750_117_353 77
252 3300044765 Ga0466970_0698179 Ga0466970_0698179_230_463 77
253 3300044842 Ga0466957_0002012 Ga0466957_0002012_7485_7718 77
254 3300045049 Ga0466959_0094236 Ga0466959_0094236_161_394 77
255 3300045049 Ga0466959_0264652 Ga0466959_0264652_677_910 77
256 3300045049 Ga0466959_0367798 Ga0466959_0367798_314_547 77
257 3300045836 Ga0466958_0011469 Ga0466958_0011469_2063_2335 77
258 3300045836 Ga0466958_0033777 Ga0466958_0033777_680_916 77
259 3300045836 Ga0466958_0060440 Ga0466958_0060440_178_411 77
260 3300045836 Ga0466958_0132538 Ga0466958_0132538_819_1052 77
261 3300045836 Ga0466958_0593476 Ga0466958_0593476_402_638 77
262 3300045836 Ga0466958_0603451 Ga0466958_0603451_85_318 77
263 3300045976 Ga0466967_0003124 Ga0466967_0003124_3932_4165 77
264 3300045976 Ga0466967_1582638 Ga0466967_1582638_218_451 77
265 3300045976 Ga0466967_2033990 Ga0466967_2033990_159_392 77
266 3300046684 Ga0495669_0000335 Ga0495669_0000335_10345_10578 77
267 3300048903 Ga0496100_0000007 Ga0496100_0000007_32391_32624 77
268 3300048904 Ga0496101_0000013 Ga0496101_0000013_32391_32624 77
269 3300048909 Ga0496106_0000006 Ga0496106_0000006_26530_26763 77
270 3300048910 Ga0496107_0000007 Ga0496107_0000007_26532_26765 77
271 3300048914 Ga0496111_0899855 Ga0496111_0899855_334_567 77
272 3300048917 Ga0496114_0022999 Ga0496114_0022999_4067_4300 77
273 3300049586 Ga0501070_0939182 Ga0501070_0939182_258_494 77
274 3300049591 Ga0501075_1330742 Ga0501075_1330742_88_321 77
275 3300049824 Ga0501045_0836917 Ga0501045_0836917_64_297 77
276 3300050507 nmdc:mga05p37_387894_c1 nmdc:mga05p37_387894_c1_1148_1384 77
277 3300050507 nmdc:mga05p37_717741_c1 nmdc:mga05p37_717741_c1_829_1062 77
278 3300050508 nmdc:mga09592_102911_c1 nmdc:mga09592_102911_c1_1719_1952 77
279 3300050509 nmdc:mga0qj67_87160_c1 nmdc:mga0qj67_87160_c1_1649_1882 77
280 3300050510 nmdc:mga06r32_110326_c1 nmdc:mga06r32_110326_c1_1920_2156 77
281 3300050510 nmdc:mga06r32_849327_c1 nmdc:mga06r32_849327_c1_228_461 77
282 3300053085 Ga0495619_0000564 Ga0495619_0000564_12236_12469 77
283 3300059421 Ga0590071_126902 Ga0590071_126902_245_478 77
284 3300061719 Ga0466962_0113396 Ga0466962_0113396_572_805 77

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d5k-assembly1.cif.gz_B crystal structure of dps from staphylococcus aureus 0.9855 17 71
7o91-assembly2.cif.gz_B dimn-sulerythrin 0.9829 15 73
2chp-assembly1.cif.gz_A crystal structure of the dodecameric ferritin mrga from b. subtilis 168 0.9773 17 71
4di0-assembly1.cif.gz_A the structure of rubrerythrin from burkholderia pseudomallei 0.9764 16 71
2c41-assembly1.cif.gz_C x-ray structure of dps from thermosynechococcus elongatus 0.9602 24 71
ID Description Score Start End Superfamily
2d5kD00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.982 20 71 1.20.1260.10
2chpA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9773 17 71 1.20.1260.10
4di0A00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9764 16 71 1.20.1260.10
af_Q58156_13_77_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9672 17 71 1.20.1260.10
2c41C01 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9671 24 70 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A317N6H8-F1-model_v4 Uncharacterized protein 0.9987 13 77
AF-A0A7V1RCE1-F1-model_v4 Uncharacterized protein 0.979 13 76
AF-A0A7C5BUW2-F1-model_v4 Sensor histidine kinase 0.9748 13 76 GO:0016020
AF-A0A0B6WZ06-F1-model_v4 Rubrerythrin 0.9736 9 76
AF-A0A1V4WE32-F1-model_v4 Uncharacterized protein 0.9726 13 74

Feature Viewer

pLDDT pTM Quality
88.37 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map