F386297

General Info

Members Datasets Scaffolds Average Seq Length
284 227 568 407

Family's Representative Sequence

Representative Sequence 3300035691|Ga0373931_0115497|Ga0373931_0115497_49_1437
Length 462
Sequence VAAGTGRRYIQHVSNNERTTCVVVGGGPAGMVLGLLLARAGVSVTVLEKHPDFLRDFRGDTVHASTLTLLDELGLGARFAALPQRRLERATVQLDSGTVQLGDLRRLPGPHKHIAMVPQWDLLDLLADAAAAEPTFTLRRNAEVTDVVRENDRIVGVRYTDRTDGSVHELRAALTVACDGRGSAVRAAAGLRSRAFGVPMDVWWFRLPRHADDPEGGIGRLGDGGFMVMIDRGSYWQCAYLIRKGSDAVLRGEGIAGFRARLTALQPWIADRVDTLGSFDDVKLLDVRLDRLRRWYADGLLLIGDAAHAMSPVGGVGINLAVQDAVAAARILAPALRANGSVPVPVLRRVQLRRWWPTALIQAGQRLAHRRILRPVLAGGGAQGNGQAGARPTGLNDRTGTEAPSASLPLPLRLVRRFPVLQGIPGRVIAIGPLPEHAPDWARRPELPVAATPRNPAGGPAQ

Samples

Sample ID Description Type Environment
1 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
127 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
128 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
129 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
130 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
131 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
136 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
137 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
144 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
145 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
146 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
147 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
148 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
149 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
150 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
151 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
154 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
155 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
156 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
157 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
158 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
159 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
160 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
161 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
162 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
163 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
164 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
165 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
166 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
167 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
168 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
169 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
183 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
184 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
185 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
186 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
195 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
199 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
200 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
203 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
204 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
205 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
206 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
207 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
208 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
209 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
210 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
211 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
212 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
213 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
214 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
215 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
216 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
217 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
218 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
219 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
220 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
221 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
222 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
223 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
224 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
225 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
226 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
227 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.25
Metatranscriptomes 0
Isolates 7.75

Biome Distribution

Category Percentage (%)
Aerial Root 0.35
Bulb 0
Endosphere 3.17
Nodule 0
Rhizoplane 4.93
Rhizosphere 82.04
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373931_0115497 3300035691 Bacteria 1528
2 JGI24744J21845_10001440 3300002077 Bacteria 4729
3 JGI25406J46586_10000332 3300003203 Bacteria 21310
4 Ga0070676_10010520 3300005328 Bacteria 5019
5 Ga0070690_100043862 3300005330 Bacteria 2837
6 Ga0068869_100020552 3300005334 Bacteria 4528
7 Ga0068869_100082607 3300005334 Bacteria 2401
8 Ga0070666_10030317 3300005335 Bacteria 3562
9 Ga0070682_100026838 3300005337 Bacteria 3450
10 Ga0070682_100143494 3300005337 Bacteria 1630
11 Ga0068868_100055165 3300005338 Bacteria 3134
12 Ga0070660_100135782 3300005339 Bacteria 1971
13 Ga0070689_100017272 3300005340 Bacteria 5295
14 Ga0070691_10048631 3300005341 Bacteria 2019
15 Ga0070687_100016383 3300005343 Bacteria 3380
16 Ga0070687_100101329 3300005343 Bacteria 1613
17 Ga0070668_100008477 3300005347 Bacteria 7635
18 Ga0070669_100028709 3300005353 Bacteria 4006
19 Ga0070675_100087953 3300005354 Bacteria 2599
20 Ga0070671_100242997 3300005355 Bacteria 1528
21 Ga0070688_100067626 3300005365 Bacteria 2276
22 Ga0070688_100126672 3300005365 Bacteria 1717
23 Ga0070659_100038383 3300005366 Bacteria 3735
24 Ga0070667_100064078 3300005367 Bacteria 3118
25 Ga0070709_10076997 3300005434 Bacteria 2167
26 Ga0070714_100089830 3300005435 Bacteria 2690
27 Ga0070710_10055168 3300005437 Bacteria 2244
28 Ga0070701_10021147 3300005438 Bacteria 3101
29 Ga0070700_100022503 3300005441 Bacteria 3676
30 Ga0070694_100059828 3300005444 Bacteria 2596
31 Ga0070663_100000376 3300005455 Bacteria 23513
32 Ga0070663_100095813 3300005455 Bacteria 2206
33 Ga0070678_100060754 3300005456 Bacteria 2783
34 Ga0070662_100020791 3300005457 Bacteria 4475
35 Ga0068867_100054843 3300005459 Bacteria 2945
36 Ga0070679_100131085 3300005530 Bacteria 2488
37 Ga0070697_100107135 3300005536 Bacteria 2325
38 Ga0068853_100058845 3300005539 Bacteria 3318
39 Ga0070695_100043981 3300005545 Bacteria 2841
40 Ga0070693_100022375 3300005547 Bacteria 3360
41 Ga0070693_100120330 3300005547 Bacteria 1627
42 Ga0070665_100090959 3300005548 Bacteria 3057
43 Ga0068855_100245125 3300005563 Bacteria 2000
44 Ga0070664_100047585 3300005564 Bacteria 3623
45 Ga0068856_100139131 3300005614 Bacteria 2434
46 Ga0070702_100002429 3300005615 Bacteria 8030
47 Ga0068852_100082039 3300005616 Bacteria 2864
48 Ga0068859_100163723 3300005617 Bacteria 2303
49 Ga0068866_10044440 3300005718 Bacteria 2222
50 Ga0068861_100133092 3300005719 Bacteria 2020
51 Ga0068863_100265723 3300005841 Bacteria 1659
52 Ga0068858_100038161 3300005842 Bacteria 4455
53 Ga0068858_100116131 3300005842 Bacteria 2501
54 Ga0068860_100149002 3300005843 Bacteria 2252
55 Ga0068860_100282747 3300005843 Bacteria 1622
56 Ga0068862_100085192 3300005844 Bacteria 2746
57 Ga0081455_10001170 3300005937 Bacteria 32840
58 Ga0081539_10000126 3300005985 Bacteria 180324
59 Ga0070717_10163276 3300006028 Bacteria 1934
60 Ga0075365_10052769 3300006038 Bacteria 2691
61 Ga0075364_10010332 3300006051 Bacteria 5634
62 Ga0070715_10008779 3300006163 Bacteria 3536
63 Ga0070716_100019454 3300006173 Bacteria 3549
64 Ga0075362_10012385 3300006177 Bacteria 3387
65 Ga0075369_10003668 3300006186 Bacteria 5608
66 Ga0068871_100022496 3300006358 Bacteria 4861
67 Ga0075428_100000335 3300006844 Bacteria 46700
68 Ga0075431_100038391 3300006847 Bacteria 4931
69 Ga0068865_100029771 3300006881 Bacteria 3626
70 Ga0068865_100167379 3300006881 Bacteria 1682
71 Ga0097620_100163710 3300006931 Bacteria 2303
72 Ga0105240_10183436 3300009093 Bacteria 2468
73 Ga0111539_10266452 3300009094 Bacteria 1994
74 Ga0105245_10077155 3300009098 Bacteria 3037
75 Ga0105245_10092486 3300009098 Bacteria 2785
76 Ga0105245_10125748 3300009098 Bacteria 2400
77 Ga0105247_10012120 3300009101 Bacteria 5183
78 Ga0105243_10143835 3300009148 Bacteria 2038
79 Ga0105243_10244308 3300009148 Bacteria 1599
80 Ga0105242_10071570 3300009176 Bacteria 2878
81 Ga0105238_10019486 3300009551 Bacteria 6909
82 Ga0105249_10011462 3300009553 Bacteria 7786
83 Ga0157370_10157519 3300013104 Bacteria 2113
84 Ga0157374_10010183 3300013296 Bacteria 8084
85 Ga0157374_10028759 3300013296 Bacteria 5024
86 Ga0163162_10063026 3300013306 Bacteria 3749
87 Ga0157372_10097247 3300013307 Bacteria 3357
88 Ga0157375_10035416 3300013308 Bacteria 4765
89 Ga0157375_10063000 3300013308 Bacteria 3687
90 Ga0157380_10033262 3300014326 Bacteria 3971
91 Ga0157377_10025613 3300014745 Bacteria 3148
92 Ga0157376_10262765 3300014969 Bacteria 1618
93 Ga0163161_10132011 3300017792 Bacteria 1885
94 Ga0213876_10037319 3300021384 Bacteria 2563
95 Ga0213875_10003582 3300021388 Bacteria 8803
96 Ga0209758_1001828 3300025297 Bacteria 23445
97 Ga0207682_10077025 3300025893 Bacteria 1422
98 Ga0207692_10006711 3300025898 Bacteria 4678
99 Ga0207642_10003952 3300025899 Bacteria 4726
100 Ga0207710_10007111 3300025900 Bacteria 4749
101 Ga0207688_10009750 3300025901 Bacteria 5227
102 Ga0207685_10002370 3300025905 Bacteria 4297
103 Ga0207699_10092077 3300025906 Bacteria 1905
104 Ga0207645_10078968 3300025907 Bacteria 2109
105 Ga0207684_10067423 3300025910 Bacteria 3041
106 Ga0207693_10004239 3300025915 Bacteria 12157
107 Ga0207663_10010277 3300025916 Bacteria 4974
108 Ga0207657_10040387 3300025919 Bacteria 4134
109 Ga0207657_10042539 3300025919 Bacteria 4007
110 Ga0207652_10170336 3300025921 Bacteria 1954
111 Ga0207659_10069248 3300025926 Bacteria 2569
112 Ga0207687_10017163 3300025927 Bacteria 4760
113 Ga0207664_10057124 3300025929 Bacteria 3101
114 Ga0207690_10056435 3300025932 Bacteria 2649
115 Ga0207706_10006954 3300025933 Bacteria 10457
116 Ga0207706_10043427 3300025933 Bacteria 3983
117 Ga0207686_10011376 3300025934 Bacteria 4873
118 Ga0207709_10012214 3300025935 Bacteria 4732
119 Ga0207670_10035061 3300025936 Bacteria 3250
120 Ga0207704_10095797 3300025938 Bacteria 1963
121 Ga0207665_10025145 3300025939 Bacteria 3928
122 Ga0207691_10054847 3300025940 Bacteria 3635
123 Ga0207689_10019978 3300025942 Bacteria 5641
124 Ga0207667_10125877 3300025949 Bacteria 2639
125 Ga0207651_10140471 3300025960 Bacteria 1865
126 Ga0207712_10015355 3300025961 Bacteria 4939
127 Ga0207712_10023558 3300025961 Bacteria 4064
128 Ga0207668_10022131 3300025972 Bacteria 4064
129 Ga0207668_10071328 3300025972 Bacteria 2481
130 Ga0207668_10108526 3300025972 Bacteria 2077
131 Ga0207640_10026443 3300025981 Bacteria 3523
132 Ga0207658_10054938 3300025986 Bacteria 2948
133 Ga0207677_10012543 3300026023 Bacteria 4877
134 Ga0207703_10029364 3300026035 Bacteria 4338
135 Ga0207639_10015525 3300026041 Bacteria 5376
136 Ga0207678_10020140 3300026067 Bacteria 5858
137 Ga0207678_10052334 3300026067 Bacteria 3523
138 Ga0207708_10026971 3300026075 Bacteria 4349
139 Ga0207648_10054750 3300026089 Bacteria 3483
140 Ga0207674_10160960 3300026116 Bacteria 2199
141 Ga0207675_100140360 3300026118 Bacteria 2295
142 Ga0207675_100165356 3300026118 Bacteria 2112
143 Ga0207683_10002615 3300026121 Bacteria 15719
144 Ga0207683_10085664 3300026121 Bacteria 2801
145 Ga0207683_10139284 3300026121 Bacteria 2186
146 Ga0207698_10087703 3300026142 Bacteria 2535
147 Ga0268266_10165838 3300028379 Bacteria 2001
148 Ga0268265_10020929 3300028380 Bacteria 4572
149 Ga0268265_10044349 3300028380 Bacteria 3311
150 Ga0307515_10208859 3300028794 Bacteria 1803
151 Ga0307511_10000622 3300030521 Bacteria 37906
152 Ga0307513_10090206 3300031456 Bacteria 3127
153 Ga0307509_10186626 3300031507 Bacteria 1931
154 Ga0307508_10008562 3300031616 Bacteria 9444
155 Ga0307516_10227625 3300031730 Bacteria 1570
156 Ga0307413_10039026 3300031824 Bacteria 2757
157 Ga0307407_10021676 3300031903 Bacteria 3320
158 Ga0307407_10113116 3300031903 Bacteria 1708
159 Ga0307414_10074575 3300032004 Bacteria 2459
160 Ga0307507_10019320 3300033179 Bacteria 7682
161 Ga0307510_10012064 3300033180 Bacteria 10244
162 Ga0373952_0039946 3300035092 Bacteria 1080
163 Ga0373931_0006359 3300035691 Bacteria 5514
164 Ga0395898_0012066 3300037466 Bacteria 8944
165 Ga0395905_0271191 3300037471 Bacteria 1583
166 Ga0436364_0992263 3300037853 Bacteria 11879
167 Ga0395901_0025245 3300038443 Bacteria 6101
168 Ga0436365_0595497 3300039437 Bacteria 3833
169 Ga0436365_1869240 3300039437 Bacteria 6996
170 Ga0439465_0036148 3300041413 Bacteria 1586
171 Ga0466969_0009853 3300044656 Bacteria 5066
172 Ga0466969_0023825 3300044656 Bacteria 3151
173 Ga0466969_0033267 3300044656 Bacteria 2619
174 Ga0466972_0001366 3300044658 Bacteria 11848
175 Ga0466972_0098603 3300044658 Bacteria 1383
176 Ga0466972_0100235 3300044658 Bacteria 1371
177 Ga0466965_0085163 3300044683 Bacteria 1602
178 Ga0466966_0026493 3300044684 Bacteria 3784
179 Ga0466966_0028013 3300044684 Bacteria 3671
180 Ga0466963_0050691 3300044694 Bacteria 2748
181 Ga0466971_0011041 3300044719 Bacteria 3954
182 Ga0466971_0022226 3300044719 Bacteria 2825
183 Ga0466971_0089281 3300044719 Bacteria 1410
184 Ga0466970_0012224 3300044765 Bacteria 4386
185 Ga0466960_0046860 3300044901 Bacteria 2071
186 Ga0466960_0095708 3300044901 Bacteria 1521
187 Ga0466967_0045867 3300045976 Bacteria 3801
188 Ga0466967_0189675 3300045976 Bacteria 1942
189 Ga0495603_0000485 3300046455 Bacteria 22011
190 Ga0495603_0004999 3300046455 Bacteria 7936
191 Ga0495603_0008560 3300046455 Bacteria 6183
192 Ga0495603_0019498 3300046455 Bacteria 4104
193 Ga0495629_0002813 3300046459 Bacteria 13271
194 Ga0495629_0020293 3300046459 Bacteria 4745
195 Ga0495605_0068827 3300046474 Bacteria 1677
196 Ga0495585_0088531 3300046492 Bacteria 1670
197 Ga0495594_0037844 3300046499 Bacteria 2633
198 Ga0495622_0022995 3300046557 Bacteria 2905
199 Ga0495588_0038000 3300046674 Bacteria 2448
200 Ga0495613_0000667 3300046689 Bacteria 27203
201 Ga0495670_0129428 3300046691 Bacteria 1315
202 Ga0495589_0002179 3300046794 Bacteria 11026
203 Ga0495589_0114939 3300046794 Bacteria 1297
204 Ga0495636_0001096 3300047318 Bacteria 10171
205 Ga0495636_0042952 3300047318 Bacteria 1879
206 Ga0495676_0006238 3300047321 Bacteria 10968
207 Ga0495676_0011679 3300047321 Bacteria 7921
208 Ga0495676_0051421 3300047321 Bacteria 3296
209 Ga0495676_0111665 3300047321 Bacteria 2004
210 Ga0495687_004277 3300047443 Bacteria 9755
211 Ga0495685_025741 3300047447 Bacteria 2024
212 Ga0495593_0103563 3300047673 Bacteria 1458
213 Ga0495614_0001606 3300048089 Bacteria 9826
214 Ga0495626_0020957 3300048091 Bacteria 3251
215 Ga0496100_0018357 3300048903 Bacteria 4147
216 Ga0496101_0097044 3300048904 Bacteria 2200
217 Ga0496102_0052759 3300048905 Bacteria 3706
218 Ga0496103_0014564 3300048906 Bacteria 4670
219 Ga0496105_0424889 3300048908 Bacteria 1052
220 Ga0496106_0016332 3300048909 Bacteria 5492
221 Ga0496106_0303240 3300048909 Bacteria 1281
222 Ga0496107_0002704 3300048910 Bacteria 11619
223 Ga0496109_0036640 3300048912 Bacteria 4428
224 Ga0496109_0322326 3300048912 Bacteria 1458
225 Ga0496112_0050403 3300048915 Bacteria 4082
226 Ga0496113_0107627 3300048916 Bacteria 2166
227 Ga0496114_0022565 3300048917 Bacteria 5130
228 Ga0496115_0034182 3300048918 Bacteria 4017
229 Ga0496117_0001079 3300048920 Bacteria 41309
230 Ga0496118_0000398 3300048921 Bacteria 73344
231 Ga0496122_0054609 3300048925 Bacteria 2998
232 Ga0496124_0000020 3300048927 Bacteria 434107
233 Ga0496124_0000198 3300048927 Bacteria 119277
234 Ga0496124_0084826 3300048927 Bacteria 2596
235 Ga0501033_0010236 3300049570 Bacteria 7195
236 Ga0501033_0073771 3300049570 Bacteria 2505
237 Ga0501034_0006751 3300049571 Bacteria 12286
238 Ga0501034_0015262 3300049571 Bacteria 7894
239 Ga0501036_0003301 3300049572 Bacteria 12873
240 Ga0501036_0029439 3300049572 Bacteria 4638
241 Ga0501037_0141587 3300049573 Bacteria 1721
242 Ga0501038_0011410 3300049574 Bacteria 8110
243 Ga0501039_0004538 3300049575 Bacteria 10484
244 Ga0501043_0002494 3300049579 Bacteria 15566
245 Ga0501043_0162497 3300049579 Bacteria 1744
246 Ga0501047_0002588 3300049581 Bacteria 17222
247 Ga0501047_0026349 3300049581 Bacteria 5594
248 Ga0501070_0021390 3300049586 Bacteria 5426
249 Ga0501074_0001357 3300049590 Bacteria 16237
250 Ga0501035_0001540 3300049822 Bacteria 23463
251 Ga0501035_0008563 3300049822 Bacteria 9522
252 Ga0501044_0000780 3300049823 Bacteria 38627
253 Ga0501044_0008124 3300049823 Bacteria 11516
254 Ga0501044_0026751 3300049823 Bacteria 6104
255 nmdc:mga03683_14089_c1 3300050489 Bacteria 2953
256 nmdc:mga03n38_18708_c1 3300050490 Bacteria 2739
257 nmdc:mga06r32_6912_c1 3300050510 Bacteria 10200
258 nmdc:mga08y16_229467_c1 3300050511 Bacteria 1920
259 nmdc:mga0sz30_927_c1 3300050516 Bacteria 10562
260 Ga0495655_0020271 3300053083 Bacteria 1489
261 Ga0500577_0006692 3300053142 Bacteria 3194
262 Ga0466962_0055334 3300061719 Bacteria 1896
263 2552108909 2551306166 Bacteria 9731570
264 2558910803 2558860112 Bacteria 9931328
265 2753303438 2751185788 Bacteria 4541048
266 2795784830 2795385470 Bacteria 8317180
267 2795794325 2795385472 Bacteria 6627535
268 2809226174 2808606447 Bacteria 3572005
269 2816504992 2816332139 Bacteria 9138787
270 2870784795 2870782633 Bacteria 9624083
271 2891327409 2891326441 Bacteria 6439512
272 2904431515 2904430863 Bacteria 3486923
273 2912715322 2912715099 Bacteria 9460473
274 2912727052 2912723979 Bacteria 8557534
275 2919043439 2919042368 Bacteria 3905917
276 2928107000 2928104781 Bacteria 3877447
277 2939588571 2939582691 Bacteria 7088898
278 2984551744 2984551494 Bacteria 3877562
279 2997602792 2997600082 Bacteria 9896405
280 3006493679 3006486233 Bacteria 8157040
281 8003316241 8003314358 Bacteria 10575343
282 8008581599 8008574985 Bacteria 7815457
283 8054163904 8054160619 Bacteria 7783213
284 8056834540 8056829672 Bacteria 9045328
285 Ga0373931_0115497
286 JGI24744J21845_10001440
287 JGI25406J46586_10000332
288 Ga0070676_10010520
289 Ga0070690_100043862
290 Ga0068869_100020552
291 Ga0068869_100082607
292 Ga0070666_10030317
293 Ga0070682_100026838
294 Ga0070682_100143494
295 Ga0068868_100055165
296 Ga0070660_100135782
297 Ga0070689_100017272
298 Ga0070691_10048631
299 Ga0070687_100016383
300 Ga0070687_100101329
301 Ga0070668_100008477
302 Ga0070669_100028709
303 Ga0070675_100087953
304 Ga0070671_100242997
305 Ga0070688_100067626
306 Ga0070688_100126672
307 Ga0070659_100038383
308 Ga0070667_100064078
309 Ga0070709_10076997
310 Ga0070714_100089830
311 Ga0070710_10055168
312 Ga0070701_10021147
313 Ga0070700_100022503
314 Ga0070694_100059828
315 Ga0070663_100000376
316 Ga0070663_100095813
317 Ga0070678_100060754
318 Ga0070662_100020791
319 Ga0068867_100054843
320 Ga0070679_100131085
321 Ga0070697_100107135
322 Ga0068853_100058845
323 Ga0070695_100043981
324 Ga0070693_100022375
325 Ga0070693_100120330
326 Ga0070665_100090959
327 Ga0068855_100245125
328 Ga0070664_100047585
329 Ga0068856_100139131
330 Ga0070702_100002429
331 Ga0068852_100082039
332 Ga0068859_100163723
333 Ga0068866_10044440
334 Ga0068861_100133092
335 Ga0068863_100265723
336 Ga0068858_100038161
337 Ga0068858_100116131
338 Ga0068860_100149002
339 Ga0068860_100282747
340 Ga0068862_100085192
341 Ga0081455_10001170
342 Ga0081539_10000126
343 Ga0070717_10163276
344 Ga0075365_10052769
345 Ga0075364_10010332
346 Ga0070715_10008779
347 Ga0070716_100019454
348 Ga0075362_10012385
349 Ga0075369_10003668
350 Ga0068871_100022496
351 Ga0075428_100000335
352 Ga0075431_100038391
353 Ga0068865_100029771
354 Ga0068865_100167379
355 Ga0097620_100163710
356 Ga0105240_10183436
357 Ga0111539_10266452
358 Ga0105245_10077155
359 Ga0105245_10092486
360 Ga0105245_10125748
361 Ga0105247_10012120
362 Ga0105243_10143835
363 Ga0105243_10244308
364 Ga0105242_10071570
365 Ga0105238_10019486
366 Ga0105249_10011462
367 Ga0157370_10157519
368 Ga0157374_10010183
369 Ga0157374_10028759
370 Ga0163162_10063026
371 Ga0157372_10097247
372 Ga0157375_10035416
373 Ga0157375_10063000
374 Ga0157380_10033262
375 Ga0157377_10025613
376 Ga0157376_10262765
377 Ga0163161_10132011
378 Ga0213876_10037319
379 Ga0213875_10003582
380 Ga0209758_1001828
381 Ga0207682_10077025
382 Ga0207692_10006711
383 Ga0207642_10003952
384 Ga0207710_10007111
385 Ga0207688_10009750
386 Ga0207685_10002370
387 Ga0207699_10092077
388 Ga0207645_10078968
389 Ga0207684_10067423
390 Ga0207693_10004239
391 Ga0207663_10010277
392 Ga0207657_10040387
393 Ga0207657_10042539
394 Ga0207652_10170336
395 Ga0207659_10069248
396 Ga0207687_10017163
397 Ga0207664_10057124
398 Ga0207690_10056435
399 Ga0207706_10006954
400 Ga0207706_10043427
401 Ga0207686_10011376
402 Ga0207709_10012214
403 Ga0207670_10035061
404 Ga0207704_10095797
405 Ga0207665_10025145
406 Ga0207691_10054847
407 Ga0207689_10019978
408 Ga0207667_10125877
409 Ga0207651_10140471
410 Ga0207712_10015355
411 Ga0207712_10023558
412 Ga0207668_10022131
413 Ga0207668_10071328
414 Ga0207668_10108526
415 Ga0207640_10026443
416 Ga0207658_10054938
417 Ga0207677_10012543
418 Ga0207703_10029364
419 Ga0207639_10015525
420 Ga0207678_10020140
421 Ga0207678_10052334
422 Ga0207708_10026971
423 Ga0207648_10054750
424 Ga0207674_10160960
425 Ga0207675_100140360
426 Ga0207675_100165356
427 Ga0207683_10002615
428 Ga0207683_10085664
429 Ga0207683_10139284
430 Ga0207698_10087703
431 Ga0268266_10165838
432 Ga0268265_10020929
433 Ga0268265_10044349
434 Ga0307515_10208859
435 Ga0307511_10000622
436 Ga0307513_10090206
437 Ga0307509_10186626
438 Ga0307508_10008562
439 Ga0307516_10227625
440 Ga0307413_10039026
441 Ga0307407_10021676
442 Ga0307407_10113116
443 Ga0307414_10074575
444 Ga0307507_10019320
445 Ga0307510_10012064
446 Ga0373952_0039946
447 Ga0373931_0006359
448 Ga0395898_0012066
449 Ga0395905_0271191
450 Ga0436364_0992263
451 Ga0395901_0025245
452 Ga0436365_0595497
453 Ga0436365_1869240
454 Ga0439465_0036148
455 Ga0466969_0009853
456 Ga0466969_0023825
457 Ga0466969_0033267
458 Ga0466972_0001366
459 Ga0466972_0098603
460 Ga0466972_0100235
461 Ga0466965_0085163
462 Ga0466966_0026493
463 Ga0466966_0028013
464 Ga0466963_0050691
465 Ga0466971_0011041
466 Ga0466971_0022226
467 Ga0466971_0089281
468 Ga0466970_0012224
469 Ga0466960_0046860
470 Ga0466960_0095708
471 Ga0466967_0045867
472 Ga0466967_0189675
473 Ga0495603_0000485
474 Ga0495603_0004999
475 Ga0495603_0008560
476 Ga0495603_0019498
477 Ga0495629_0002813
478 Ga0495629_0020293
479 Ga0495605_0068827
480 Ga0495585_0088531
481 Ga0495594_0037844
482 Ga0495622_0022995
483 Ga0495588_0038000
484 Ga0495613_0000667
485 Ga0495670_0129428
486 Ga0495589_0002179
487 Ga0495589_0114939
488 Ga0495636_0001096
489 Ga0495636_0042952
490 Ga0495676_0006238
491 Ga0495676_0011679
492 Ga0495676_0051421
493 Ga0495676_0111665
494 Ga0495687_004277
495 Ga0495685_025741
496 Ga0495593_0103563
497 Ga0495614_0001606
498 Ga0495626_0020957
499 Ga0496100_0018357
500 Ga0496101_0097044
501 Ga0496102_0052759
502 Ga0496103_0014564
503 Ga0496105_0424889
504 Ga0496106_0016332
505 Ga0496106_0303240
506 Ga0496107_0002704
507 Ga0496109_0036640
508 Ga0496109_0322326
509 Ga0496112_0050403
510 Ga0496113_0107627
511 Ga0496114_0022565
512 Ga0496115_0034182
513 Ga0496117_0001079
514 Ga0496118_0000398
515 Ga0496122_0054609
516 Ga0496124_0000020
517 Ga0496124_0000198
518 Ga0496124_0084826
519 Ga0501033_0010236
520 Ga0501033_0073771
521 Ga0501034_0006751
522 Ga0501034_0015262
523 Ga0501036_0003301
524 Ga0501036_0029439
525 Ga0501037_0141587
526 Ga0501038_0011410
527 Ga0501039_0004538
528 Ga0501043_0002494
529 Ga0501043_0162497
530 Ga0501047_0002588
531 Ga0501047_0026349
532 Ga0501070_0021390
533 Ga0501074_0001357
534 Ga0501035_0001540
535 Ga0501035_0008563
536 Ga0501044_0000780
537 Ga0501044_0008124
538 Ga0501044_0026751
539 nmdc:mga03683_14089_c1
540 nmdc:mga03n38_18708_c1
541 nmdc:mga06r32_6912_c1
542 nmdc:mga08y16_229467_c1
543 nmdc:mga0sz30_927_c1
544 Ga0495655_0020271
545 Ga0500577_0006692
546 Ga0466962_0055334
547 2552108909
548 2558910803
549 2753303438
550 2795784830
551 2795794325
552 2809226174
553 2816504992
554 2870784795
555 2891327409
556 2904431515
557 2912715322
558 2912727052
559 2919043439
560 2928107000
561 2939588571
562 2984551744
563 2997602792
564 3006493679
565 8003316241
566 8008581599
567 8054163904
568 8056834540

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

23

56

0.97

PF01494

FAD_binding_3

FAD binding domain

18

343

0.92

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

20

83

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6sw2-assembly1.cif.gz_A crystal structure of p. aeruginosa pqsl in complex with 2-aminobenzoylacetate 0.8333 1 364
6sw1-assembly1.cif.gz_A crystal structure of p. aeruginosa pqsl: r41y, i43r, g45r, c105g mutant 0.8324 1 358
6hrd-assembly2.cif.gz_D crystal structure of m. tuberculosis fadb2 (rv0468) 0.8284 2 35
2x3n-assembly1.cif.gz_A crystal structure of pqsl, a probable fad-dependent monooxygenase from pseudomonas aeruginosa 0.8267 1 364
7da9-assembly1.cif.gz_B structure of 6-hydroxy-3-succinoyl-pyridine 3-monooxygenase (hspb) from pseudomonas putida s16 0.8262 1 392
ID Description Score Start End Superfamily
af_O65936_274_405_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9979 229 354 3.50.50.60
af_O65936_274_405_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9454 229 354 3.50.50.60
af_O65936_46_234_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9374 1 181 3.50.50.60
af_Q8T4I0_15_313_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8965 13 31 3.40.1190.20
af_O65936_46_234_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8751 1 181 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A0K2QXS7-F1-model_v4 deleted 0.9676 16 297
AF-A0A1I7AVI2-F1-model_v4 2-polyprenyl-6-methoxyphenol hydroxylase 0.9555 2 407 GO:0016491
GO:0071949
AF-A0A166KPL1-F1-model_v4 Monooxygenase 0.9525 18 403 GO:0004497
GO:0071949
AF-A0A0Q9HSD3-F1-model_v4 FAD-binding domain-containing protein 0.9493 16 407 GO:0016491
GO:0071949
AF-A0A166KPL1-F1-model_v4 Monooxygenase 0.9476 18 403 GO:0004497
GO:0071949

Map