F386299

General Info

Members Datasets Scaffolds Average Seq Length
284 201 568 113

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_1100051|Ga0373937_1100051_348_704
Length 118
Sequence MQAVQALLQPNTLQASLFPPASRYAGLDTGAIERPDGTAIVYVRRRFIAQPERFALLLEHLVVQGERLDTITARYLGDPEQFWRICDANAVIAPEELEQVGRTLRITLPEGIPGQEEQ

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
89 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
122 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
134 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
135 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
136 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
137 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
138 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
139 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
140 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
141 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
142 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
143 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
144 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
155 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
168 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
169 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
170 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
171 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
172 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
173 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
174 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
175 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
176 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
177 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
178 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
179 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
180 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
181 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
182 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
183 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
186 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
187 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
190 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
196 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
197 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
198 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
199 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
200 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
201 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.3
Metatranscriptomes 0.7
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.11
Nodule 0
Rhizoplane 4.23
Rhizosphere 92.96
Stem 0
Stem Tuber 0
Unclassified 28.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_1100051 3300036401 Unclassified 743
2 Ga0065712_10073897 3300005290 Bacteria 4247
3 Ga0065715_10091235 3300005293 Bacteria 5970
4 Ga0070676_10194148 3300005328 Unclassified 1327
5 Ga0070683_100231135 3300005329 Unclassified 1758
6 Ga0070683_101157626 3300005329 Unclassified 743
7 Ga0070690_100261246 3300005330 Bacteria 1228
8 Ga0070670_100087989 3300005331 Bacteria 2670
9 Ga0070670_100453797 3300005331 Unclassified 1136
10 Ga0070670_100565764 3300005331 Bacteria 1015
11 Ga0068869_101037083 3300005334 Unclassified 715
12 Ga0070682_100052021 3300005337 Unclassified 2562
13 Ga0070682_100118182 3300005337 Bacteria 1776
14 Ga0070660_100032659 3300005339 Bacteria 3919
15 Ga0070689_100020389 3300005340 Unclassified 4917
16 Ga0070661_100025467 3300005344 Bacteria 4252
17 Ga0070661_100987046 3300005344 Bacteria 698
18 Ga0070668_100582574 3300005347 Unclassified 977
19 Ga0070675_100054445 3300005354 Bacteria 3292
20 Ga0070671_100038879 3300005355 Bacteria 3949
21 Ga0070671_100064317 3300005355 Bacteria 3055
22 Ga0070674_100040044 3300005356 Bacteria 3168
23 Ga0070674_100693156 3300005356 Unclassified 870
24 Ga0070673_100034574 3300005364 Bacteria 3826
25 Ga0070673_100111521 3300005364 Unclassified 2269
26 Ga0070673_101851831 3300005364 Unclassified 572
27 Ga0070688_100086340 3300005365 Bacteria 2041
28 Ga0070659_100020312 3300005366 Bacteria 5044
29 Ga0070667_101152323 3300005367 Unclassified 725
30 Ga0070703_10142192 3300005406 Bacteria 893
31 Ga0070701_10260194 3300005438 Bacteria 1051
32 Ga0070705_101298787 3300005440 Bacteria 603
33 Ga0070700_101642749 3300005441 Unclassified 550
34 Ga0070694_100503717 3300005444 Bacteria 964
35 Ga0070708_100000299 3300005445 Bacteria 37193
36 Ga0070708_100081144 3300005445 Bacteria 2936
37 Ga0070708_100862942 3300005445 Bacteria 850
38 Ga0070663_100060139 3300005455 Unclassified 2732
39 Ga0070663_100214695 3300005455 Bacteria 1508
40 Ga0070678_101447823 3300005456 Unclassified 642
41 Ga0070662_100139938 3300005457 Unclassified 1874
42 Ga0070681_10014527 3300005458 Bacteria 7836
43 Ga0070681_11693795 3300005458 Bacteria 558
44 Ga0070706_100001593 3300005467 Bacteria 23652
45 Ga0070706_100023806 3300005467 Bacteria 5638
46 Ga0070706_100152962 3300005467 Bacteria 2154
47 Ga0070707_100002110 3300005468 Bacteria 19055
48 Ga0070707_100519882 3300005468 Unclassified 1152
49 Ga0070707_100546647 3300005468 Bacteria 1120
50 Ga0070707_101042096 3300005468 Bacteria 784
51 Ga0070698_100060552 3300005471 Bacteria 3821
52 Ga0070698_100754481 3300005471 Bacteria 916
53 Ga0070698_100859542 3300005471 Bacteria 852
54 Ga0070699_100273168 3300005518 Bacteria 1513
55 Ga0070699_100563554 3300005518 Bacteria 1037
56 Ga0070679_100110006 3300005530 Unclassified 2742
57 Ga0070684_100998670 3300005535 Unclassified 785
58 Ga0070697_100000140 3300005536 Bacteria 58765
59 Ga0070697_100002233 3300005536 Bacteria 14855
60 Ga0068853_100012548 3300005539 Bacteria 6893
61 Ga0068853_101690784 3300005539 Bacteria 613
62 Ga0070672_100128108 3300005543 Bacteria 2084
63 Ga0070695_100141399 3300005545 Bacteria 1669
64 Ga0070696_100018140 3300005546 Bacteria 4754
65 Ga0070693_101076360 3300005547 Unclassified 612
66 Ga0070693_101249053 3300005547 Bacteria 572
67 Ga0070665_100253100 3300005548 Unclassified 1762
68 Ga0070704_100017412 3300005549 Unclassified 4570
69 Ga0068855_100175622 3300005563 Unclassified 2424
70 Ga0070664_100010698 3300005564 Bacteria 7440
71 Ga0070664_100017490 3300005564 Bacteria 5888
72 Ga0068857_100019637 3300005577 Bacteria 5937
73 Ga0068857_100557468 3300005577 Bacteria 1080
74 Ga0068857_101173419 3300005577 Unclassified 743
75 Ga0068854_100820304 3300005578 Unclassified 812
76 Ga0070702_101227412 3300005615 Bacteria 605
77 Ga0070702_101808645 3300005615 Bacteria 510
78 Ga0068852_100321810 3300005616 Bacteria 1502
79 Ga0068859_100048837 3300005617 Bacteria 4251
80 Ga0068859_100477289 3300005617 Bacteria 1342
81 Ga0068859_101310373 3300005617 Unclassified 798
82 Ga0068859_102580785 3300005617 Bacteria 559
83 Ga0068864_100019477 3300005618 Bacteria 5674
84 Ga0068864_100098476 3300005618 Bacteria 2590
85 Ga0068864_100434282 3300005618 Bacteria 1253
86 Ga0068861_101695610 3300005719 Unclassified 625
87 Ga0068851_10740417 3300005834 Unclassified 607
88 Ga0068870_10002566 3300005840 Bacteria 7594
89 Ga0068870_10971486 3300005840 Unclassified 604
90 Ga0068863_102314180 3300005841 Unclassified 547
91 Ga0068858_100037871 3300005842 Bacteria 4472
92 Ga0068858_101769264 3300005842 Unclassified 610
93 Ga0068860_100011867 3300005843 Bacteria 8590
94 Ga0068860_101015145 3300005843 Unclassified 848
95 Ga0068862_100052522 3300005844 Unclassified 3487
96 Ga0068862_100076799 3300005844 Bacteria 2891
97 Ga0081539_10112353 3300005985 Bacteria 1368
98 Ga0075365_10059595 3300006038 Bacteria 2545
99 Ga0075364_10412384 3300006051 Unclassified 922
100 Ga0075428_100841948 3300006844 Bacteria 974
101 Ga0075431_100458272 3300006847 Bacteria 1270
102 Ga0075433_10293593 3300006852 Bacteria 1439
103 Ga0075434_100427494 3300006871 Bacteria 1346
104 Ga0075436_100222643 3300006914 Bacteria 1339
105 Ga0097620_100048835 3300006931 Bacteria 4251
106 Ga0097620_100477301 3300006931 Bacteria 1342
107 Ga0097620_100905162 3300006931 Bacteria 967
108 Ga0097620_101310212 3300006931 Unclassified 798
109 Ga0097620_102580657 3300006931 Bacteria 559
110 Ga0075435_100665229 3300007076 Bacteria 904
111 Ga0111539_10049499 3300009094 Bacteria 5010
112 Ga0111539_10363957 3300009094 Unclassified 1683
113 Ga0105247_10242897 3300009101 Bacteria 1228
114 Ga0114129_10967275 3300009147 Unclassified 1074
115 Ga0105241_10148338 3300009174 Unclassified 1916
116 Ga0105241_11166190 3300009174 Bacteria 728
117 Ga0105248_10011129 3300009177 Bacteria 9927
118 Ga0105248_10057108 3300009177 Bacteria 4380
119 Ga0105238_12590843 3300009551 Unclassified 543
120 Ga0105249_10672261 3300009553 Bacteria 1094
121 Ga0105249_12668851 3300009553 Unclassified 572
122 Ga0105239_10036590 3300010375 Bacteria 5389
123 Ga0105246_10939534 3300011119 Bacteria 778
124 Ga0157373_10021393 3300013100 Bacteria 4699
125 Ga0157373_10592072 3300013100 Bacteria 807
126 Ga0157374_10120828 3300013296 Bacteria 2528
127 Ga0157378_11296423 3300013297 Unclassified 769
128 Ga0163162_11746844 3300013306 Unclassified 711
129 Ga0157372_10034586 3300013307 Bacteria 5556
130 Ga0157372_10471824 3300013307 Bacteria 1463
131 Ga0157375_10676848 3300013308 Unclassified 1187
132 Ga0157375_11155430 3300013308 Bacteria 907
133 Ga0157375_12622820 3300013308 Unclassified 602
134 Ga0163163_10463674 3300014325 Unclassified 1327
135 Ga0157380_10089873 3300014326 Unclassified 2532
136 Ga0157380_10202146 3300014326 Bacteria 1764
137 Ga0157380_10292118 3300014326 Bacteria 1497
138 Ga0157380_12084790 3300014326 Unclassified 630
139 Ga0157380_13406924 3300014326 Bacteria 509
140 Ga0157379_10213865 3300014968 Unclassified 1746
141 Ga0182007_10176827 3300015262 Bacteria 736
142 Ga0206349_1244232 3300020075 Bacteria 717
143 Ga0206353_11182085 3300020082 Bacteria 928
144 Ga0207645_10216583 3300025907 Unclassified 1262
145 Ga0207643_10050523 3300025908 Bacteria 2358
146 Ga0207684_10001536 3300025910 Bacteria 24717
147 Ga0207657_10166766 3300025919 Unclassified 1786
148 Ga0207649_10010144 3300025920 Bacteria 5170
149 Ga0207652_10026809 3300025921 Bacteria 4802
150 Ga0207646_10003167 3300025922 Bacteria 18830
151 Ga0207646_10315342 3300025922 Bacteria 1413
152 Ga0207646_11670931 3300025922 Unclassified 548
153 Ga0207650_10067241 3300025925 Bacteria 2689
154 Ga0207650_10716178 3300025925 Bacteria 846
155 Ga0207659_10097992 3300025926 Bacteria 2204
156 Ga0207687_10981984 3300025927 Bacteria 724
157 Ga0207690_10083797 3300025932 Unclassified 2233
158 Ga0207706_10176820 3300025933 Unclassified 1875
159 Ga0207670_11054586 3300025936 Bacteria 685
160 Ga0207669_10341384 3300025937 Bacteria 1154
161 Ga0207691_10140000 3300025940 Bacteria 2133
162 Ga0207711_10030025 3300025941 Bacteria 4585
163 Ga0207661_10018586 3300025944 Bacteria 5166
164 Ga0207661_11352291 3300025944 Unclassified 654
165 Ga0207679_10008411 3300025945 Bacteria 6575
166 Ga0207679_11250706 3300025945 Unclassified 681
167 Ga0207679_12034831 3300025945 Bacteria 522
168 Ga0207667_10136611 3300025949 Unclassified 2525
169 Ga0207658_11022146 3300025986 Bacteria 754
170 Ga0207703_10060985 3300026035 Bacteria 3086
171 Ga0207703_11306576 3300026035 Unclassified 698
172 Ga0207639_10569222 3300026041 Unclassified 1042
173 Ga0207639_11398902 3300026041 Bacteria 657
174 Ga0207641_11183174 3300026088 Bacteria 764
175 Ga0207676_10033288 3300026095 Bacteria 3893
176 Ga0207676_10039788 3300026095 Bacteria 3599
177 Ga0207676_10382870 3300026095 Bacteria 1310
178 Ga0207674_10000851 3300026116 Bacteria 39823
179 Ga0207674_10301317 3300026116 Bacteria 1552
180 Ga0207674_11315268 3300026116 Bacteria 692
181 Ga0207674_11739394 3300026116 Unclassified 591
182 Ga0207675_101199482 3300026118 Bacteria 779
183 Ga0207698_11184796 3300026142 Unclassified 778
184 Ga0207698_11586753 3300026142 Bacteria 670
185 Ga0268265_10027580 3300028380 Unclassified 4055
186 Ga0268265_10056167 3300028380 Bacteria 2994
187 Ga0268264_10007821 3300028381 Bacteria 8895
188 Ga0307408_100006007 3300031548 Bacteria 8080
189 Ga0316576_10137296 3300031727 Bacteria 1840
190 Ga0316578_10000216 3300031728 Bacteria 16611
191 Ga0307405_10023447 3300031731 Bacteria 3507
192 Ga0307413_10009133 3300031824 Bacteria 4727
193 Ga0307410_10009883 3300031852 Bacteria 5377
194 Ga0307406_10022338 3300031901 Bacteria 3752
195 Ga0307407_10057142 3300031903 Bacteria 2262
196 Ga0307412_10013714 3300031911 Bacteria 4761
197 Ga0307412_11341056 3300031911 Unclassified 645
198 Ga0307409_100444594 3300031995 Bacteria 1250
199 Ga0307416_100016556 3300032002 Bacteria 5129
200 Ga0307416_100035412 3300032002 Bacteria 3812
201 Ga0307414_10006929 3300032004 Bacteria 6349
202 Ga0307415_100005575 3300032126 Bacteria 6699
203 Ga0316585_10000576 3300032137 Bacteria 8970
204 Ga0373936_0245268 3300035113 Unclassified 799
205 Ga0373939_0135611 3300035114 Unclassified 883
206 Ga0316574_0045958 3300035398 Bacteria 2705
207 Ga0373931_0039789 3300035691 Bacteria 2464
208 Ga0316582_0000225 3300036647 Bacteria 18544
209 Ga0316584_0000270 3300036712 Bacteria 26280
210 Ga0316584_0562155 3300036712 Bacteria 795
211 Ga0400491_23637 3300038727 Bacteria 3282
212 Ga0451853_0345243 3300041512 Bacteria 545
213 Ga0453684_0005526 3300044712 Bacteria 24950
214 Ga0495651_0708555 3300046462 Bacteria 627
215 Ga0495664_0713260 3300046477 Unclassified 592
216 Ga0495674_0702799 3300047319 Unclassified 793
217 Ga0496100_0128834 3300048903 Bacteria 1780
218 Ga0496104_0284682 3300048907 Bacteria 1566
219 Ga0496108_0073481 3300048911 Bacteria 2887
220 Ga0496109_0247307 3300048912 Bacteria 1679
221 Ga0496109_0369111 3300048912 Bacteria 1356
222 Ga0496110_0673235 3300048913 Bacteria 935
223 Ga0496110_1168246 3300048913 Bacteria 678
224 Ga0496111_0840764 3300048914 Bacteria 663
225 Ga0496112_0124847 3300048915 Unclassified 2545
226 Ga0496112_0385319 3300048915 Unclassified 1342
227 Ga0496112_0630839 3300048915 Bacteria 1002
228 Ga0496113_1456652 3300048916 Bacteria 529
229 Ga0501291_099319 3300049514 Unclassified 605
230 Ga0501032_0000536 3300049569 Bacteria 30812
231 Ga0501033_0082160 3300049570 Bacteria 2363
232 Ga0501036_0881457 3300049572 Bacteria 735
233 Ga0501037_0114965 3300049573 Bacteria 1937
234 Ga0501038_0176212 3300049574 Bacteria 1728
235 Ga0501038_0538495 3300049574 Unclassified 889
236 Ga0501039_0774021 3300049575 Bacteria 749
237 Ga0501040_0305492 3300049576 Bacteria 1137
238 Ga0501041_0104389 3300049577 Bacteria 1756
239 Ga0501041_0917203 3300049577 Unclassified 563
240 Ga0501043_0091101 3300049579 Bacteria 2397
241 Ga0501046_0000457 3300049580 Bacteria 40887
242 Ga0501046_0006376 3300049580 Bacteria 10459
243 Ga0501046_1165931 3300049580 Bacteria 530
244 Ga0501047_0003672 3300049581 Bacteria 14463
245 Ga0501047_0229934 3300049581 Unclassified 1708
246 Ga0501048_0760045 3300049582 Bacteria 696
247 Ga0501067_0008769 3300049583 Bacteria 5601
248 Ga0501068_0047717 3300049584 Bacteria 2584
249 Ga0501072_0365182 3300049588 Bacteria 1146
250 Ga0501076_0108402 3300049592 Bacteria 2243
251 Ga0501077_0000102 3300049593 Bacteria 44966
252 Ga0501198_006490 3300049649 Bacteria 1667
253 Ga0501199_004743 3300049650 Bacteria 1349
254 Ga0501202_000507 3300049652 Bacteria 5592
255 Ga0501207_005780 3300049654 Unclassified 1720
256 Ga0501217_002038 3300049661 Bacteria 3908
257 Ga0501223_001594 3300049663 Bacteria 5221
258 Ga0501224_001015 3300049664 Bacteria 3639
259 Ga0501227_012538 3300049665 Bacteria 1857
260 Ga0501256_012914 3300049685 Unclassified 818
261 Ga0501221_127885 3300049704 Unclassified 655
262 Ga0501225_0006209 3300049705 Bacteria 3490
263 Ga0501234_001766 3300049707 Bacteria 3405
264 Ga0501080_0030245 3300049742 Bacteria 5045
265 Ga0501268_113265 3300049765 Unclassified 594
266 Ga0501270_044017 3300049767 Unclassified 787
267 Ga0501035_0000576 3300049822 Bacteria 40518
268 Ga0501044_0000697 3300049823 Bacteria 40518
269 Ga0501226_000762 3300049853 Unclassified 4351
270 nmdc:mga0yw44_1231327_c1 3300050492 Bacteria 505
271 nmdc:mga05p37_57615_c1 3300050507 Bacteria 4785
272 nmdc:mga06r32_438611_c1 3300050510 Bacteria 1286
273 nmdc:mga08y16_144801_c1 3300050511 Bacteria 2470
274 nmdc:mga08y16_281137_c1 3300050511 Unclassified 1716
275 nmdc:mga08y16_874194_c1 3300050511 Bacteria 887
276 nmdc:mga0n895_54769_c1 3300050512 Bacteria 3924
277 nmdc:mga08x19_389942_c1 3300050514 Unclassified 976
278 nmdc:mga0a205_449231_c1 3300050515 Bacteria 1149
279 Ga0500643_182877 3300053087 Unclassified 562
280 Ga0500577_0121032 3300053142 Bacteria 1089
281 Ga0500627_0135624 3300053158 Bacteria 1112
282 Ga0501082_0000128 3300060353 Bacteria 61551
283 Ga0501082_1269164 3300060353 Bacteria 643
284 Ga0530510_0003676 3300061734 Bacteria 10556
285 Ga0373937_1100051
286 Ga0065712_10073897
287 Ga0065715_10091235
288 Ga0070676_10194148
289 Ga0070683_100231135
290 Ga0070683_101157626
291 Ga0070690_100261246
292 Ga0070670_100087989
293 Ga0070670_100453797
294 Ga0070670_100565764
295 Ga0068869_101037083
296 Ga0070682_100052021
297 Ga0070682_100118182
298 Ga0070660_100032659
299 Ga0070689_100020389
300 Ga0070661_100025467
301 Ga0070661_100987046
302 Ga0070668_100582574
303 Ga0070675_100054445
304 Ga0070671_100038879
305 Ga0070671_100064317
306 Ga0070674_100040044
307 Ga0070674_100693156
308 Ga0070673_100034574
309 Ga0070673_100111521
310 Ga0070673_101851831
311 Ga0070688_100086340
312 Ga0070659_100020312
313 Ga0070667_101152323
314 Ga0070703_10142192
315 Ga0070701_10260194
316 Ga0070705_101298787
317 Ga0070700_101642749
318 Ga0070694_100503717
319 Ga0070708_100000299
320 Ga0070708_100081144
321 Ga0070708_100862942
322 Ga0070663_100060139
323 Ga0070663_100214695
324 Ga0070678_101447823
325 Ga0070662_100139938
326 Ga0070681_10014527
327 Ga0070681_11693795
328 Ga0070706_100001593
329 Ga0070706_100023806
330 Ga0070706_100152962
331 Ga0070707_100002110
332 Ga0070707_100519882
333 Ga0070707_100546647
334 Ga0070707_101042096
335 Ga0070698_100060552
336 Ga0070698_100754481
337 Ga0070698_100859542
338 Ga0070699_100273168
339 Ga0070699_100563554
340 Ga0070679_100110006
341 Ga0070684_100998670
342 Ga0070697_100000140
343 Ga0070697_100002233
344 Ga0068853_100012548
345 Ga0068853_101690784
346 Ga0070672_100128108
347 Ga0070695_100141399
348 Ga0070696_100018140
349 Ga0070693_101076360
350 Ga0070693_101249053
351 Ga0070665_100253100
352 Ga0070704_100017412
353 Ga0068855_100175622
354 Ga0070664_100010698
355 Ga0070664_100017490
356 Ga0068857_100019637
357 Ga0068857_100557468
358 Ga0068857_101173419
359 Ga0068854_100820304
360 Ga0070702_101227412
361 Ga0070702_101808645
362 Ga0068852_100321810
363 Ga0068859_100048837
364 Ga0068859_100477289
365 Ga0068859_101310373
366 Ga0068859_102580785
367 Ga0068864_100019477
368 Ga0068864_100098476
369 Ga0068864_100434282
370 Ga0068861_101695610
371 Ga0068851_10740417
372 Ga0068870_10002566
373 Ga0068870_10971486
374 Ga0068863_102314180
375 Ga0068858_100037871
376 Ga0068858_101769264
377 Ga0068860_100011867
378 Ga0068860_101015145
379 Ga0068862_100052522
380 Ga0068862_100076799
381 Ga0081539_10112353
382 Ga0075365_10059595
383 Ga0075364_10412384
384 Ga0075428_100841948
385 Ga0075431_100458272
386 Ga0075433_10293593
387 Ga0075434_100427494
388 Ga0075436_100222643
389 Ga0097620_100048835
390 Ga0097620_100477301
391 Ga0097620_100905162
392 Ga0097620_101310212
393 Ga0097620_102580657
394 Ga0075435_100665229
395 Ga0111539_10049499
396 Ga0111539_10363957
397 Ga0105247_10242897
398 Ga0114129_10967275
399 Ga0105241_10148338
400 Ga0105241_11166190
401 Ga0105248_10011129
402 Ga0105248_10057108
403 Ga0105238_12590843
404 Ga0105249_10672261
405 Ga0105249_12668851
406 Ga0105239_10036590
407 Ga0105246_10939534
408 Ga0157373_10021393
409 Ga0157373_10592072
410 Ga0157374_10120828
411 Ga0157378_11296423
412 Ga0163162_11746844
413 Ga0157372_10034586
414 Ga0157372_10471824
415 Ga0157375_10676848
416 Ga0157375_11155430
417 Ga0157375_12622820
418 Ga0163163_10463674
419 Ga0157380_10089873
420 Ga0157380_10202146
421 Ga0157380_10292118
422 Ga0157380_12084790
423 Ga0157380_13406924
424 Ga0157379_10213865
425 Ga0182007_10176827
426 Ga0206349_1244232
427 Ga0206353_11182085
428 Ga0207645_10216583
429 Ga0207643_10050523
430 Ga0207684_10001536
431 Ga0207657_10166766
432 Ga0207649_10010144
433 Ga0207652_10026809
434 Ga0207646_10003167
435 Ga0207646_10315342
436 Ga0207646_11670931
437 Ga0207650_10067241
438 Ga0207650_10716178
439 Ga0207659_10097992
440 Ga0207687_10981984
441 Ga0207690_10083797
442 Ga0207706_10176820
443 Ga0207670_11054586
444 Ga0207669_10341384
445 Ga0207691_10140000
446 Ga0207711_10030025
447 Ga0207661_10018586
448 Ga0207661_11352291
449 Ga0207679_10008411
450 Ga0207679_11250706
451 Ga0207679_12034831
452 Ga0207667_10136611
453 Ga0207658_11022146
454 Ga0207703_10060985
455 Ga0207703_11306576
456 Ga0207639_10569222
457 Ga0207639_11398902
458 Ga0207641_11183174
459 Ga0207676_10033288
460 Ga0207676_10039788
461 Ga0207676_10382870
462 Ga0207674_10000851
463 Ga0207674_10301317
464 Ga0207674_11315268
465 Ga0207674_11739394
466 Ga0207675_101199482
467 Ga0207698_11184796
468 Ga0207698_11586753
469 Ga0268265_10027580
470 Ga0268265_10056167
471 Ga0268264_10007821
472 Ga0307408_100006007
473 Ga0316576_10137296
474 Ga0316578_10000216
475 Ga0307405_10023447
476 Ga0307413_10009133
477 Ga0307410_10009883
478 Ga0307406_10022338
479 Ga0307407_10057142
480 Ga0307412_10013714
481 Ga0307412_11341056
482 Ga0307409_100444594
483 Ga0307416_100016556
484 Ga0307416_100035412
485 Ga0307414_10006929
486 Ga0307415_100005575
487 Ga0316585_10000576
488 Ga0373936_0245268
489 Ga0373939_0135611
490 Ga0316574_0045958
491 Ga0373931_0039789
492 Ga0316582_0000225
493 Ga0316584_0000270
494 Ga0316584_0562155
495 Ga0400491_23637
496 Ga0451853_0345243
497 Ga0453684_0005526
498 Ga0495651_0708555
499 Ga0495664_0713260
500 Ga0495674_0702799
501 Ga0496100_0128834
502 Ga0496104_0284682
503 Ga0496108_0073481
504 Ga0496109_0247307
505 Ga0496109_0369111
506 Ga0496110_0673235
507 Ga0496110_1168246
508 Ga0496111_0840764
509 Ga0496112_0124847
510 Ga0496112_0385319
511 Ga0496112_0630839
512 Ga0496113_1456652
513 Ga0501291_099319
514 Ga0501032_0000536
515 Ga0501033_0082160
516 Ga0501036_0881457
517 Ga0501037_0114965
518 Ga0501038_0176212
519 Ga0501038_0538495
520 Ga0501039_0774021
521 Ga0501040_0305492
522 Ga0501041_0104389
523 Ga0501041_0917203
524 Ga0501043_0091101
525 Ga0501046_0000457
526 Ga0501046_0006376
527 Ga0501046_1165931
528 Ga0501047_0003672
529 Ga0501047_0229934
530 Ga0501048_0760045
531 Ga0501067_0008769
532 Ga0501068_0047717
533 Ga0501072_0365182
534 Ga0501076_0108402
535 Ga0501077_0000102
536 Ga0501198_006490
537 Ga0501199_004743
538 Ga0501202_000507
539 Ga0501207_005780
540 Ga0501217_002038
541 Ga0501223_001594
542 Ga0501224_001015
543 Ga0501227_012538
544 Ga0501256_012914
545 Ga0501221_127885
546 Ga0501225_0006209
547 Ga0501234_001766
548 Ga0501080_0030245
549 Ga0501268_113265
550 Ga0501270_044017
551 Ga0501035_0000576
552 Ga0501044_0000697
553 Ga0501226_000762
554 nmdc:mga0yw44_1231327_c1
555 nmdc:mga05p37_57615_c1
556 nmdc:mga06r32_438611_c1
557 nmdc:mga08y16_144801_c1
558 nmdc:mga08y16_281137_c1
559 nmdc:mga08y16_874194_c1
560 nmdc:mga0n895_54769_c1
561 nmdc:mga08x19_389942_c1
562 nmdc:mga0a205_449231_c1
563 Ga0500643_182877
564 Ga0500577_0121032
565 Ga0500627_0135624
566 Ga0501082_0000128
567 Ga0501082_1269164
568 Ga0530510_0003676

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7pvc-assembly1.cif.gz_A the structure of kbp.k from e. coli with potassium bound. 0.825 55 110
7vcm-assembly2.cif.gz_B crystal structure of ginko1 0.82 59 113
7vcm-assembly1.cif.gz_A crystal structure of ginko1 0.8194 59 113
5k2l-assembly1.cif.gz_A crystal structure of lysm domain from volvox carteri chitinase 0.788 59 108
5bum-assembly1.cif.gz_B crystal structure of lysm domain from equisetum arvense chitinase a 0.785 58 106
ID Description Score Start End Superfamily
5c8qB02 Alpha Beta;Roll;Membrane-bound Lytic Murein Transglycosylase D; Chain A;LysM domain 0.8699 59 108 3.10.350.10
5c8qB02 Alpha Beta;Roll;Membrane-bound Lytic Murein Transglycosylase D; Chain A;LysM domain 0.8372 59 108 3.10.350.10
af_Q9UUJ1_180_270_3.90.640.10 Alpha Beta;Alpha-Beta Complex;Actin; Chain A, domain 4;ATPase, substrate binding domain, subdomain 4 0.8297 30 44 3.90.640.10
af_K7MXH5_183_269_3.90.640.10 Alpha Beta;Alpha-Beta Complex;Actin; Chain A, domain 4;ATPase, substrate binding domain, subdomain 4 0.8213 30 44 3.90.640.10
5k2lA00 Alpha Beta;Roll;Membrane-bound Lytic Murein Transglycosylase D; Chain A;LysM domain 0.7884 59 108 3.10.350.10
ID Description Score Start End GO Terms
AF-A0A3N5RTC5-F1-model_v4 LysM domain-containing protein 0.9596 61 112
AF-K6W6W1-F1-model_v4 LysM domain-containing protein 0.9282 59 110
AF-A0A3N5RTC5-F1-model_v4 LysM domain-containing protein 0.9247 61 112
AF-A0A416GDS0-F1-model_v4 LysM domain-containing protein 0.9096 57 110 GO:0003677
GO:0005829
GO:0016020
GO:0030527
AF-A0A3P1Z264-F1-model_v4 LysM domain-containing protein 0.9092 56 110 GO:0003677
GO:0005829
GO:0016020
GO:0030527

Map