F386345

General Info

Members Datasets Scaffolds Average Seq Length
284 167 568 349

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0081362|Ga0466963_0081362_200_1411
Length 403
Sequence VSDGRVARIGVVGLGYWGPNIARNVAENPRAELAWLCDRSPETLAAVAVRHPQVRTTTSYEELLEDPELDAVAIVTPVSTHYDLAAAALDADKHVLVEKPLAGSSEQAARLIELAAQRSLVLLPGHTFLYSPPVVKVKELLDAGALGEIYFISLSRVNLGLHQPDVSVVWDLAPHDLSILSFWLGGMPTEVSAVSRSCVLPESPDVAFVNLRFGAGTIAHLELSWLSPVKLRRTSIVGSEKMVIYDDTSNEPIRIFDAGAQLPAPETFGEFRLTYRTGDIVSPKIDAMEPLALEIDDFCAAILDDIETRSSPRLGYEVVRAVEAIERSLQSGGRPCSTADELDLEPTEADATLDADVLSLVHPQDAGWAPGHDRSGGDVASHNGSGSDDCVLPDAEAAEHDRA

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
69 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
70 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
94 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
95 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
96 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
97 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
98 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
99 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
100 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
101 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
102 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
109 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
110 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
111 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
112 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
113 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
119 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
120 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
121 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
122 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
123 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
126 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
127 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
128 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
129 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
130 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
131 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
132 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
133 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
134 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
135 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
136 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
137 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
138 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
139 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
144 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
145 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
154 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
155 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
156 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
159 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
160 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
164 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
165 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
166 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
167 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.24
Metatranscriptomes 1.76
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 14.79
Rhizosphere 83.1
Stem 0
Stem Tuber 0
Unclassified 2.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0081362 3300044694 Bacteria 2193
2 JGI25407J50210_10004898 3300003373 Bacteria 3271
3 Ga0070683_100005647 3300005329 Bacteria 10450
4 Ga0070683_100006088 3300005329 Bacteria 10115
5 Ga0070683_100006834 3300005329 Bacteria 9587
6 Ga0070666_10048166 3300005335 Bacteria 2863
7 Ga0070682_100011662 3300005337 Bacteria 5026
8 Ga0070682_100079761 3300005337 Bacteria 2115
9 Ga0068868_100030572 3300005338 Bacteria 4130
10 Ga0068868_100090705 3300005338 Bacteria 2462
11 Ga0070660_100067321 3300005339 Bacteria 2790
12 Ga0070692_10182123 3300005345 Bacteria 1218
13 Ga0070675_100139877 3300005354 Bacteria 2069
14 Ga0070673_100021211 3300005364 Bacteria 4703
15 Ga0070667_100202465 3300005367 Bacteria 1762
16 Ga0070714_100006120 3300005435 Bacteria 9249
17 Ga0070714_100425097 3300005435 Bacteria 1259
18 Ga0070705_100033915 3300005440 Bacteria 2849
19 Ga0070705_100035012 3300005440 Bacteria 2811
20 Ga0070705_100119998 3300005440 Bacteria 1696
21 Ga0070678_100027529 3300005456 Bacteria 3861
22 Ga0070681_10006067 3300005458 Bacteria 11719
23 Ga0070706_100113493 3300005467 Bacteria 2523
24 Ga0070698_100103654 3300005471 Bacteria 2815
25 Ga0070698_100188089 3300005471 Bacteria 2002
26 Ga0070699_100137017 3300005518 Bacteria 2160
27 Ga0070699_100206901 3300005518 Bacteria 1746
28 Ga0070679_100115310 3300005530 Bacteria 2672
29 Ga0070684_100004689 3300005535 Bacteria 10438
30 Ga0070684_100007806 3300005535 Bacteria 8342
31 Ga0070684_100072357 3300005535 Bacteria 3035
32 Ga0070684_100133778 3300005535 Bacteria 2238
33 Ga0070697_100229963 3300005536 Bacteria 1582
34 Ga0070695_100003153 3300005545 Bacteria 9616
35 Ga0070696_100074045 3300005546 Bacteria 2401
36 Ga0070665_100358954 3300005548 Bacteria 1463
37 Ga0070704_100087435 3300005549 Bacteria 2313
38 Ga0070664_100168287 3300005564 Bacteria 1943
39 Ga0068856_100002824 3300005614 Bacteria 17781
40 Ga0068856_100023821 3300005614 Bacteria 5955
41 Ga0068856_100455909 3300005614 Bacteria 1299
42 Ga0070702_100016839 3300005615 Bacteria 3760
43 Ga0068852_100067543 3300005616 Bacteria 3126
44 Ga0068858_100000088 3300005842 Bacteria 95138
45 Ga0068860_100212244 3300005843 Bacteria 1878
46 Ga0081455_10102662 3300005937 Bacteria 2292
47 Ga0081538_10000126 3300005981 Bacteria 77929
48 Ga0081539_10004465 3300005985 Bacteria 15422
49 Ga0081539_10018325 3300005985 Bacteria 4864
50 Ga0070717_10055872 3300006028 Bacteria 3259
51 Ga0097621_100020351 3300006237 Bacteria 5112
52 Ga0068871_100008153 3300006358 Bacteria 7525
53 Ga0068871_100125026 3300006358 Bacteria 2176
54 Ga0075428_100036229 3300006844 Bacteria 5435
55 Ga0075430_100042095 3300006846 Bacteria 3863
56 Ga0075430_100213304 3300006846 Bacteria 1602
57 Ga0075431_100004133 3300006847 Bacteria 14164
58 Ga0075433_10010301 3300006852 Bacteria 7497
59 Ga0075433_10050982 3300006852 Bacteria 3603
60 Ga0075434_100006209 3300006871 Bacteria 10946
61 Ga0075434_100082590 3300006871 Bacteria 3210
62 Ga0075429_100006182 3300006880 Bacteria 10351
63 Ga0075436_100003616 3300006914 Bacteria 10608
64 Ga0075435_100000572 3300007076 Bacteria 22520
65 Ga0075435_100048427 3300007076 Bacteria 3415
66 Ga0105240_10120785 3300009093 Bacteria 3155
67 Ga0111539_10009807 3300009094 Bacteria 12088
68 Ga0111539_10067847 3300009094 Bacteria 4211
69 Ga0111539_10291954 3300009094 Bacteria 1897
70 Ga0105245_10016764 3300009098 Bacteria 6397
71 Ga0105245_10215636 3300009098 Bacteria 1849
72 Ga0105245_10418781 3300009098 Bacteria 1342
73 Ga0105247_10010678 3300009101 Bacteria 5545
74 Ga0114129_10004311 3300009147 Bacteria 20107
75 Ga0114129_10004681 3300009147 Bacteria 19328
76 Ga0114129_10008420 3300009147 Bacteria 14693
77 Ga0114129_10026748 3300009147 Bacteria 8172
78 Ga0114129_10177873 3300009147 Bacteria 2897
79 Ga0114129_10197615 3300009147 Bacteria 2726
80 Ga0105243_10067552 3300009148 Unclassified 2878
81 Ga0105243_10326422 3300009148 Bacteria 1400
82 Ga0105241_10103754 3300009174 Bacteria 2264
83 Ga0105242_10003129 3300009176 Bacteria 12914
84 Ga0105248_10046454 3300009177 Bacteria 4866
85 Ga0105248_10189741 3300009177 Bacteria 2316
86 Ga0105239_10510864 3300010375 Bacteria 1367
87 Ga0157369_10002401 3300013105 Bacteria 22498
88 Ga0157374_10237369 3300013296 Bacteria 1792
89 Ga0157378_10008189 3300013297 Bacteria 9116
90 Ga0157372_10047710 3300013307 Bacteria 4760
91 Ga0157372_10210469 3300013307 Bacteria 2253
92 Ga0157375_10160113 3300013308 Bacteria 2392
93 Ga0157377_10021589 3300014745 Bacteria 3388
94 Ga0157379_10000486 3300014968 Bacteria 32204
95 Ga0157376_10002869 3300014969 Bacteria 11805
96 Ga0157376_10183465 3300014969 Bacteria 1914
97 Ga0197907_10647488 3300020069 Bacteria 3002
98 Ga0206356_10969781 3300020070 Bacteria 3978
99 Ga0206350_10214256 3300020080 Bacteria 2383
100 Ga0206354_11647763 3300020081 Bacteria 2100
101 Ga0213874_10003965 3300021377 Bacteria 3332
102 Ga0213874_10006766 3300021377 Bacteria 2726
103 Ga0213875_10000106 3300021388 Bacteria 95400
104 Ga0224712_10006533 3300022467 Bacteria 3334
105 Ga0207707_10041432 3300025912 Bacteria 4022
106 Ga0207707_10189212 3300025912 Bacteria 1796
107 Ga0207695_10167301 3300025913 Bacteria 2126
108 Ga0207671_10092671 3300025914 Bacteria 2278
109 Ga0207663_10191354 3300025916 Bacteria 1469
110 Ga0207652_10031362 3300025921 Bacteria 4464
111 Ga0207659_10095105 3300025926 Bacteria 2234
112 Ga0207687_10033921 3300025927 Bacteria 3464
113 Ga0207687_10066159 3300025927 Bacteria 2568
114 Ga0207687_10263437 3300025927 Bacteria 1375
115 Ga0207664_10005946 3300025929 Bacteria 8352
116 Ga0207664_10077322 3300025929 Bacteria 2696
117 Ga0207686_10007816 3300025934 Bacteria 5764
118 Ga0207686_10023325 3300025934 Bacteria 3572
119 Ga0207709_10008064 3300025935 Bacteria 5833
120 Ga0207689_10404334 3300025942 Bacteria 1138
121 Ga0207661_10002444 3300025944 Bacteria 12780
122 Ga0207661_10010199 3300025944 Bacteria 6755
123 Ga0207661_10296577 3300025944 Bacteria 1448
124 Ga0207679_10133340 3300025945 Bacteria 1996
125 Ga0207651_10019360 3300025960 Bacteria 4077
126 Ga0207677_10072612 3300026023 Bacteria 2433
127 Ga0207703_10000237 3300026035 Bacteria 62874
128 Ga0207703_10424778 3300026035 Bacteria 1237
129 Ga0207702_10002875 3300026078 Bacteria 16101
130 Ga0207702_10009205 3300026078 Bacteria 8304
131 Ga0207641_10111034 3300026088 Bacteria 2431
132 Ga0207676_10452418 3300026095 Bacteria 1211
133 Ga0207683_10000068 3300026121 Bacteria 78969
134 Ga0207428_10021284 3300027907 Bacteria 5493
135 Ga0268266_10285697 3300028379 Bacteria 1535
136 Ga0265326_10000017 3300028558 Bacteria 152436
137 Ga0265319_1018948 3300028563 Bacteria 2581
138 Ga0265318_10021857 3300028577 Bacteria 2564
139 Ga0265338_10014919 3300028800 Bacteria 8592
140 Ga0265338_10056798 3300028800 Bacteria 3467
141 Ga0265338_10164255 3300028800 Bacteria 1711
142 Ga0265320_10042117 3300031240 Bacteria 2267
143 Ga0265327_10006735 3300031251 Bacteria 9090
144 Ga0265327_10045427 3300031251 Bacteria 2334
145 Ga0373943_0037527 3300035170 Bacteria 2326
146 Ga0373943_0185175 3300035170 Unclassified 1146
147 Ga0373933_0139925 3300035724 Bacteria 1528
148 Ga0373947_0015810 3300035725 Bacteria 4335
149 Ga0373947_0040828 3300035725 Unclassified 2765
150 Ga0373925_0048272 3300037068 Bacteria 3172
151 Ga0373925_0057283 3300037068 Bacteria 2920
152 Ga0395899_0178250 3300037312 Bacteria 1493
153 Ga0395900_0010161 3300037418 Bacteria 9627
154 Ga0395900_0041359 3300037418 Bacteria 4752
155 Ga0395900_0209807 3300037418 Bacteria 1967
156 Ga0395898_0028065 3300037466 Bacteria 5644
157 Ga0395898_0032682 3300037466 Bacteria 5194
158 Ga0395898_0035153 3300037466 Unclassified 4987
159 Ga0395898_0424198 3300037466 Bacteria 1267
160 Ga0395905_0061391 3300037471 Bacteria 3516
161 Ga0395901_0015505 3300038443 Bacteria 7760
162 Ga0395901_0023812 3300038443 Bacteria 6279
163 Ga0395901_0101110 3300038443 Bacteria 3025
164 Ga0395901_0124993 3300038443 Bacteria 2703
165 Ga0395901_0441595 3300038443 Bacteria 1332
166 Ga0436363_0100847 3300039450 Bacteria 2567
167 Ga0436363_0385777 3300039450 Bacteria 3866
168 Ga0436363_0781227 3300039450 Bacteria 4124
169 Ga0466965_0039111 3300044683 Bacteria 2331
170 Ga0466961_0066458 3300044693 Bacteria 2290
171 Ga0466963_0004961 3300044694 Bacteria 7762
172 Ga0466963_0007370 3300044694 Bacteria 6553
173 Ga0466963_0048114 3300044694 Bacteria 2816
174 Ga0466964_0020418 3300044706 Bacteria 2551
175 Ga0466971_0014170 3300044719 Bacteria 3505
176 Ga0466971_0019342 3300044719 Bacteria 3023
177 Ga0466957_0022679 3300044842 Bacteria 3705
178 Ga0466957_0179966 3300044842 Unclassified 1380
179 Ga0466959_0075895 3300045049 Bacteria 2428
180 Ga0466959_0087753 3300045049 Bacteria 2237
181 Ga0451576_0014797 3300045051 Bacteria 8672
182 Ga0466958_0048537 3300045836 Bacteria 2566
183 Ga0466967_0001554 3300045976 Bacteria 13458
184 Ga0466967_0003143 3300045976 Bacteria 10633
185 Ga0466967_0005538 3300045976 Bacteria 8765
186 Ga0466967_0037220 3300045976 Bacteria 4162
187 Ga0466967_0074463 3300045976 Bacteria 3050
188 Ga0466967_0144820 3300045976 Bacteria 2216
189 Ga0466967_0174132 3300045976 Bacteria 2026
190 Ga0466967_0403007 3300045976 Bacteria 1331
191 Ga0495603_0062303 3300046455 Bacteria 2202
192 Ga0495641_0017181 3300046461 Bacteria 3779
193 Ga0495641_0046197 3300046461 Bacteria 2003
194 Ga0495651_0051375 3300046462 Bacteria 3178
195 Ga0495653_0028486 3300046463 Bacteria 4466
196 Ga0495608_0011012 3300046511 Bacteria 6303
197 Ga0495618_0061795 3300046514 Bacteria 2376
198 Ga0495630_0009772 3300046517 Bacteria 6904
199 Ga0495640_0015207 3300046533 Bacteria 5795
200 Ga0495645_0000147 3300046543 Bacteria 48283
201 Ga0495645_0161514 3300046543 Bacteria 1549
202 Ga0495635_0002587 3300046663 Bacteria 12381
203 Ga0495659_0016344 3300046664 Bacteria 2447
204 Ga0495657_0018587 3300046675 Bacteria 5024
205 Ga0495647_0006169 3300046681 Bacteria 3958
206 Ga0495658_0003641 3300046683 Bacteria 7629
207 Ga0495581_0011053 3300047315 Bacteria 5217
208 Ga0495674_0052913 3300047319 Bacteria 3571
209 Ga0495674_0158209 3300047319 Bacteria 1897
210 Ga0495676_0052046 3300047321 Bacteria 3272
211 Ga0495680_0041157 3300047322 Bacteria 3675
212 Ga0495680_0047846 3300047322 Bacteria 3361
213 Ga0495684_0039381 3300047471 Bacteria 3623
214 Ga0495614_0036071 3300048089 Bacteria 2123
215 Ga0496100_0006999 3300048903 Bacteria 6187
216 Ga0496100_0009136 3300048903 Bacteria 5561
217 Ga0496101_0001717 3300048904 Bacteria 13120
218 Ga0496101_0056669 3300048904 Bacteria 2833
219 Ga0496102_0001331 3300048905 Bacteria 22170
220 Ga0496102_0009045 3300048905 Bacteria 8547
221 Ga0496102_0218808 3300048905 Bacteria 1795
222 Ga0496103_0003316 3300048906 Bacteria 9850
223 Ga0496103_0013867 3300048906 Bacteria 4785
224 Ga0496104_0000534 3300048907 Bacteria 32696
225 Ga0496104_0070782 3300048907 Bacteria 3316
226 Ga0496105_0001375 3300048908 Bacteria 17103
227 Ga0496105_0418444 3300048908 Bacteria 1061
228 Ga0496106_0002134 3300048909 Bacteria 14777
229 Ga0496106_0073021 3300048909 Bacteria 2624
230 Ga0496107_0000703 3300048910 Bacteria 19082
231 Ga0496107_0010531 3300048910 Bacteria 6426
232 Ga0496107_0132480 3300048910 Bacteria 1840
233 Ga0496108_0000398 3300048911 Bacteria 35931
234 Ga0496108_0001118 3300048911 Bacteria 20979
235 Ga0496108_0042775 3300048911 Bacteria 3783
236 Ga0496108_0151681 3300048911 Bacteria 2000
237 Ga0496109_0000285 3300048912 Bacteria 48300
238 Ga0496109_0000671 3300048912 Bacteria 28349
239 Ga0496109_0020267 3300048912 Bacteria 5873
240 Ga0496109_0124586 3300048912 Unclassified 2402
241 Ga0496109_0334177 3300048912 Bacteria 1430
242 Ga0496110_0005866 3300048913 Bacteria 9659
243 Ga0496112_0000510 3300048915 Bacteria 26376
244 Ga0496112_0202769 3300048915 Bacteria 1942
245 Ga0496112_0211214 3300048915 Bacteria 1898
246 Ga0496112_0341751 3300048915 Bacteria 1440
247 Ga0496113_0055335 3300048916 Bacteria 2974
248 Ga0496113_0105228 3300048916 Bacteria 2191
249 Ga0496114_0000507 3300048917 Bacteria 28521
250 Ga0496114_0000555 3300048917 Bacteria 27670
251 Ga0496114_0009398 3300048917 Bacteria 7762
252 Ga0496114_0014822 3300048917 Bacteria 6265
253 Ga0496115_0012523 3300048918 Bacteria 6387
254 Ga0496115_0187344 3300048918 Bacteria 1710
255 Ga0496115_0218854 3300048918 Bacteria 1572
256 Ga0496115_0286845 3300048918 Unclassified 1351
257 Ga0501067_0000804 3300049583 Bacteria 16905
258 Ga0501067_0006045 3300049583 Bacteria 6711
259 Ga0501067_0029890 3300049583 Bacteria 3020
260 Ga0501069_0046052 3300049585 Bacteria 2418
261 Ga0501069_0047324 3300049585 Bacteria 2387
262 Ga0501072_0064940 3300049588 Bacteria 2878
263 Ga0501079_0257910 3300049741 Bacteria 1363
264 nmdc:mga05p37_222758_c1 3300050507 Bacteria 2276
265 nmdc:mga05p37_66186_c1 3300050507 Bacteria 4445
266 nmdc:mga09592_71792_c1 3300050508 Bacteria 2939
267 nmdc:mga0qj67_7413_c1 3300050509 Bacteria 8109
268 nmdc:mga06r32_29359_c1 3300050510 Bacteria 5152
269 nmdc:mga06r32_89553_c1 3300050510 Bacteria 3005
270 nmdc:mga08y16_2586_c1 3300050511 Bacteria 18610
271 nmdc:mga08y16_71496_c1 3300050511 Bacteria 3615
272 nmdc:mga0n895_60332_c1 3300050512 Bacteria 3743
273 nmdc:mga0n895_60516_c1 3300050512 Bacteria 3737
274 nmdc:mga0rr50_1397_c1 3300050513 Bacteria 13223
275 nmdc:mga0rr50_36225_c1 3300050513 Bacteria 3551
276 nmdc:mga0rr50_36784_c1 3300050513 Bacteria 3528
277 nmdc:mga08x19_149703_c1 3300050514 Bacteria 1580
278 nmdc:mga08x19_80567_c1 3300050514 Bacteria 2137
279 Ga0495619_0000042 3300053085 Bacteria 112453
280 Ga0495619_0004427 3300053085 Bacteria 8961
281 Ga0495619_0051022 3300053085 Bacteria 2733
282 Ga0466962_0006407 3300061719 Bacteria 5650
283 Ga0466962_0021994 3300061719 Bacteria 3063
284 Ga0530510_0072430 3300061734 Bacteria 2501
285 Ga0466963_0081362
286 JGI25407J50210_10004898
287 Ga0070683_100005647
288 Ga0070683_100006088
289 Ga0070683_100006834
290 Ga0070666_10048166
291 Ga0070682_100011662
292 Ga0070682_100079761
293 Ga0068868_100030572
294 Ga0068868_100090705
295 Ga0070660_100067321
296 Ga0070692_10182123
297 Ga0070675_100139877
298 Ga0070673_100021211
299 Ga0070667_100202465
300 Ga0070714_100006120
301 Ga0070714_100425097
302 Ga0070705_100033915
303 Ga0070705_100035012
304 Ga0070705_100119998
305 Ga0070678_100027529
306 Ga0070681_10006067
307 Ga0070706_100113493
308 Ga0070698_100103654
309 Ga0070698_100188089
310 Ga0070699_100137017
311 Ga0070699_100206901
312 Ga0070679_100115310
313 Ga0070684_100004689
314 Ga0070684_100007806
315 Ga0070684_100072357
316 Ga0070684_100133778
317 Ga0070697_100229963
318 Ga0070695_100003153
319 Ga0070696_100074045
320 Ga0070665_100358954
321 Ga0070704_100087435
322 Ga0070664_100168287
323 Ga0068856_100002824
324 Ga0068856_100023821
325 Ga0068856_100455909
326 Ga0070702_100016839
327 Ga0068852_100067543
328 Ga0068858_100000088
329 Ga0068860_100212244
330 Ga0081455_10102662
331 Ga0081538_10000126
332 Ga0081539_10004465
333 Ga0081539_10018325
334 Ga0070717_10055872
335 Ga0097621_100020351
336 Ga0068871_100008153
337 Ga0068871_100125026
338 Ga0075428_100036229
339 Ga0075430_100042095
340 Ga0075430_100213304
341 Ga0075431_100004133
342 Ga0075433_10010301
343 Ga0075433_10050982
344 Ga0075434_100006209
345 Ga0075434_100082590
346 Ga0075429_100006182
347 Ga0075436_100003616
348 Ga0075435_100000572
349 Ga0075435_100048427
350 Ga0105240_10120785
351 Ga0111539_10009807
352 Ga0111539_10067847
353 Ga0111539_10291954
354 Ga0105245_10016764
355 Ga0105245_10215636
356 Ga0105245_10418781
357 Ga0105247_10010678
358 Ga0114129_10004311
359 Ga0114129_10004681
360 Ga0114129_10008420
361 Ga0114129_10026748
362 Ga0114129_10177873
363 Ga0114129_10197615
364 Ga0105243_10067552
365 Ga0105243_10326422
366 Ga0105241_10103754
367 Ga0105242_10003129
368 Ga0105248_10046454
369 Ga0105248_10189741
370 Ga0105239_10510864
371 Ga0157369_10002401
372 Ga0157374_10237369
373 Ga0157378_10008189
374 Ga0157372_10047710
375 Ga0157372_10210469
376 Ga0157375_10160113
377 Ga0157377_10021589
378 Ga0157379_10000486
379 Ga0157376_10002869
380 Ga0157376_10183465
381 Ga0197907_10647488
382 Ga0206356_10969781
383 Ga0206350_10214256
384 Ga0206354_11647763
385 Ga0213874_10003965
386 Ga0213874_10006766
387 Ga0213875_10000106
388 Ga0224712_10006533
389 Ga0207707_10041432
390 Ga0207707_10189212
391 Ga0207695_10167301
392 Ga0207671_10092671
393 Ga0207663_10191354
394 Ga0207652_10031362
395 Ga0207659_10095105
396 Ga0207687_10033921
397 Ga0207687_10066159
398 Ga0207687_10263437
399 Ga0207664_10005946
400 Ga0207664_10077322
401 Ga0207686_10007816
402 Ga0207686_10023325
403 Ga0207709_10008064
404 Ga0207689_10404334
405 Ga0207661_10002444
406 Ga0207661_10010199
407 Ga0207661_10296577
408 Ga0207679_10133340
409 Ga0207651_10019360
410 Ga0207677_10072612
411 Ga0207703_10000237
412 Ga0207703_10424778
413 Ga0207702_10002875
414 Ga0207702_10009205
415 Ga0207641_10111034
416 Ga0207676_10452418
417 Ga0207683_10000068
418 Ga0207428_10021284
419 Ga0268266_10285697
420 Ga0265326_10000017
421 Ga0265319_1018948
422 Ga0265318_10021857
423 Ga0265338_10014919
424 Ga0265338_10056798
425 Ga0265338_10164255
426 Ga0265320_10042117
427 Ga0265327_10006735
428 Ga0265327_10045427
429 Ga0373943_0037527
430 Ga0373943_0185175
431 Ga0373933_0139925
432 Ga0373947_0015810
433 Ga0373947_0040828
434 Ga0373925_0048272
435 Ga0373925_0057283
436 Ga0395899_0178250
437 Ga0395900_0010161
438 Ga0395900_0041359
439 Ga0395900_0209807
440 Ga0395898_0028065
441 Ga0395898_0032682
442 Ga0395898_0035153
443 Ga0395898_0424198
444 Ga0395905_0061391
445 Ga0395901_0015505
446 Ga0395901_0023812
447 Ga0395901_0101110
448 Ga0395901_0124993
449 Ga0395901_0441595
450 Ga0436363_0100847
451 Ga0436363_0385777
452 Ga0436363_0781227
453 Ga0466965_0039111
454 Ga0466961_0066458
455 Ga0466963_0004961
456 Ga0466963_0007370
457 Ga0466963_0048114
458 Ga0466964_0020418
459 Ga0466971_0014170
460 Ga0466971_0019342
461 Ga0466957_0022679
462 Ga0466957_0179966
463 Ga0466959_0075895
464 Ga0466959_0087753
465 Ga0451576_0014797
466 Ga0466958_0048537
467 Ga0466967_0001554
468 Ga0466967_0003143
469 Ga0466967_0005538
470 Ga0466967_0037220
471 Ga0466967_0074463
472 Ga0466967_0144820
473 Ga0466967_0174132
474 Ga0466967_0403007
475 Ga0495603_0062303
476 Ga0495641_0017181
477 Ga0495641_0046197
478 Ga0495651_0051375
479 Ga0495653_0028486
480 Ga0495608_0011012
481 Ga0495618_0061795
482 Ga0495630_0009772
483 Ga0495640_0015207
484 Ga0495645_0000147
485 Ga0495645_0161514
486 Ga0495635_0002587
487 Ga0495659_0016344
488 Ga0495657_0018587
489 Ga0495647_0006169
490 Ga0495658_0003641
491 Ga0495581_0011053
492 Ga0495674_0052913
493 Ga0495674_0158209
494 Ga0495676_0052046
495 Ga0495680_0041157
496 Ga0495680_0047846
497 Ga0495684_0039381
498 Ga0495614_0036071
499 Ga0496100_0006999
500 Ga0496100_0009136
501 Ga0496101_0001717
502 Ga0496101_0056669
503 Ga0496102_0001331
504 Ga0496102_0009045
505 Ga0496102_0218808
506 Ga0496103_0003316
507 Ga0496103_0013867
508 Ga0496104_0000534
509 Ga0496104_0070782
510 Ga0496105_0001375
511 Ga0496105_0418444
512 Ga0496106_0002134
513 Ga0496106_0073021
514 Ga0496107_0000703
515 Ga0496107_0010531
516 Ga0496107_0132480
517 Ga0496108_0000398
518 Ga0496108_0001118
519 Ga0496108_0042775
520 Ga0496108_0151681
521 Ga0496109_0000285
522 Ga0496109_0000671
523 Ga0496109_0020267
524 Ga0496109_0124586
525 Ga0496109_0334177
526 Ga0496110_0005866
527 Ga0496112_0000510
528 Ga0496112_0202769
529 Ga0496112_0211214
530 Ga0496112_0341751
531 Ga0496113_0055335
532 Ga0496113_0105228
533 Ga0496114_0000507
534 Ga0496114_0000555
535 Ga0496114_0009398
536 Ga0496114_0014822
537 Ga0496115_0012523
538 Ga0496115_0187344
539 Ga0496115_0218854
540 Ga0496115_0286845
541 Ga0501067_0000804
542 Ga0501067_0006045
543 Ga0501067_0029890
544 Ga0501069_0046052
545 Ga0501069_0047324
546 Ga0501072_0064940
547 Ga0501079_0257910
548 nmdc:mga05p37_222758_c1
549 nmdc:mga05p37_66186_c1
550 nmdc:mga09592_71792_c1
551 nmdc:mga0qj67_7413_c1
552 nmdc:mga06r32_29359_c1
553 nmdc:mga06r32_89553_c1
554 nmdc:mga08y16_2586_c1
555 nmdc:mga08y16_71496_c1
556 nmdc:mga0n895_60332_c1
557 nmdc:mga0n895_60516_c1
558 nmdc:mga0rr50_1397_c1
559 nmdc:mga0rr50_36225_c1
560 nmdc:mga0rr50_36784_c1
561 nmdc:mga08x19_149703_c1
562 nmdc:mga08x19_80567_c1
563 Ga0495619_0000042
564 Ga0495619_0004427
565 Ga0495619_0051022
566 Ga0466962_0006407
567 Ga0466962_0021994
568 Ga0530510_0072430

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

7

126

0.97

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

134

244

0.93

PF03447

NAD_binding_3

Homoserine dehydrogenase, NAD binding domain

13

123

0.92

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

138

337

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bvj-assembly4.cif.gz_D udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.9269 26 351
7bvk-assembly2.cif.gz_B udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p212121) 0.9245 26 351
7bvj-assembly3.cif.gz_C udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.9184 26 351
7bvj-assembly4.cif.gz_D udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.9152 26 351
7bvj-assembly1.cif.gz_A udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.913 26 351
ID Description Score Start End Superfamily
3e18B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9584 26 145 3.40.50.720
3e18A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9541 27 145 3.40.50.720
3rbvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9468 26 150 3.40.50.720
af_P77376_2_121_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9408 24 145 3.90.1150.10
af_Q2G1E6_2_122_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9373 28 143 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A535DBZ8-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9691 28 168 GO:0000166
GO:0003824
AF-A0A3M1P1U7-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9678 23 241 GO:0000166
GO:0016491
AF-A0A6V8P6A7-F1-model_v4 Gfo/Idh/MocA-like oxidoreductase N-terminal domain-containing protein 0.9604 27 103 GO:0000166
AF-A0A538AFB7-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9604 78 168 GO:0000166
GO:0016491
AF-A0A2V8W3V3-F1-model_v4 Gfo/Idh/MocA-like oxidoreductase N-terminal domain-containing protein 0.9599 26 168 GO:0000166

Map