F386357
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 284 | 167 | 284 | 76 |
Family's Representative Sequence
| Representative Sequence | 3300045836|Ga0466958_0011469|Ga0466958_0011469_2063_2335 |
| Length | 90 |
| Sequence | MPQAIVSHATKGRMMGSQETGQTTGTKDKDYNLLWFTEQSLSNVLRLETYIEDAERDGDSELADFFRRAQEASRRGGEQGKEQLRKRLAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 22 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 26 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 27 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 28 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 29 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 30 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 31 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 32 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 36 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 37 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 38 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 39 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 40 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 41 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 47 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 49 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 59 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 60 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 61 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 62 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 63 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 64 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 65 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 66 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 67 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 96 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 97 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 98 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 99 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 100 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 101 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 102 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 103 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 104 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 105 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 106 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 107 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 108 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 109 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 110 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 111 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 112 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 113 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 114 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 115 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 116 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 117 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 118 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 119 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 120 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 121 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 122 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 123 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 124 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 125 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 126 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 138 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 139 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 140 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 141 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 142 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 143 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 144 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 145 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 146 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 147 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 148 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 149 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 150 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 152 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 156 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 157 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 158 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 160 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 161 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 163 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 164 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 167 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.18 |
| Metatranscriptomes | 2.82 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.7 |
| Nodule | 0 |
| Rhizoplane | 9.15 |
| Rhizosphere | 82.04 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000010 | 3300001977 | Bacteria | 18578 |
| 2 | JGI24751J29686_10054428 | 3300002459 | Bacteria | 825 |
| 3 | Ga0070683_100000534 | 3300005329 | Bacteria | 26797 |
| 4 | Ga0070683_100042035 | 3300005329 | Bacteria | 4208 |
| 5 | Ga0070683_100066423 | 3300005329 | Bacteria | 3360 |
| 6 | Ga0070683_100609905 | 3300005329 | Bacteria | 1045 |
| 7 | Ga0070683_101711816 | 3300005329 | Bacteria | 605 |
| 8 | Ga0070670_100012696 | 3300005331 | Bacteria | 7212 |
| 9 | Ga0070677_10000016 | 3300005333 | Bacteria | 52044 |
| 10 | Ga0070682_100000011 | 3300005337 | Bacteria | 266253 |
| 11 | Ga0068868_100000634 | 3300005338 | Bacteria | 23652 |
| 12 | Ga0068868_100003834 | 3300005338 | Bacteria | 10495 |
| 13 | Ga0070689_100035506 | 3300005340 | Bacteria | 3809 |
| 14 | Ga0070661_100000004 | 3300005344 | Bacteria | 243876 |
| 15 | Ga0070692_10249464 | 3300005345 | Bacteria | 1062 |
| 16 | Ga0070668_100229753 | 3300005347 | Bacteria | 1533 |
| 17 | Ga0070675_100000078 | 3300005354 | Bacteria | 56469 |
| 18 | Ga0070688_100000705 | 3300005365 | Bacteria | 16441 |
| 19 | Ga0070688_100000989 | 3300005365 | Bacteria | 14241 |
| 20 | Ga0070688_100038370 | 3300005365 | Bacteria | 2925 |
| 21 | Ga0070714_100056443 | 3300005435 | Bacteria | 3359 |
| 22 | Ga0070714_101418106 | 3300005435 | Bacteria | 678 |
| 23 | Ga0070711_101980285 | 3300005439 | Bacteria | 512 |
| 24 | Ga0070663_100255156 | 3300005455 | Bacteria | 1389 |
| 25 | Ga0070678_100758567 | 3300005456 | Bacteria | 878 |
| 26 | Ga0070685_10000012 | 3300005466 | Bacteria | 128823 |
| 27 | Ga0070685_10001134 | 3300005466 | Bacteria | 14241 |
| 28 | Ga0070685_10009582 | 3300005466 | Bacteria | 5009 |
| 29 | Ga0070679_100434295 | 3300005530 | Bacteria | 1258 |
| 30 | Ga0070684_100010265 | 3300005535 | Bacteria | 7413 |
| 31 | Ga0070684_100108799 | 3300005535 | Bacteria | 2484 |
| 32 | Ga0070684_100299780 | 3300005535 | Bacteria | 1475 |
| 33 | Ga0068853_100489064 | 3300005539 | Bacteria | 1161 |
| 34 | Ga0070672_100000049 | 3300005543 | Bacteria | 52233 |
| 35 | Ga0070693_100000307 | 3300005547 | Bacteria | 22748 |
| 36 | Ga0070664_100107085 | 3300005564 | Bacteria | 2437 |
| 37 | Ga0070664_100391299 | 3300005564 | Bacteria | 1270 |
| 38 | Ga0068854_100000062 | 3300005578 | Bacteria | 78159 |
| 39 | Ga0068856_100000377 | 3300005614 | Bacteria | 48877 |
| 40 | Ga0068856_100007632 | 3300005614 | Bacteria | 10556 |
| 41 | Ga0068852_100000022 | 3300005616 | Bacteria | 125196 |
| 42 | Ga0068864_100000023 | 3300005618 | Bacteria | 257064 |
| 43 | Ga0068851_10000297 | 3300005834 | Bacteria | 22748 |
| 44 | Ga0068870_10060649 | 3300005840 | Bacteria | 2031 |
| 45 | Ga0081538_10003665 | 3300005981 | Bacteria | 14434 |
| 46 | Ga0081538_10021381 | 3300005981 | Bacteria | 4725 |
| 47 | Ga0070717_10655261 | 3300006028 | Bacteria | 953 |
| 48 | Ga0070715_10494277 | 3300006163 | Bacteria | 699 |
| 49 | Ga0070716_100596321 | 3300006173 | Bacteria | 830 |
| 50 | Ga0075370_10446601 | 3300006353 | Bacteria | 778 |
| 51 | Ga0075428_100022919 | 3300006844 | Bacteria | 6911 |
| 52 | Ga0075428_100153368 | 3300006844 | Bacteria | 2503 |
| 53 | Ga0075428_101071749 | 3300006844 | Bacteria | 852 |
| 54 | Ga0075428_101910052 | 3300006844 | Bacteria | 617 |
| 55 | Ga0075430_100041528 | 3300006846 | Bacteria | 3891 |
| 56 | Ga0075430_100207375 | 3300006846 | Bacteria | 1627 |
| 57 | Ga0075431_100046387 | 3300006847 | Bacteria | 4481 |
| 58 | Ga0075431_100181733 | 3300006847 | Bacteria | 2158 |
| 59 | Ga0075429_100001934 | 3300006880 | Bacteria | 17175 |
| 60 | Ga0075429_101567087 | 3300006880 | Bacteria | 573 |
| 61 | Ga0075429_101662113 | 3300006880 | Bacteria | 555 |
| 62 | Ga0068865_100000135 | 3300006881 | Bacteria | 38521 |
| 63 | Ga0068865_101203008 | 3300006881 | Unclassified | 671 |
| 64 | Ga0111539_10511488 | 3300009094 | Bacteria | 1399 |
| 65 | Ga0105245_10004839 | 3300009098 | Bacteria | 11864 |
| 66 | Ga0114129_10371040 | 3300009147 | Bacteria | 1891 |
| 67 | Ga0114129_11619702 | 3300009147 | Bacteria | 792 |
| 68 | Ga0114129_13302564 | 3300009147 | Unclassified | 522 |
| 69 | Ga0105243_10032044 | 3300009148 | Bacteria | 4057 |
| 70 | Ga0105243_12570181 | 3300009148 | Bacteria | 549 |
| 71 | Ga0105248_12549506 | 3300009177 | Bacteria | 583 |
| 72 | Ga0099796_10298833 | 3300010159 | Bacteria | 682 |
| 73 | Ga0105239_10048810 | 3300010375 | Bacteria | 4641 |
| 74 | Ga0105239_10118827 | 3300010375 | Bacteria | 2934 |
| 75 | Ga0157342_1031294 | 3300012507 | Bacteria | 671 |
| 76 | Ga0157371_10004879 | 3300013102 | Bacteria | 11527 |
| 77 | Ga0157370_10245860 | 3300013104 | Bacteria | 1655 |
| 78 | Ga0157369_10000014 | 3300013105 | Bacteria | 266411 |
| 79 | Ga0157378_10001375 | 3300013297 | Bacteria | 21833 |
| 80 | Ga0157378_12565241 | 3300013297 | Bacteria | 562 |
| 81 | Ga0163162_10571135 | 3300013306 | Bacteria | 1258 |
| 82 | Ga0157372_10000550 | 3300013307 | Bacteria | 41234 |
| 83 | Ga0157372_10902846 | 3300013307 | Bacteria | 1025 |
| 84 | Ga0163163_10796426 | 3300014325 | Bacteria | 1008 |
| 85 | Ga0157380_10807002 | 3300014326 | Bacteria | 956 |
| 86 | Ga0157376_10008488 | 3300014969 | Bacteria | 7417 |
| 87 | Ga0197907_10402958 | 3300020069 | Bacteria | 501 |
| 88 | Ga0206356_10730229 | 3300020070 | Bacteria | 528 |
| 89 | Ga0206356_11112838 | 3300020070 | Bacteria | 4456 |
| 90 | Ga0206356_11522892 | 3300020070 | Bacteria | 541 |
| 91 | Ga0206350_11222552 | 3300020080 | Bacteria | 736 |
| 92 | Ga0206354_11508322 | 3300020081 | Bacteria | 828 |
| 93 | Ga0206353_11526258 | 3300020082 | Bacteria | 1969 |
| 94 | Ga0213874_10002023 | 3300021377 | Bacteria | 4284 |
| 95 | Ga0213874_10467397 | 3300021377 | Bacteria | 500 |
| 96 | Ga0213876_10015706 | 3300021384 | Bacteria | 4007 |
| 97 | Ga0213876_10039437 | 3300021384 | Bacteria | 2495 |
| 98 | Ga0213876_10663072 | 3300021384 | Bacteria | 555 |
| 99 | Ga0213875_10008642 | 3300021388 | Bacteria | 5201 |
| 100 | Ga0213875_10012434 | 3300021388 | Bacteria | 4207 |
| 101 | Ga0224712_10003498 | 3300022467 | Bacteria | 4092 |
| 102 | Ga0207656_10000084 | 3300025321 | Bacteria | 35284 |
| 103 | Ga0207682_10000008 | 3300025893 | Bacteria | 87020 |
| 104 | Ga0207654_10514160 | 3300025911 | Bacteria | 847 |
| 105 | Ga0207649_10000003 | 3300025920 | Bacteria | 388908 |
| 106 | Ga0207652_10800946 | 3300025921 | Bacteria | 837 |
| 107 | Ga0207650_10052709 | 3300025925 | Bacteria | 3014 |
| 108 | Ga0207659_10000018 | 3300025926 | Bacteria | 156920 |
| 109 | Ga0207687_10007940 | 3300025927 | Bacteria | 6948 |
| 110 | Ga0207664_10099589 | 3300025929 | Bacteria | 2399 |
| 111 | Ga0207709_10019423 | 3300025935 | Bacteria | 3821 |
| 112 | Ga0207670_10011901 | 3300025936 | Bacteria | 5066 |
| 113 | Ga0207704_10000026 | 3300025938 | Bacteria | 123892 |
| 114 | Ga0207704_11007057 | 3300025938 | Bacteria | 705 |
| 115 | Ga0207691_10000002 | 3300025940 | Bacteria | 189785 |
| 116 | Ga0207711_10000192 | 3300025941 | Bacteria | 65599 |
| 117 | Ga0207661_10000247 | 3300025944 | Bacteria | 35222 |
| 118 | Ga0207661_10036898 | 3300025944 | Bacteria | 3819 |
| 119 | Ga0207661_10087085 | 3300025944 | Bacteria | 2593 |
| 120 | Ga0207661_10646601 | 3300025944 | Bacteria | 972 |
| 121 | Ga0207679_10125964 | 3300025945 | Bacteria | 2047 |
| 122 | Ga0207679_10359070 | 3300025945 | Bacteria | 1272 |
| 123 | Ga0207668_10013940 | 3300025972 | Bacteria | 4966 |
| 124 | Ga0207640_10000074 | 3300025981 | Bacteria | 78164 |
| 125 | Ga0207677_10000308 | 3300026023 | Bacteria | 35929 |
| 126 | Ga0207677_10000534 | 3300026023 | Bacteria | 24018 |
| 127 | Ga0207639_10147348 | 3300026041 | Bacteria | 1968 |
| 128 | Ga0207678_10265616 | 3300026067 | Bacteria | 1471 |
| 129 | Ga0207708_11420455 | 3300026075 | Bacteria | 609 |
| 130 | Ga0207702_10000085 | 3300026078 | Bacteria | 106728 |
| 131 | Ga0207702_10003306 | 3300026078 | Bacteria | 14840 |
| 132 | Ga0207702_12055762 | 3300026078 | Bacteria | 561 |
| 133 | Ga0207641_11422311 | 3300026088 | Bacteria | 695 |
| 134 | Ga0207648_11976455 | 3300026089 | Bacteria | 544 |
| 135 | Ga0207676_10000025 | 3300026095 | Bacteria | 261714 |
| 136 | Ga0207698_10000043 | 3300026142 | Bacteria | 96553 |
| 137 | Ga0268265_10180062 | 3300028380 | Bacteria | 1815 |
| 138 | Ga0307405_11079910 | 3300031731 | Bacteria | 689 |
| 139 | Ga0307405_11545933 | 3300031731 | Bacteria | 584 |
| 140 | Ga0307413_12044459 | 3300031824 | Unclassified | 517 |
| 141 | Ga0307410_10532874 | 3300031852 | Bacteria | 971 |
| 142 | Ga0307406_10819830 | 3300031901 | Bacteria | 787 |
| 143 | Ga0307409_100861027 | 3300031995 | Bacteria | 918 |
| 144 | Ga0307409_101737045 | 3300031995 | Bacteria | 653 |
| 145 | Ga0307409_102607849 | 3300031995 | Bacteria | 534 |
| 146 | Ga0307416_100114724 | 3300032002 | Bacteria | 2384 |
| 147 | Ga0307416_100214075 | 3300032002 | Bacteria | 1841 |
| 148 | Ga0307416_100958318 | 3300032002 | Bacteria | 958 |
| 149 | Ga0307416_101756751 | 3300032002 | Bacteria | 724 |
| 150 | Ga0307414_10393171 | 3300032004 | Bacteria | 1202 |
| 151 | Ga0307411_10458940 | 3300032005 | Bacteria | 1068 |
| 152 | Ga0307415_100117828 | 3300032126 | Bacteria | 1984 |
| 153 | Ga0307415_100157517 | 3300032126 | Bacteria | 1756 |
| 154 | Ga0307415_100181510 | 3300032126 | Bacteria | 1652 |
| 155 | Ga0307415_100351615 | 3300032126 | Bacteria | 1241 |
| 156 | Ga0307415_101024542 | 3300032126 | Bacteria | 769 |
| 157 | Ga0395898_1501755 | 3300037466 | Bacteria | 600 |
| 158 | Ga0436364_0024637 | 3300037853 | Bacteria | 831 |
| 159 | Ga0436364_0376890 | 3300037853 | Bacteria | 32731 |
| 160 | Ga0436364_0783784 | 3300037853 | Bacteria | 776 |
| 161 | Ga0395901_1865672 | 3300038443 | Bacteria | 549 |
| 162 | Ga0436365_0202901 | 3300039437 | Bacteria | 32522 |
| 163 | Ga0436365_0769762 | 3300039437 | Bacteria | 837 |
| 164 | Ga0436365_1109014 | 3300039437 | Bacteria | 1156 |
| 165 | Ga0436365_1113673 | 3300039437 | Bacteria | 953 |
| 166 | Ga0436365_1367936 | 3300039437 | Bacteria | 12358 |
| 167 | Ga0436365_1454726 | 3300039437 | Bacteria | 1018 |
| 168 | Ga0436365_1625495 | 3300039437 | Bacteria | 557 |
| 169 | Ga0436365_1772279 | 3300039437 | Bacteria | 1960 |
| 170 | Ga0436363_0002721 | 3300039450 | Bacteria | 11912 |
| 171 | Ga0436363_0224773 | 3300039450 | Bacteria | 584 |
| 172 | Ga0436363_1719013 | 3300039450 | Bacteria | 1019 |
| 173 | Ga0436362_0474970 | 3300039453 | Unclassified | 758 |
| 174 | Ga0436362_0660486 | 3300039453 | Bacteria | 2011 |
| 175 | Ga0436362_0865685 | 3300039453 | Bacteria | 832 |
| 176 | Ga0436362_1266156 | 3300039453 | Bacteria | 527 |
| 177 | Ga0451800_1689789 | 3300041459 | Bacteria | 817 |
| 178 | Ga0451845_0296743 | 3300041501 | Bacteria | 705 |
| 179 | Ga0451853_2063636 | 3300041512 | Bacteria | 781 |
| 180 | Ga0466969_0422727 | 3300044656 | Bacteria | 605 |
| 181 | Ga0466965_0047352 | 3300044683 | Bacteria | 2129 |
| 182 | Ga0466966_0286948 | 3300044684 | Bacteria | 989 |
| 183 | Ga0466966_0352600 | 3300044684 | Bacteria | 884 |
| 184 | Ga0466961_0042396 | 3300044693 | Bacteria | 2917 |
| 185 | Ga0466961_0214049 | 3300044693 | Bacteria | 1189 |
| 186 | Ga0466961_0911558 | 3300044693 | Bacteria | 523 |
| 187 | Ga0466963_0000318 | 3300044694 | Bacteria | 21719 |
| 188 | Ga0466963_0007267 | 3300044694 | Bacteria | 6604 |
| 189 | Ga0466963_0027453 | 3300044694 | Bacteria | 3645 |
| 190 | Ga0466963_0030956 | 3300044694 | Bacteria | 3456 |
| 191 | Ga0466963_0356178 | 3300044694 | Bacteria | 1031 |
| 192 | Ga0466963_0812167 | 3300044694 | Bacteria | 659 |
| 193 | Ga0466964_0391051 | 3300044706 | Bacteria | 724 |
| 194 | Ga0466964_0458787 | 3300044706 | Bacteria | 677 |
| 195 | Ga0466964_0679647 | 3300044706 | Bacteria | 572 |
| 196 | Ga0466971_0051386 | 3300044719 | Bacteria | 1855 |
| 197 | Ga0466971_0132944 | 3300044719 | Bacteria | 1156 |
| 198 | Ga0466968_0055746 | 3300044735 | Bacteria | 1697 |
| 199 | Ga0466968_0624750 | 3300044735 | Bacteria | 545 |
| 200 | Ga0466970_0698179 | 3300044765 | Bacteria | 591 |
| 201 | Ga0466957_0002012 | 3300044842 | Bacteria | 10830 |
| 202 | Ga0466957_0571530 | 3300044842 | Bacteria | 789 |
| 203 | Ga0466957_1344515 | 3300044842 | Bacteria | 519 |
| 204 | Ga0466959_0094236 | 3300045049 | Bacteria | 2148 |
| 205 | Ga0466959_0194628 | 3300045049 | Bacteria | 1414 |
| 206 | Ga0466959_0264652 | 3300045049 | Bacteria | 1183 |
| 207 | Ga0466959_0367798 | 3300045049 | Bacteria | 979 |
| 208 | Ga0466959_0394904 | 3300045049 | Bacteria | 940 |
| 209 | Ga0466958_0011469 | 3300045836 | Bacteria | 4990 |
| 210 | Ga0466958_0033777 | 3300045836 | Bacteria | 3049 |
| 211 | Ga0466958_0060440 | 3300045836 | Bacteria | 2307 |
| 212 | Ga0466958_0127199 | 3300045836 | Bacteria | 1598 |
| 213 | Ga0466958_0132538 | 3300045836 | Bacteria | 1566 |
| 214 | Ga0466958_0593476 | 3300045836 | Bacteria | 720 |
| 215 | Ga0466958_0603451 | 3300045836 | Bacteria | 714 |
| 216 | Ga0466967_0000006 | 3300045976 | Bacteria | 144065 |
| 217 | Ga0466967_0003124 | 3300045976 | Bacteria | 10658 |
| 218 | Ga0466967_0017758 | 3300045976 | Bacteria | 5662 |
| 219 | Ga0466967_0469523 | 3300045976 | Bacteria | 1231 |
| 220 | Ga0466967_0641688 | 3300045976 | Bacteria | 1050 |
| 221 | Ga0466967_1484690 | 3300045976 | Bacteria | 675 |
| 222 | Ga0466967_1582638 | 3300045976 | Bacteria | 653 |
| 223 | Ga0466967_1637910 | 3300045976 | Bacteria | 641 |
| 224 | Ga0466967_2033990 | 3300045976 | Bacteria | 571 |
| 225 | Ga0495582_0268485 | 3300046473 | Bacteria | 979 |
| 226 | Ga0495630_0001103 | 3300046517 | Bacteria | 18562 |
| 227 | Ga0495644_0000618 | 3300046523 | Bacteria | 14879 |
| 228 | Ga0495665_0028459 | 3300046531 | Bacteria | 2996 |
| 229 | Ga0495645_0011486 | 3300046543 | Bacteria | 6234 |
| 230 | Ga0495658_0001081 | 3300046683 | Bacteria | 14347 |
| 231 | Ga0495669_0000335 | 3300046684 | Bacteria | 24890 |
| 232 | Ga0495581_0039060 | 3300047315 | Bacteria | 2748 |
| 233 | Ga0495679_030237 | 3300047446 | Bacteria | 1760 |
| 234 | Ga0495593_0229284 | 3300047673 | Bacteria | 931 |
| 235 | Ga0495602_0541485 | 3300048088 | Bacteria | 808 |
| 236 | Ga0496100_0000007 | 3300048903 | Bacteria | 261266 |
| 237 | Ga0496101_0000013 | 3300048904 | Bacteria | 261266 |
| 238 | Ga0496104_0303896 | 3300048907 | Bacteria | 1508 |
| 239 | Ga0496105_0027709 | 3300048908 | Bacteria | 4631 |
| 240 | Ga0496106_0000006 | 3300048909 | Bacteria | 251855 |
| 241 | Ga0496107_0000007 | 3300048910 | Bacteria | 257113 |
| 242 | Ga0496108_0000005 | 3300048911 | Bacteria | 535059 |
| 243 | Ga0496108_0017081 | 3300048911 | Bacteria | 5933 |
| 244 | Ga0496108_0226842 | 3300048911 | Bacteria | 1624 |
| 245 | Ga0496108_0852014 | 3300048911 | Bacteria | 784 |
| 246 | Ga0496109_0000002 | 3300048912 | Bacteria | 443393 |
| 247 | Ga0496110_0001478 | 3300048913 | Bacteria | 17029 |
| 248 | Ga0496110_0273341 | 3300048913 | Bacteria | 1538 |
| 249 | Ga0496111_0000011 | 3300048914 | Bacteria | 88409 |
| 250 | Ga0496111_0865055 | 3300048914 | Bacteria | 652 |
| 251 | Ga0496111_0899855 | 3300048914 | Bacteria | 637 |
| 252 | Ga0496112_0000006 | 3300048915 | Bacteria | 365227 |
| 253 | Ga0496112_0001978 | 3300048915 | Bacteria | 16196 |
| 254 | Ga0496112_1334951 | 3300048915 | Bacteria | 632 |
| 255 | Ga0496113_0000001 | 3300048916 | Bacteria | 224977 |
| 256 | Ga0496113_0002405 | 3300048916 | Bacteria | 10875 |
| 257 | Ga0496113_0020389 | 3300048916 | Bacteria | 4660 |
| 258 | Ga0496113_0103252 | 3300048916 | Bacteria | 2211 |
| 259 | Ga0496113_0321449 | 3300048916 | Bacteria | 1240 |
| 260 | Ga0496114_0022999 | 3300048917 | Bacteria | 5080 |
| 261 | Ga0501037_0612039 | 3300049573 | Bacteria | 731 |
| 262 | Ga0501067_0287194 | 3300049583 | Bacteria | 916 |
| 263 | Ga0501070_0855364 | 3300049586 | Bacteria | 711 |
| 264 | Ga0501070_0939182 | 3300049586 | Bacteria | 673 |
| 265 | Ga0501071_0621217 | 3300049587 | Bacteria | 831 |
| 266 | Ga0501073_0199297 | 3300049589 | Bacteria | 1385 |
| 267 | Ga0501075_1330742 | 3300049591 | Bacteria | 544 |
| 268 | Ga0501076_0688219 | 3300049592 | Bacteria | 844 |
| 269 | Ga0501081_1516970 | 3300049743 | Bacteria | 509 |
| 270 | Ga0501045_0836917 | 3300049824 | Bacteria | 677 |
| 271 | nmdc:mga03n38_277193_c1 | 3300050490 | Bacteria | 894 |
| 272 | nmdc:mga05p37_387894_c1 | 3300050507 | Bacteria | 1634 |
| 273 | nmdc:mga05p37_717741_c1 | 3300050507 | Bacteria | 1108 |
| 274 | nmdc:mga09592_102911_c1 | 3300050508 | Bacteria | 2447 |
| 275 | nmdc:mga0qj67_496353_c1 | 3300050509 | Bacteria | 981 |
| 276 | nmdc:mga0qj67_87160_c1 | 3300050509 | Bacteria | 2505 |
| 277 | nmdc:mga06r32_110326_c1 | 3300050510 | Bacteria | 2706 |
| 278 | nmdc:mga06r32_849327_c1 | 3300050510 | Bacteria | 872 |
| 279 | Ga0495619_0000054 | 3300053085 | Bacteria | 97928 |
| 280 | Ga0495619_0000564 | 3300053085 | Bacteria | 24556 |
| 281 | Ga0501084_1061558 | 3300054114 | Bacteria | 680 |
| 282 | Ga0590071_126902 | 3300059421 | Bacteria | 654 |
| 283 | Ga0466962_0113396 | 3300061719 | Bacteria | 1306 |
| 284 | Ga0466962_0552261 | 3300061719 | Bacteria | 585 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045049 | Ga0466959_0394904 | Ga0466959_0394904_143_361 | 72 |
| 2 | 3300045976 | Ga0466967_0469523 | Ga0466967_0469523_524_745 | 73 |
| 3 | 3300005337 | Ga0070682_100000011 | Ga0070682_100000011263 | 74 |
| 4 | 3300005435 | Ga0070714_101418106 | Ga0070714_1014181061 | 74 |
| 5 | 3300005578 | Ga0068854_100000062 | Ga0068854_10000006233 | 74 |
| 6 | 3300005834 | Ga0068851_10000297 | Ga0068851_100002979 | 74 |
| 7 | 3300006163 | Ga0070715_10494277 | Ga0070715_104942773 | 74 |
| 8 | 3300009098 | Ga0105245_10004839 | Ga0105245_100048399 | 74 |
| 9 | 3300010159 | Ga0099796_10298833 | Ga0099796_102988332 | 74 |
| 10 | 3300010375 | Ga0105239_10118827 | Ga0105239_101188275 | 74 |
| 11 | 3300013307 | Ga0157372_10000550 | Ga0157372_1000055032 | 74 |
| 12 | 3300020081 | Ga0206354_11508322 | Ga0206354_115083223 | 74 |
| 13 | 3300025321 | Ga0207656_10000084 | Ga0207656_1000008420 | 74 |
| 14 | 3300025911 | Ga0207654_10514160 | Ga0207654_105141603 | 74 |
| 15 | 3300025927 | Ga0207687_10007940 | Ga0207687_100079403 | 74 |
| 16 | 3300025981 | Ga0207640_10000074 | Ga0207640_1000007433 | 74 |
| 17 | 3300048911 | Ga0496108_0852014 | Ga0496108_0852014_304_567 | 74 |
| 18 | 3300048913 | Ga0496110_0001478 | Ga0496110_0001478_13131_13355 | 74 |
| 19 | 3300048914 | Ga0496111_0000011 | Ga0496111_0000011_75039_75263 | 74 |
| 20 | 3300048915 | Ga0496112_0001978 | Ga0496112_0001978_2520_2744 | 74 |
| 21 | 3300048916 | Ga0496113_0000001 | Ga0496113_0000001_49387_49611 | 74 |
| 22 | 3300053085 | Ga0495619_0000054 | Ga0495619_0000054_81404_81628 | 74 |
| 23 | 3300005981 | Ga0081538_10003665 | Ga0081538_1000366518 | 75 |
| 24 | 3300005981 | Ga0081538_10021381 | Ga0081538_100213812 | 75 |
| 25 | 3300006028 | Ga0070717_10655261 | Ga0070717_106552612 | 75 |
| 26 | 3300006846 | Ga0075430_100207375 | Ga0075430_1002073753 | 75 |
| 27 | 3300006881 | Ga0068865_101203008 | Ga0068865_1012030082 | 75 |
| 28 | 3300021377 | Ga0213874_10002023 | Ga0213874_100020236 | 75 |
| 29 | 3300021384 | Ga0213876_10039437 | Ga0213876_100394372 | 75 |
| 30 | 3300021388 | Ga0213875_10008642 | Ga0213875_100086422 | 75 |
| 31 | 3300025938 | Ga0207704_11007057 | Ga0207704_110070572 | 75 |
| 32 | 3300031731 | Ga0307405_11079910 | Ga0307405_110799102 | 75 |
| 33 | 3300031995 | Ga0307409_100861027 | Ga0307409_1008610272 | 75 |
| 34 | 3300032002 | Ga0307416_100114724 | Ga0307416_1001147243 | 75 |
| 35 | 3300032002 | Ga0307416_100958318 | Ga0307416_1009583182 | 75 |
| 36 | 3300032126 | Ga0307415_100157517 | Ga0307415_1001575172 | 75 |
| 37 | 3300032126 | Ga0307415_100181510 | Ga0307415_1001815102 | 75 |
| 38 | 3300037853 | Ga0436364_0024637 | Ga0436364_0024637_222_449 | 75 |
| 39 | 3300037853 | Ga0436364_0376890 | Ga0436364_0376890_15390_15620 | 75 |
| 40 | 3300037853 | Ga0436364_0783784 | Ga0436364_0783784_34_264 | 75 |
| 41 | 3300038443 | Ga0395901_1865672 | Ga0395901_1865672_99_326 | 75 |
| 42 | 3300039437 | Ga0436365_1367936 | Ga0436365_1367936_9351_9581 | 75 |
| 43 | 3300039450 | Ga0436363_0002721 | Ga0436363_0002721_2037_2267 | 75 |
| 44 | 3300039450 | Ga0436363_0224773 | Ga0436363_0224773_163_390 | 75 |
| 45 | 3300039453 | Ga0436362_0474970 | Ga0436362_0474970_293_520 | 75 |
| 46 | 3300039453 | Ga0436362_0660486 | Ga0436362_0660486_1547_1777 | 75 |
| 47 | 3300047673 | Ga0495593_0229284 | Ga0495593_0229284_40_267 | 75 |
| 48 | 3300048907 | Ga0496104_0303896 | Ga0496104_0303896_202_429 | 75 |
| 49 | 3300048908 | Ga0496105_0027709 | Ga0496105_0027709_2455_2682 | 75 |
| 50 | 3300049573 | Ga0501037_0612039 | Ga0501037_0612039_184_411 | 75 |
| 51 | 3300049583 | Ga0501067_0287194 | Ga0501067_0287194_645_872 | 75 |
| 52 | 3300049586 | Ga0501070_0855364 | Ga0501070_0855364_474_701 | 75 |
| 53 | 3300049589 | Ga0501073_0199297 | Ga0501073_0199297_132_359 | 75 |
| 54 | 3300054114 | Ga0501084_1061558 | Ga0501084_1061558_208_435 | 75 |
| 55 | 3300005329 | Ga0070683_100000534 | Ga0070683_10000053415 | 76 |
| 56 | 3300005329 | Ga0070683_100042035 | Ga0070683_1000420355 | 76 |
| 57 | 3300005329 | Ga0070683_100066423 | Ga0070683_1000664233 | 76 |
| 58 | 3300005329 | Ga0070683_100609905 | Ga0070683_1006099053 | 76 |
| 59 | 3300005329 | Ga0070683_101711816 | Ga0070683_1017118161 | 76 |
| 60 | 3300005331 | Ga0070670_100012696 | Ga0070670_1000126969 | 76 |
| 61 | 3300005333 | Ga0070677_10000016 | Ga0070677_1000001643 | 76 |
| 62 | 3300005338 | Ga0068868_100000634 | Ga0068868_10000063422 | 76 |
| 63 | 3300005340 | Ga0070689_100035506 | Ga0070689_1000355062 | 76 |
| 64 | 3300005344 | Ga0070661_100000004 | Ga0070661_10000000455 | 76 |
| 65 | 3300005345 | Ga0070692_10249464 | Ga0070692_102494642 | 76 |
| 66 | 3300005347 | Ga0070668_100229753 | Ga0070668_1002297533 | 76 |
| 67 | 3300005354 | Ga0070675_100000078 | Ga0070675_10000007816 | 76 |
| 68 | 3300005365 | Ga0070688_100000705 | Ga0070688_1000007057 | 76 |
| 69 | 3300005365 | Ga0070688_100000989 | Ga0070688_1000009894 | 76 |
| 70 | 3300005365 | Ga0070688_100038370 | Ga0070688_1000383702 | 76 |
| 71 | 3300005435 | Ga0070714_100056443 | Ga0070714_1000564434 | 76 |
| 72 | 3300005439 | Ga0070711_101980285 | Ga0070711_1019802851 | 76 |
| 73 | 3300005455 | Ga0070663_100255156 | Ga0070663_1002551561 | 76 |
| 74 | 3300005456 | Ga0070678_100758567 | Ga0070678_1007585671 | 76 |
| 75 | 3300005466 | Ga0070685_10000012 | Ga0070685_1000001221 | 76 |
| 76 | 3300005466 | Ga0070685_10001134 | Ga0070685_1000113414 | 76 |
| 77 | 3300005466 | Ga0070685_10009582 | Ga0070685_100095823 | 76 |
| 78 | 3300005530 | Ga0070679_100434295 | Ga0070679_1004342952 | 76 |
| 79 | 3300005535 | Ga0070684_100010265 | Ga0070684_10001026510 | 76 |
| 80 | 3300005535 | Ga0070684_100108799 | Ga0070684_1001087992 | 76 |
| 81 | 3300005535 | Ga0070684_100299780 | Ga0070684_1002997803 | 76 |
| 82 | 3300005539 | Ga0068853_100489064 | Ga0068853_1004890641 | 76 |
| 83 | 3300005543 | Ga0070672_100000049 | Ga0070672_10000004932 | 76 |
| 84 | 3300005564 | Ga0070664_100107085 | Ga0070664_1001070855 | 76 |
| 85 | 3300005564 | Ga0070664_100391299 | Ga0070664_1003912993 | 76 |
| 86 | 3300005614 | Ga0068856_100000377 | Ga0068856_10000037733 | 76 |
| 87 | 3300005614 | Ga0068856_100007632 | Ga0068856_1000076329 | 76 |
| 88 | 3300005616 | Ga0068852_100000022 | Ga0068852_100000022111 | 76 |
| 89 | 3300005618 | Ga0068864_100000023 | Ga0068864_100000023194 | 76 |
| 90 | 3300005840 | Ga0068870_10060649 | Ga0068870_100606492 | 76 |
| 91 | 3300006353 | Ga0075370_10446601 | Ga0075370_104466012 | 76 |
| 92 | 3300006880 | Ga0075429_101662113 | Ga0075429_1016621132 | 76 |
| 93 | 3300006881 | Ga0068865_100000135 | Ga0068865_10000013527 | 76 |
| 94 | 3300009148 | Ga0105243_10032044 | Ga0105243_100320446 | 76 |
| 95 | 3300009148 | Ga0105243_12570181 | Ga0105243_125701812 | 76 |
| 96 | 3300009177 | Ga0105248_12549506 | Ga0105248_125495061 | 76 |
| 97 | 3300010375 | Ga0105239_10048810 | Ga0105239_100488108 | 76 |
| 98 | 3300013102 | Ga0157371_10004879 | Ga0157371_100048795 | 76 |
| 99 | 3300013104 | Ga0157370_10245860 | Ga0157370_102458603 | 76 |
| 100 | 3300013105 | Ga0157369_10000014 | Ga0157369_10000014194 | 76 |
| 101 | 3300013297 | Ga0157378_10001375 | Ga0157378_1000137521 | 76 |
| 102 | 3300013297 | Ga0157378_12565241 | Ga0157378_125652412 | 76 |
| 103 | 3300013306 | Ga0163162_10571135 | Ga0163162_105711352 | 76 |
| 104 | 3300014969 | Ga0157376_10008488 | Ga0157376_100084884 | 76 |
| 105 | 3300020069 | Ga0197907_10402958 | Ga0197907_104029581 | 76 |
| 106 | 3300020070 | Ga0206356_10730229 | Ga0206356_107302292 | 76 |
| 107 | 3300020070 | Ga0206356_11112838 | Ga0206356_111128385 | 76 |
| 108 | 3300020070 | Ga0206356_11522892 | Ga0206356_115228921 | 76 |
| 109 | 3300020080 | Ga0206350_11222552 | Ga0206350_112225522 | 76 |
| 110 | 3300020082 | Ga0206353_11526258 | Ga0206353_115262583 | 76 |
| 111 | 3300022467 | Ga0224712_10003498 | Ga0224712_100034983 | 76 |
| 112 | 3300025893 | Ga0207682_10000008 | Ga0207682_1000000890 | 76 |
| 113 | 3300025920 | Ga0207649_10000003 | Ga0207649_10000003204 | 76 |
| 114 | 3300025921 | Ga0207652_10800946 | Ga0207652_108009461 | 76 |
| 115 | 3300025925 | Ga0207650_10052709 | Ga0207650_100527094 | 76 |
| 116 | 3300025926 | Ga0207659_10000018 | Ga0207659_10000018122 | 76 |
| 117 | 3300025929 | Ga0207664_10099589 | Ga0207664_100995891 | 76 |
| 118 | 3300025935 | Ga0207709_10019423 | Ga0207709_100194233 | 76 |
| 119 | 3300025936 | Ga0207670_10011901 | Ga0207670_100119013 | 76 |
| 120 | 3300025938 | Ga0207704_10000026 | Ga0207704_1000002679 | 76 |
| 121 | 3300025940 | Ga0207691_10000002 | Ga0207691_1000000286 | 76 |
| 122 | 3300025941 | Ga0207711_10000192 | Ga0207711_1000019256 | 76 |
| 123 | 3300025944 | Ga0207661_10000247 | Ga0207661_1000024719 | 76 |
| 124 | 3300025944 | Ga0207661_10036898 | Ga0207661_100368985 | 76 |
| 125 | 3300025944 | Ga0207661_10087085 | Ga0207661_100870852 | 76 |
| 126 | 3300025944 | Ga0207661_10646601 | Ga0207661_106466011 | 76 |
| 127 | 3300025945 | Ga0207679_10125964 | Ga0207679_101259645 | 76 |
| 128 | 3300025945 | Ga0207679_10359070 | Ga0207679_103590703 | 76 |
| 129 | 3300025972 | Ga0207668_10013940 | Ga0207668_100139403 | 76 |
| 130 | 3300026023 | Ga0207677_10000534 | Ga0207677_100005349 | 76 |
| 131 | 3300026041 | Ga0207639_10147348 | Ga0207639_101473483 | 76 |
| 132 | 3300026067 | Ga0207678_10265616 | Ga0207678_102656162 | 76 |
| 133 | 3300026075 | Ga0207708_11420455 | Ga0207708_114204552 | 76 |
| 134 | 3300026078 | Ga0207702_10000085 | Ga0207702_1000008544 | 76 |
| 135 | 3300026078 | Ga0207702_10003306 | Ga0207702_100033063 | 76 |
| 136 | 3300026078 | Ga0207702_12055762 | Ga0207702_120557622 | 76 |
| 137 | 3300026089 | Ga0207648_11976455 | Ga0207648_119764551 | 76 |
| 138 | 3300026095 | Ga0207676_10000025 | Ga0207676_1000002584 | 76 |
| 139 | 3300026142 | Ga0207698_10000043 | Ga0207698_1000004314 | 76 |
| 140 | 3300028380 | Ga0268265_10180062 | Ga0268265_101800624 | 76 |
| 141 | 3300031731 | Ga0307405_11545933 | Ga0307405_115459332 | 76 |
| 142 | 3300031852 | Ga0307410_10532874 | Ga0307410_105328742 | 76 |
| 143 | 3300031901 | Ga0307406_10819830 | Ga0307406_108198302 | 76 |
| 144 | 3300031995 | Ga0307409_102607849 | Ga0307409_1026078491 | 76 |
| 145 | 3300032002 | Ga0307416_100214075 | Ga0307416_1002140751 | 76 |
| 146 | 3300032004 | Ga0307414_10393171 | Ga0307414_103931712 | 76 |
| 147 | 3300032126 | Ga0307415_100117828 | Ga0307415_1001178283 | 76 |
| 148 | 3300032126 | Ga0307415_100351615 | Ga0307415_1003516152 | 76 |
| 149 | 3300032126 | Ga0307415_101024542 | Ga0307415_1010245422 | 76 |
| 150 | 3300039437 | Ga0436365_1109014 | Ga0436365_1109014_137_367 | 76 |
| 151 | 3300039437 | Ga0436365_1454726 | Ga0436365_1454726_267_497 | 76 |
| 152 | 3300039437 | Ga0436365_1625495 | Ga0436365_1625495_43_273 | 76 |
| 153 | 3300039437 | Ga0436365_1772279 | Ga0436365_1772279_59_328 | 76 |
| 154 | 3300039453 | Ga0436362_0865685 | Ga0436362_0865685_443_673 | 76 |
| 155 | 3300044694 | Ga0466963_0000318 | Ga0466963_0000318_11337_11567 | 76 |
| 156 | 3300044694 | Ga0466963_0030956 | Ga0466963_0030956_97_327 | 76 |
| 157 | 3300044706 | Ga0466964_0458787 | Ga0466964_0458787_166_396 | 76 |
| 158 | 3300044719 | Ga0466971_0132944 | Ga0466971_0132944_137_367 | 76 |
| 159 | 3300044842 | Ga0466957_0571530 | Ga0466957_0571530_49_279 | 76 |
| 160 | 3300044842 | Ga0466957_1344515 | Ga0466957_1344515_238_468 | 76 |
| 161 | 3300045049 | Ga0466959_0194628 | Ga0466959_0194628_437_667 | 76 |
| 162 | 3300045836 | Ga0466958_0127199 | Ga0466958_0127199_1267_1497 | 76 |
| 163 | 3300045976 | Ga0466967_0000006 | Ga0466967_0000006_5775_6005 | 76 |
| 164 | 3300045976 | Ga0466967_0017758 | Ga0466967_0017758_1041_1271 | 76 |
| 165 | 3300045976 | Ga0466967_0641688 | Ga0466967_0641688_546_782 | 76 |
| 166 | 3300045976 | Ga0466967_1484690 | Ga0466967_1484690_37_267 | 76 |
| 167 | 3300045976 | Ga0466967_1637910 | Ga0466967_1637910_175_405 | 76 |
| 168 | 3300046473 | Ga0495582_0268485 | Ga0495582_0268485_383_613 | 76 |
| 169 | 3300046517 | Ga0495630_0001103 | Ga0495630_0001103_5104_5334 | 76 |
| 170 | 3300046523 | Ga0495644_0000618 | Ga0495644_0000618_10870_11100 | 76 |
| 171 | 3300046531 | Ga0495665_0028459 | Ga0495665_0028459_1416_1652 | 76 |
| 172 | 3300046543 | Ga0495645_0011486 | Ga0495645_0011486_3085_3315 | 76 |
| 173 | 3300046683 | Ga0495658_0001081 | Ga0495658_0001081_5571_5801 | 76 |
| 174 | 3300047315 | Ga0495581_0039060 | Ga0495581_0039060_871_1107 | 76 |
| 175 | 3300047446 | Ga0495679_030237 | Ga0495679_030237_1267_1497 | 76 |
| 176 | 3300048088 | Ga0495602_0541485 | Ga0495602_0541485_486_716 | 76 |
| 177 | 3300048911 | Ga0496108_0000005 | Ga0496108_0000005_184670_184900 | 76 |
| 178 | 3300048911 | Ga0496108_0017081 | Ga0496108_0017081_1594_1824 | 76 |
| 179 | 3300048911 | Ga0496108_0226842 | Ga0496108_0226842_161_391 | 76 |
| 180 | 3300048912 | Ga0496109_0000002 | Ga0496109_0000002_350192_350422 | 76 |
| 181 | 3300048913 | Ga0496110_0273341 | Ga0496110_0273341_445_675 | 76 |
| 182 | 3300048914 | Ga0496111_0865055 | Ga0496111_0865055_348_578 | 76 |
| 183 | 3300048915 | Ga0496112_0000006 | Ga0496112_0000006_176371_176601 | 76 |
| 184 | 3300048915 | Ga0496112_1334951 | Ga0496112_1334951_126_356 | 76 |
| 185 | 3300048916 | Ga0496113_0002405 | Ga0496113_0002405_2357_2587 | 76 |
| 186 | 3300048916 | Ga0496113_0020389 | Ga0496113_0020389_3607_3837 | 76 |
| 187 | 3300048916 | Ga0496113_0103252 | Ga0496113_0103252_1947_2177 | 76 |
| 188 | 3300048916 | Ga0496113_0321449 | Ga0496113_0321449_158_388 | 76 |
| 189 | 3300049587 | Ga0501071_0621217 | Ga0501071_0621217_511_741 | 76 |
| 190 | 3300049592 | Ga0501076_0688219 | Ga0501076_0688219_410_640 | 76 |
| 191 | 3300049743 | Ga0501081_1516970 | Ga0501081_1516970_24_254 | 76 |
| 192 | 3300050490 | nmdc:mga03n38_277193_c1 | nmdc:mga03n38_277193_c1_273_509 | 76 |
| 193 | 3300050509 | nmdc:mga0qj67_496353_c1 | nmdc:mga0qj67_496353_c1_345_578 | 76 |
| 194 | 3300061719 | Ga0466962_0552261 | Ga0466962_0552261_183_413 | 76 |
| 195 | 3300001977 | JGI24746J21847_1000010 | JGI24746J21847_100001020 | 77 |
| 196 | 3300002459 | JGI24751J29686_10054428 | JGI24751J29686_100544282 | 77 |
| 197 | 3300005338 | Ga0068868_100003834 | Ga0068868_1000038348 | 77 |
| 198 | 3300005547 | Ga0070693_100000307 | Ga0070693_10000030726 | 77 |
| 199 | 3300006173 | Ga0070716_100596321 | Ga0070716_1005963212 | 77 |
| 200 | 3300006844 | Ga0075428_100022919 | Ga0075428_1000229194 | 77 |
| 201 | 3300006844 | Ga0075428_100153368 | Ga0075428_1001533683 | 77 |
| 202 | 3300006844 | Ga0075428_101071749 | Ga0075428_1010717492 | 77 |
| 203 | 3300006844 | Ga0075428_101910052 | Ga0075428_1019100522 | 77 |
| 204 | 3300006846 | Ga0075430_100041528 | Ga0075430_1000415285 | 77 |
| 205 | 3300006847 | Ga0075431_100046387 | Ga0075431_1000463872 | 77 |
| 206 | 3300006847 | Ga0075431_100181733 | Ga0075431_1001817331 | 77 |
| 207 | 3300006880 | Ga0075429_100001934 | Ga0075429_1000019346 | 77 |
| 208 | 3300006880 | Ga0075429_101567087 | Ga0075429_1015670872 | 77 |
| 209 | 3300009094 | Ga0111539_10511488 | Ga0111539_105114882 | 77 |
| 210 | 3300009147 | Ga0114129_10371040 | Ga0114129_103710401 | 77 |
| 211 | 3300009147 | Ga0114129_11619702 | Ga0114129_116197021 | 77 |
| 212 | 3300009147 | Ga0114129_13302564 | Ga0114129_133025642 | 77 |
| 213 | 3300012507 | Ga0157342_1031294 | Ga0157342_10312942 | 77 |
| 214 | 3300013307 | Ga0157372_10902846 | Ga0157372_109028461 | 77 |
| 215 | 3300014325 | Ga0163163_10796426 | Ga0163163_107964263 | 77 |
| 216 | 3300014326 | Ga0157380_10807002 | Ga0157380_108070022 | 77 |
| 217 | 3300021377 | Ga0213874_10467397 | Ga0213874_104673971 | 77 |
| 218 | 3300021384 | Ga0213876_10015706 | Ga0213876_100157063 | 77 |
| 219 | 3300021384 | Ga0213876_10663072 | Ga0213876_106630722 | 77 |
| 220 | 3300021388 | Ga0213875_10012434 | Ga0213875_100124341 | 77 |
| 221 | 3300026023 | Ga0207677_10000308 | Ga0207677_1000030818 | 77 |
| 222 | 3300026088 | Ga0207641_11422311 | Ga0207641_114223112 | 77 |
| 223 | 3300031824 | Ga0307413_12044459 | Ga0307413_120444591 | 77 |
| 224 | 3300031995 | Ga0307409_101737045 | Ga0307409_1017370451 | 77 |
| 225 | 3300032002 | Ga0307416_101756751 | Ga0307416_1017567511 | 77 |
| 226 | 3300032005 | Ga0307411_10458940 | Ga0307411_104589401 | 77 |
| 227 | 3300037466 | Ga0395898_1501755 | Ga0395898_1501755_195_428 | 77 |
| 228 | 3300039437 | Ga0436365_0202901 | Ga0436365_0202901_3974_4207 | 77 |
| 229 | 3300039437 | Ga0436365_0769762 | Ga0436365_0769762_302_538 | 77 |
| 230 | 3300039437 | Ga0436365_1113673 | Ga0436365_1113673_316_552 | 77 |
| 231 | 3300039450 | Ga0436363_1719013 | Ga0436363_1719013_513_746 | 77 |
| 232 | 3300039453 | Ga0436362_1266156 | Ga0436362_1266156_142_375 | 77 |
| 233 | 3300041459 | Ga0451800_1689789 | Ga0451800_1689789_301_534 | 77 |
| 234 | 3300041501 | Ga0451845_0296743 | Ga0451845_0296743_390_623 | 77 |
| 235 | 3300041512 | Ga0451853_2063636 | Ga0451853_2063636_183_419 | 77 |
| 236 | 3300044656 | Ga0466969_0422727 | Ga0466969_0422727_298_531 | 77 |
| 237 | 3300044683 | Ga0466965_0047352 | Ga0466965_0047352_1004_1237 | 77 |
| 238 | 3300044684 | Ga0466966_0286948 | Ga0466966_0286948_613_846 | 77 |
| 239 | 3300044684 | Ga0466966_0352600 | Ga0466966_0352600_560_796 | 77 |
| 240 | 3300044693 | Ga0466961_0042396 | Ga0466961_0042396_2380_2613 | 77 |
| 241 | 3300044693 | Ga0466961_0214049 | Ga0466961_0214049_457_693 | 77 |
| 242 | 3300044693 | Ga0466961_0911558 | Ga0466961_0911558_225_458 | 77 |
| 243 | 3300044694 | Ga0466963_0007267 | Ga0466963_0007267_3958_4194 | 77 |
| 244 | 3300044694 | Ga0466963_0027453 | Ga0466963_0027453_1095_1328 | 77 |
| 245 | 3300044694 | Ga0466963_0356178 | Ga0466963_0356178_498_731 | 77 |
| 246 | 3300044694 | Ga0466963_0812167 | Ga0466963_0812167_380_616 | 77 |
| 247 | 3300044706 | Ga0466964_0391051 | Ga0466964_0391051_215_451 | 77 |
| 248 | 3300044706 | Ga0466964_0679647 | Ga0466964_0679647_241_474 | 77 |
| 249 | 3300044719 | Ga0466971_0051386 | Ga0466971_0051386_132_365 | 77 |
| 250 | 3300044735 | Ga0466968_0055746 | Ga0466968_0055746_724_957 | 77 |
| 251 | 3300044735 | Ga0466968_0624750 | Ga0466968_0624750_117_353 | 77 |
| 252 | 3300044765 | Ga0466970_0698179 | Ga0466970_0698179_230_463 | 77 |
| 253 | 3300044842 | Ga0466957_0002012 | Ga0466957_0002012_7485_7718 | 77 |
| 254 | 3300045049 | Ga0466959_0094236 | Ga0466959_0094236_161_394 | 77 |
| 255 | 3300045049 | Ga0466959_0264652 | Ga0466959_0264652_677_910 | 77 |
| 256 | 3300045049 | Ga0466959_0367798 | Ga0466959_0367798_314_547 | 77 |
| 257 | 3300045836 | Ga0466958_0011469 | Ga0466958_0011469_2063_2335 | 77 |
| 258 | 3300045836 | Ga0466958_0033777 | Ga0466958_0033777_680_916 | 77 |
| 259 | 3300045836 | Ga0466958_0060440 | Ga0466958_0060440_178_411 | 77 |
| 260 | 3300045836 | Ga0466958_0132538 | Ga0466958_0132538_819_1052 | 77 |
| 261 | 3300045836 | Ga0466958_0593476 | Ga0466958_0593476_402_638 | 77 |
| 262 | 3300045836 | Ga0466958_0603451 | Ga0466958_0603451_85_318 | 77 |
| 263 | 3300045976 | Ga0466967_0003124 | Ga0466967_0003124_3932_4165 | 77 |
| 264 | 3300045976 | Ga0466967_1582638 | Ga0466967_1582638_218_451 | 77 |
| 265 | 3300045976 | Ga0466967_2033990 | Ga0466967_2033990_159_392 | 77 |
| 266 | 3300046684 | Ga0495669_0000335 | Ga0495669_0000335_10345_10578 | 77 |
| 267 | 3300048903 | Ga0496100_0000007 | Ga0496100_0000007_32391_32624 | 77 |
| 268 | 3300048904 | Ga0496101_0000013 | Ga0496101_0000013_32391_32624 | 77 |
| 269 | 3300048909 | Ga0496106_0000006 | Ga0496106_0000006_26530_26763 | 77 |
| 270 | 3300048910 | Ga0496107_0000007 | Ga0496107_0000007_26532_26765 | 77 |
| 271 | 3300048914 | Ga0496111_0899855 | Ga0496111_0899855_334_567 | 77 |
| 272 | 3300048917 | Ga0496114_0022999 | Ga0496114_0022999_4067_4300 | 77 |
| 273 | 3300049586 | Ga0501070_0939182 | Ga0501070_0939182_258_494 | 77 |
| 274 | 3300049591 | Ga0501075_1330742 | Ga0501075_1330742_88_321 | 77 |
| 275 | 3300049824 | Ga0501045_0836917 | Ga0501045_0836917_64_297 | 77 |
| 276 | 3300050507 | nmdc:mga05p37_387894_c1 | nmdc:mga05p37_387894_c1_1148_1384 | 77 |
| 277 | 3300050507 | nmdc:mga05p37_717741_c1 | nmdc:mga05p37_717741_c1_829_1062 | 77 |
| 278 | 3300050508 | nmdc:mga09592_102911_c1 | nmdc:mga09592_102911_c1_1719_1952 | 77 |
| 279 | 3300050509 | nmdc:mga0qj67_87160_c1 | nmdc:mga0qj67_87160_c1_1649_1882 | 77 |
| 280 | 3300050510 | nmdc:mga06r32_110326_c1 | nmdc:mga06r32_110326_c1_1920_2156 | 77 |
| 281 | 3300050510 | nmdc:mga06r32_849327_c1 | nmdc:mga06r32_849327_c1_228_461 | 77 |
| 282 | 3300053085 | Ga0495619_0000564 | Ga0495619_0000564_12236_12469 | 77 |
| 283 | 3300059421 | Ga0590071_126902 | Ga0590071_126902_245_478 | 77 |
| 284 | 3300061719 | Ga0466962_0113396 | Ga0466962_0113396_572_805 | 77 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2d5k-assembly1.cif.gz_B | crystal structure of dps from staphylococcus aureus | 0.9855 | 17 | 71 |
| 7o91-assembly2.cif.gz_B | dimn-sulerythrin | 0.9829 | 15 | 73 |
| 2chp-assembly1.cif.gz_A | crystal structure of the dodecameric ferritin mrga from b. subtilis 168 | 0.9773 | 17 | 71 |
| 4di0-assembly1.cif.gz_A | the structure of rubrerythrin from burkholderia pseudomallei | 0.9764 | 16 | 71 |
| 2c41-assembly1.cif.gz_C | x-ray structure of dps from thermosynechococcus elongatus | 0.9602 | 24 | 71 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2d5kD00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.982 | 20 | 71 | 1.20.1260.10 |
| 2chpA00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9773 | 17 | 71 | 1.20.1260.10 |
| 4di0A00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9764 | 16 | 71 | 1.20.1260.10 |
| af_Q58156_13_77_1.20.1260.10 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9672 | 17 | 71 | 1.20.1260.10 |
| 2c41C01 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9671 | 24 | 70 | 1.20.1260.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A317N6H8-F1-model_v4 | Uncharacterized protein | 0.9987 | 13 | 77 |
|
| AF-A0A7V1RCE1-F1-model_v4 | Uncharacterized protein | 0.979 | 13 | 76 |
|
| AF-A0A7C5BUW2-F1-model_v4 | Sensor histidine kinase | 0.9748 | 13 | 76 |
GO:0016020
|
| AF-A0A0B6WZ06-F1-model_v4 | Rubrerythrin | 0.9736 | 9 | 76 |
|
| AF-A0A1V4WE32-F1-model_v4 | Uncharacterized protein | 0.9726 | 13 | 74 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar