F386261

General Info

Members Datasets Scaffolds Average Seq Length
284 198 568 445

Family's Representative Sequence

Representative Sequence 3300028573|Ga0265334_10014634|Ga0265334_100146342
Length 490
Sequence MRAGPCVGSSAGSVXXXXTTSVDTTLLSREQILGCELSTPINLARSRDVSQPFFPTVPDQVAYASAASDEALAFRAYDPELVIRGKRMEEWLRISVAYWHSFAANGSDMFGTGTFDRPWTQQPGDPMEAARAKMAAAFEFIEKLGAPFYCFHDVDVSPTGASFHEFRSNLDALADELLGYQERTGVRLLWGTANLFTHPRFQAGAATNPDPEVFAYAAAQVKNMLGVTNRLGGANYVLWGGREGYDSLLNTDLRREGEQLARFLHLVVDEKHRIGFDGTLLLEPKPMEPTKHQYDFDAAVVHGFLARHGLEGEYKLNIEANHATLAGHSFHHEIAYATANDMLGSVDANRGDPQNGWDTDQFPNSVEDLVLPLYEIVLAGGLGNGGFNFDAKLRRQSIDRDDLFHAHIGGIDTLARALIAAAKLADDGTLARMTEQRYSGWEGELGRAISDGTATLAELADRVEQGEINPDPVSGKQELYENLVNEALWG

Samples

Sample ID Description Type Environment
1 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
63 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
100 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
101 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
102 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
106 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
107 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
108 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
109 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
110 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
111 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
112 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
113 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
114 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
115 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
116 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
117 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
118 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
119 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
122 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
123 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
124 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
130 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
134 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
137 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
138 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
139 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
140 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
141 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
142 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
157 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
167 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
168 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
169 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
170 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
171 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
172 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
173 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
174 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
175 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
176 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
178 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
179 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
180 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
181 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
185 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
186 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
187 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
188 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
189 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
190 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
191 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
192 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
193 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
196 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
197 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
198 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.94
Metatranscriptomes 0.35
Isolates 0.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.82
Nodule 0.7
Rhizoplane 14.08
Rhizosphere 80.28
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265334_10014634 3300028573 Bacteria 3268
2 rootH2_10019620 3300003320 Bacteria 12582
3 Ga0070690_100044389 3300005330 Bacteria 2821
4 Ga0070682_100001583 3300005337 Bacteria 12685
5 Ga0068868_100013340 3300005338 Bacteria 6025
6 Ga0070660_100020405 3300005339 Bacteria 4869
7 Ga0070689_100000904 3300005340 Bacteria 18535
8 Ga0070687_100005007 3300005343 Bacteria 5337
9 Ga0070692_10005235 3300005345 Bacteria 5503
10 Ga0070675_100009756 3300005354 Bacteria 7476
11 Ga0070673_100078948 3300005364 Bacteria 2664
12 Ga0070688_100000721 3300005365 Bacteria 16265
13 Ga0070667_100010872 3300005367 Bacteria 7527
14 Ga0070714_100002542 3300005435 Bacteria 13443
15 Ga0070713_100069134 3300005436 Bacteria 2977
16 Ga0070705_100014970 3300005440 Bacteria 4002
17 Ga0070700_100001094 3300005441 Bacteria 13407
18 Ga0070700_100069040 3300005441 Bacteria 2249
19 Ga0070694_100048449 3300005444 Bacteria 2858
20 Ga0070708_100018663 3300005445 Bacteria 5807
21 Ga0070663_100023256 3300005455 Bacteria 4151
22 Ga0070678_100004780 3300005456 Bacteria 7726
23 Ga0070678_100023587 3300005456 Bacteria 4102
24 Ga0068867_100016253 3300005459 Bacteria 5285
25 Ga0070685_10001371 3300005466 Bacteria 12792
26 Ga0070706_100103724 3300005467 Bacteria 2644
27 Ga0070684_100017931 3300005535 Bacteria 5820
28 Ga0068853_100099823 3300005539 Bacteria 2565
29 Ga0070686_100001777 3300005544 Bacteria 12042
30 Ga0070695_100001318 3300005545 Bacteria 13730
31 Ga0070696_100036701 3300005546 Bacteria 3380
32 Ga0070665_100171731 3300005548 Bacteria 2169
33 Ga0070664_100015003 3300005564 Bacteria 6324
34 Ga0068854_100180880 3300005578 Bacteria 1647
35 Ga0070702_100002470 3300005615 Bacteria 7994
36 Ga0068859_100002176 3300005617 Bacteria 19904
37 Ga0068864_100002591 3300005618 Bacteria 14933
38 Ga0068870_10003743 3300005840 Bacteria 6471
39 Ga0068858_100017121 3300005842 Bacteria 6802
40 Ga0068858_100070807 3300005842 Bacteria 3233
41 Ga0068860_100008757 3300005843 Bacteria 10078
42 Ga0068860_100205451 3300005843 Bacteria 1910
43 Ga0068862_100064133 3300005844 Bacteria 3162
44 Ga0070717_10012247 3300006028 Bacteria 6540
45 Ga0075366_10100191 3300006195 Bacteria 1738
46 Ga0075431_100066440 3300006847 Bacteria 3723
47 Ga0075429_100052836 3300006880 Bacteria 3534
48 Ga0068865_100001624 3300006881 Bacteria 13166
49 Ga0068865_100010958 3300006881 Bacteria 5658
50 Ga0097620_100002176 3300006931 Bacteria 19904
51 Ga0111539_10016860 3300009094 Bacteria 9047
52 Ga0111539_10021065 3300009094 Bacteria 8029
53 Ga0111539_10105941 3300009094 Bacteria 3299
54 Ga0105245_10011074 3300009098 Bacteria 7852
55 Ga0105245_10088697 3300009098 Bacteria 2841
56 Ga0105247_10152246 3300009101 Bacteria 1525
57 Ga0114129_10126351 3300009147 Bacteria 3515
58 Ga0114129_10178852 3300009147 Bacteria 2888
59 Ga0105243_10047096 3300009148 Bacteria 3393
60 Ga0105242_10010833 3300009176 Bacteria 7001
61 Ga0105242_10025064 3300009176 Bacteria 4715
62 Ga0105248_10126183 3300009177 Bacteria 2887
63 Ga0105248_10227010 3300009177 Bacteria 2102
64 Ga0105237_10000003 3300009545 Bacteria 556908
65 Ga0105249_10095401 3300009553 Bacteria 2789
66 Ga0105239_10005248 3300010375 Bacteria 15242
67 Ga0105239_10170091 3300010375 Bacteria 2436
68 Ga0157374_10204030 3300013296 Bacteria 1937
69 Ga0157378_10054571 3300013297 Bacteria 3558
70 Ga0157375_10001572 3300013308 Bacteria 19670
71 Ga0163163_10001628 3300014325 Bacteria 18900
72 Ga0157377_10000367 3300014745 Bacteria 20120
73 Ga0157379_10089057 3300014968 Bacteria 2768
74 Ga0157379_10112299 3300014968 Bacteria 2449
75 Ga0213872_10000055 3300021361 Bacteria 101489
76 Ga0207688_10008892 3300025901 Bacteria 5465
77 Ga0207680_10002513 3300025903 Bacteria 8551
78 Ga0207643_10003895 3300025908 Bacteria 8035
79 Ga0207684_10083296 3300025910 Bacteria 2724
80 Ga0207671_10000012 3300025914 Bacteria 519494
81 Ga0207693_10049307 3300025915 Bacteria 3307
82 Ga0207662_10000688 3300025918 Bacteria 15392
83 Ga0207662_10073536 3300025918 Bacteria 2073
84 Ga0207657_10032822 3300025919 Bacteria 4685
85 Ga0207646_10034114 3300025922 Bacteria 4599
86 Ga0207650_10120918 3300025925 Bacteria 2039
87 Ga0207659_10096822 3300025926 Bacteria 2216
88 Ga0207687_10004525 3300025927 Bacteria 9252
89 Ga0207687_10087487 3300025927 Bacteria 2264
90 Ga0207700_10043246 3300025928 Bacteria 3308
91 Ga0207664_10000049 3300025929 Bacteria 134645
92 Ga0207690_10067618 3300025932 Bacteria 2451
93 Ga0207706_10007406 3300025933 Bacteria 10148
94 Ga0207686_10013973 3300025934 Bacteria 4457
95 Ga0207686_10084401 3300025934 Bacteria 2081
96 Ga0207670_10011853 3300025936 Bacteria 5076
97 Ga0207670_10037493 3300025936 Bacteria 3159
98 Ga0207669_10115013 3300025937 Bacteria 1812
99 Ga0207704_10014494 3300025938 Bacteria 3981
100 Ga0207691_10134278 3300025940 Bacteria 2184
101 Ga0207661_10246492 3300025944 Bacteria 1587
102 Ga0207679_10031564 3300025945 Bacteria 3709
103 Ga0207667_10053945 3300025949 Bacteria 4229
104 Ga0207658_10027046 3300025986 Bacteria 4028
105 Ga0207703_10004067 3300026035 Bacteria 12066
106 Ga0207703_10071809 3300026035 Bacteria 2860
107 Ga0207639_10237971 3300026041 Bacteria 1581
108 Ga0207678_10013825 3300026067 Bacteria 7093
109 Ga0207708_10027555 3300026075 Bacteria 4302
110 Ga0207708_10106248 3300026075 Bacteria 2176
111 Ga0207648_10001299 3300026089 Bacteria 27833
112 Ga0207648_10048484 3300026089 Bacteria 3718
113 Ga0207648_10156697 3300026089 Bacteria 2010
114 Ga0207674_10004158 3300026116 Bacteria 17504
115 Ga0207675_100013646 3300026118 Bacteria 7583
116 Ga0207675_100103486 3300026118 Bacteria 2683
117 Ga0207683_10010640 3300026121 Bacteria 7845
118 Ga0207698_10013643 3300026142 Bacteria 5370
119 Ga0207428_10024756 3300027907 Bacteria 5038
120 Ga0268265_10119697 3300028380 Bacteria 2167
121 Ga0265337_1016050 3300028556 Bacteria 2433
122 Ga0265326_10000877 3300028558 Bacteria 10934
123 Ga0265326_10013429 3300028558 Bacteria 2397
124 Ga0265326_10017154 3300028558 Bacteria 2090
125 Ga0265319_1000574 3300028563 Bacteria 24722
126 Ga0265319_1001765 3300028563 Bacteria 12409
127 Ga0265334_10002495 3300028573 Bacteria 8602
128 Ga0265334_10011176 3300028573 Bacteria 3784
129 Ga0265334_10013792 3300028573 Bacteria 3377
130 Ga0265318_10000042 3300028577 Bacteria 130384
131 Ga0265318_10041035 3300028577 Bacteria 1760
132 Ga0265338_10003496 3300028800 Bacteria 22044
133 Ga0265338_10025384 3300028800 Bacteria 6014
134 Ga0265338_10042764 3300028800 Bacteria 4213
135 Ga0265338_10065303 3300028800 Bacteria 3158
136 Ga0265760_10013185 3300031090 Bacteria 2366
137 Ga0265330_10000026 3300031235 Bacteria 140332
138 Ga0265330_10014548 3300031235 Bacteria 3651
139 Ga0265330_10056095 3300031235 Bacteria 1720
140 Ga0265332_10000173 3300031238 Bacteria 52835
141 Ga0265328_10002705 3300031239 Bacteria 7925
142 Ga0265320_10000489 3300031240 Bacteria 31041
143 Ga0265320_10007072 3300031240 Bacteria 6997
144 Ga0265320_10047116 3300031240 Bacteria 2109
145 Ga0265325_10005132 3300031241 Bacteria 8144
146 Ga0265325_10034398 3300031241 Bacteria 2696
147 Ga0265329_10016236 3300031242 Bacteria 2585
148 Ga0265329_10028321 3300031242 Bacteria 1837
149 Ga0265340_10021185 3300031247 Bacteria 3334
150 Ga0265331_10000010 3300031250 Bacteria 312076
151 Ga0265327_10023077 3300031251 Bacteria 3696
152 Ga0265327_10024276 3300031251 Bacteria 3567
153 Ga0265327_10038982 3300031251 Bacteria 2585
154 Ga0265327_10074798 3300031251 Bacteria 1686
155 Ga0265316_10000744 3300031344 Bacteria 36026
156 Ga0265316_10001532 3300031344 Bacteria 24744
157 Ga0265316_10011008 3300031344 Bacteria 8206
158 Ga0307509_10038283 3300031507 Bacteria 5234
159 Ga0265313_10000401 3300031595 Bacteria 46604
160 Ga0265314_10000035 3300031711 Bacteria 240629
161 Ga0265314_10005360 3300031711 Bacteria 11591
162 Ga0265314_10017930 3300031711 Bacteria 5542
163 Ga0265314_10030528 3300031711 Bacteria 3987
164 Ga0265342_10046126 3300031712 Bacteria 2620
165 Ga0265342_10065145 3300031712 Bacteria 2136
166 Ga0307406_10103429 3300031901 Bacteria 1945
167 Ga0307415_100074748 3300032126 Bacteria 2396
168 Ga0373956_0005857 3300035119 Bacteria 4916
169 Ga0373943_0018420 3300035170 Bacteria 3208
170 Ga0373931_0019536 3300035691 Bacteria 3384
171 Ga0373933_0101687 3300035724 Bacteria 1784
172 Ga0373937_0000835 3300036401 Bacteria 26380
173 Ga0395905_0007698 3300037471 Bacteria 10690
174 Ga0400483_063031 3300039062 Bacteria 7383
175 Ga0400483_107066 3300039062 Bacteria 9438
176 Ga0400483_247084 3300039062 Bacteria 29107
177 Ga0436365_0025105 3300039437 Bacteria 2008
178 Ga0436361_0749269 3300039447 Bacteria 121408
179 Ga0453684_0049608 3300044712 Bacteria 5532
180 Ga0466967_0221656 3300045976 Bacteria 1797
181 Ga0495629_0111185 3300046459 Bacteria 1910
182 Ga0495651_0003188 3300046462 Bacteria 12610
183 Ga0495596_0001144 3300046500 Bacteria 15594
184 Ga0495628_0172080 3300046516 Bacteria 1642
185 Ga0495630_0137061 3300046517 Bacteria 1860
186 Ga0495643_0023944 3300046522 Bacteria 3466
187 Ga0495645_0215152 3300046543 Bacteria 1296
188 Ga0495634_0067252 3300046642 Bacteria 2371
189 Ga0495686_0000088 3300047472 Bacteria 195862
190 Ga0496100_0187236 3300048903 Bacteria 1500
191 Ga0496101_0006114 3300048904 Bacteria 7730
192 Ga0496101_0052300 3300048904 Bacteria 2945
193 Ga0496102_0081372 3300048905 Bacteria 2986
194 Ga0496104_0002627 3300048907 Bacteria 15455
195 Ga0496104_0013891 3300048907 Bacteria 7265
196 Ga0496104_0093015 3300048907 Bacteria 2883
197 Ga0496104_0114063 3300048907 Bacteria 2591
198 Ga0496105_0028316 3300048908 Bacteria 4582
199 Ga0496105_0114160 3300048908 Bacteria 2228
200 Ga0496105_0130784 3300048908 Bacteria 2069
201 Ga0496106_0049962 3300048909 Bacteria 3151
202 Ga0496106_0105332 3300048909 Bacteria 2191
203 Ga0496106_0128497 3300048909 Bacteria 1986
204 Ga0496107_0091770 3300048910 Bacteria 2220
205 Ga0496108_0001483 3300048911 Bacteria 18537
206 Ga0496108_0019468 3300048911 Bacteria 5575
207 Ga0496108_0031024 3300048911 Bacteria 4431
208 Ga0496108_0063043 3300048911 Bacteria 3121
209 Ga0496108_0089668 3300048911 Bacteria 2614
210 Ga0496109_0006346 3300048912 Bacteria 9956
211 Ga0496109_0006862 3300048912 Bacteria 9602
212 Ga0496109_0008709 3300048912 Bacteria 8638
213 Ga0496109_0013212 3300048912 Bacteria 7148
214 Ga0496109_0024552 3300048912 Bacteria 5360
215 Ga0496109_0086997 3300048912 Bacteria 2886
216 Ga0496110_0002412 3300048913 Bacteria 13991
217 Ga0496110_0037310 3300048913 Bacteria 4224
218 Ga0496110_0059254 3300048913 Bacteria 3374
219 Ga0496110_0064287 3300048913 Bacteria 3242
220 Ga0496111_0027921 3300048914 Bacteria 3997
221 Ga0496111_0058761 3300048914 Bacteria 2784
222 Ga0496112_0002831 3300048915 Bacteria 14082
223 Ga0496112_0155753 3300048915 Bacteria 2251
224 Ga0496113_0071387 3300048916 Bacteria 2641
225 Ga0496113_0158162 3300048916 Bacteria 1790
226 Ga0496114_0006288 3300048917 Bacteria 9349
227 Ga0496114_0006319 3300048917 Bacteria 9324
228 Ga0496114_0119148 3300048917 Bacteria 2269
229 Ga0496115_0021090 3300048918 Bacteria 5028
230 Ga0495678_000009 3300049459 Bacteria 373806
231 Ga0501031_0024278 3300049568 Bacteria 3952
232 Ga0501033_0046729 3300049570 Bacteria 3219
233 Ga0501034_0127477 3300049571 Bacteria 2530
234 Ga0501036_0005884 3300049572 Bacteria 9936
235 Ga0501038_0107845 3300049574 Bacteria 2310
236 Ga0501039_0264667 3300049575 Bacteria 1351
237 Ga0501040_0008343 3300049576 Bacteria 6736
238 Ga0501040_0069009 3300049576 Bacteria 2438
239 Ga0501041_0122128 3300049577 Bacteria 1619
240 Ga0501042_0116916 3300049578 Bacteria 1920
241 Ga0501067_0094873 3300049583 Bacteria 1656
242 Ga0501072_0001828 3300049588 Bacteria 15831
243 Ga0501072_0029289 3300049588 Bacteria 4300
244 Ga0501073_0019954 3300049589 Bacteria 4834
245 Ga0501075_0053932 3300049591 Bacteria 3024
246 Ga0501075_0057222 3300049591 Bacteria 2935
247 Ga0501075_0095345 3300049591 Bacteria 2258
248 Ga0501076_0004225 3300049592 Bacteria 10162
249 Ga0501076_0016168 3300049592 Bacteria 5651
250 Ga0501076_0086957 3300049592 Bacteria 2512
251 Ga0501077_0076442 3300049593 Bacteria 2121
252 Ga0501077_0098686 3300049593 Bacteria 1851
253 Ga0501079_0014462 3300049741 Bacteria 6018
254 Ga0501079_0075707 3300049741 Bacteria 2603
255 Ga0501080_0098955 3300049742 Bacteria 2707
256 Ga0501081_0022966 3300049743 Bacteria 4177
257 Ga0501083_0007061 3300049744 Bacteria 7971
258 Ga0501035_0181556 3300049822 Bacteria 1813
259 Ga0501045_0005830 3300049824 Bacteria 8530
260 nmdc:mga0k408_517_c1 3300050493 Bacteria 3348
261 nmdc:mga05p37_296259_c1 3300050507 Bacteria 1924
262 nmdc:mga09592_110530_c1 3300050508 Bacteria 2358
263 nmdc:mga0qj67_201812_c1 3300050509 Bacteria 1616
264 nmdc:mga06r32_4852_c1 3300050510 Bacteria 12113
265 nmdc:mga08y16_10250_c1 3300050511 Bacteria 9835
266 nmdc:mga0n895_185802_c1 3300050512 Bacteria 2109
267 Ga0495601_0012817 3300053077 Bacteria 5031
268 Ga0495612_0000763 3300053078 Bacteria 13130
269 Ga0495619_0005013 3300053085 Bacteria 8408
270 Ga0500647_0044658 3300053091 Bacteria 2127
271 Ga0500640_001441 3300053095 Bacteria 7213
272 Ga0500595_001472 3300053119 Bacteria 12521
273 Ga0500614_000477 3300053123 Bacteria 10413
274 Ga0500559_0004591 3300053136 Bacteria 6527
275 Ga0500638_000007 3300053162 Bacteria 129134
276 Ga0501084_0011825 3300054114 Bacteria 7225
277 Ga0501084_0058226 3300054114 Bacteria 3233
278 Ga0501082_0038126 3300060353 Bacteria 4146
279 Ga0501082_0050085 3300060353 Bacteria 3602
280 Ga0501082_0332311 3300060353 Bacteria 1324
281 Ga0530510_0075873 3300061734 Bacteria 2442
282 Ga0530510_0082768 3300061734 Bacteria 2337
283 8016545005 8016539877 Bacteria 8155419
284 8019677279 8019668869 Bacteria 8791617
285 Ga0265334_10014634
286 rootH2_10019620
287 Ga0070690_100044389
288 Ga0070682_100001583
289 Ga0068868_100013340
290 Ga0070660_100020405
291 Ga0070689_100000904
292 Ga0070687_100005007
293 Ga0070692_10005235
294 Ga0070675_100009756
295 Ga0070673_100078948
296 Ga0070688_100000721
297 Ga0070667_100010872
298 Ga0070714_100002542
299 Ga0070713_100069134
300 Ga0070705_100014970
301 Ga0070700_100001094
302 Ga0070700_100069040
303 Ga0070694_100048449
304 Ga0070708_100018663
305 Ga0070663_100023256
306 Ga0070678_100004780
307 Ga0070678_100023587
308 Ga0068867_100016253
309 Ga0070685_10001371
310 Ga0070706_100103724
311 Ga0070684_100017931
312 Ga0068853_100099823
313 Ga0070686_100001777
314 Ga0070695_100001318
315 Ga0070696_100036701
316 Ga0070665_100171731
317 Ga0070664_100015003
318 Ga0068854_100180880
319 Ga0070702_100002470
320 Ga0068859_100002176
321 Ga0068864_100002591
322 Ga0068870_10003743
323 Ga0068858_100017121
324 Ga0068858_100070807
325 Ga0068860_100008757
326 Ga0068860_100205451
327 Ga0068862_100064133
328 Ga0070717_10012247
329 Ga0075366_10100191
330 Ga0075431_100066440
331 Ga0075429_100052836
332 Ga0068865_100001624
333 Ga0068865_100010958
334 Ga0097620_100002176
335 Ga0111539_10016860
336 Ga0111539_10021065
337 Ga0111539_10105941
338 Ga0105245_10011074
339 Ga0105245_10088697
340 Ga0105247_10152246
341 Ga0114129_10126351
342 Ga0114129_10178852
343 Ga0105243_10047096
344 Ga0105242_10010833
345 Ga0105242_10025064
346 Ga0105248_10126183
347 Ga0105248_10227010
348 Ga0105237_10000003
349 Ga0105249_10095401
350 Ga0105239_10005248
351 Ga0105239_10170091
352 Ga0157374_10204030
353 Ga0157378_10054571
354 Ga0157375_10001572
355 Ga0163163_10001628
356 Ga0157377_10000367
357 Ga0157379_10089057
358 Ga0157379_10112299
359 Ga0213872_10000055
360 Ga0207688_10008892
361 Ga0207680_10002513
362 Ga0207643_10003895
363 Ga0207684_10083296
364 Ga0207671_10000012
365 Ga0207693_10049307
366 Ga0207662_10000688
367 Ga0207662_10073536
368 Ga0207657_10032822
369 Ga0207646_10034114
370 Ga0207650_10120918
371 Ga0207659_10096822
372 Ga0207687_10004525
373 Ga0207687_10087487
374 Ga0207700_10043246
375 Ga0207664_10000049
376 Ga0207690_10067618
377 Ga0207706_10007406
378 Ga0207686_10013973
379 Ga0207686_10084401
380 Ga0207670_10011853
381 Ga0207670_10037493
382 Ga0207669_10115013
383 Ga0207704_10014494
384 Ga0207691_10134278
385 Ga0207661_10246492
386 Ga0207679_10031564
387 Ga0207667_10053945
388 Ga0207658_10027046
389 Ga0207703_10004067
390 Ga0207703_10071809
391 Ga0207639_10237971
392 Ga0207678_10013825
393 Ga0207708_10027555
394 Ga0207708_10106248
395 Ga0207648_10001299
396 Ga0207648_10048484
397 Ga0207648_10156697
398 Ga0207674_10004158
399 Ga0207675_100013646
400 Ga0207675_100103486
401 Ga0207683_10010640
402 Ga0207698_10013643
403 Ga0207428_10024756
404 Ga0268265_10119697
405 Ga0265337_1016050
406 Ga0265326_10000877
407 Ga0265326_10013429
408 Ga0265326_10017154
409 Ga0265319_1000574
410 Ga0265319_1001765
411 Ga0265334_10002495
412 Ga0265334_10011176
413 Ga0265334_10013792
414 Ga0265318_10000042
415 Ga0265318_10041035
416 Ga0265338_10003496
417 Ga0265338_10025384
418 Ga0265338_10042764
419 Ga0265338_10065303
420 Ga0265760_10013185
421 Ga0265330_10000026
422 Ga0265330_10014548
423 Ga0265330_10056095
424 Ga0265332_10000173
425 Ga0265328_10002705
426 Ga0265320_10000489
427 Ga0265320_10007072
428 Ga0265320_10047116
429 Ga0265325_10005132
430 Ga0265325_10034398
431 Ga0265329_10016236
432 Ga0265329_10028321
433 Ga0265340_10021185
434 Ga0265331_10000010
435 Ga0265327_10023077
436 Ga0265327_10024276
437 Ga0265327_10038982
438 Ga0265327_10074798
439 Ga0265316_10000744
440 Ga0265316_10001532
441 Ga0265316_10011008
442 Ga0307509_10038283
443 Ga0265313_10000401
444 Ga0265314_10000035
445 Ga0265314_10005360
446 Ga0265314_10017930
447 Ga0265314_10030528
448 Ga0265342_10046126
449 Ga0265342_10065145
450 Ga0307406_10103429
451 Ga0307415_100074748
452 Ga0373956_0005857
453 Ga0373943_0018420
454 Ga0373931_0019536
455 Ga0373933_0101687
456 Ga0373937_0000835
457 Ga0395905_0007698
458 Ga0400483_063031
459 Ga0400483_107066
460 Ga0400483_247084
461 Ga0436365_0025105
462 Ga0436361_0749269
463 Ga0453684_0049608
464 Ga0466967_0221656
465 Ga0495629_0111185
466 Ga0495651_0003188
467 Ga0495596_0001144
468 Ga0495628_0172080
469 Ga0495630_0137061
470 Ga0495643_0023944
471 Ga0495645_0215152
472 Ga0495634_0067252
473 Ga0495686_0000088
474 Ga0496100_0187236
475 Ga0496101_0006114
476 Ga0496101_0052300
477 Ga0496102_0081372
478 Ga0496104_0002627
479 Ga0496104_0013891
480 Ga0496104_0093015
481 Ga0496104_0114063
482 Ga0496105_0028316
483 Ga0496105_0114160
484 Ga0496105_0130784
485 Ga0496106_0049962
486 Ga0496106_0105332
487 Ga0496106_0128497
488 Ga0496107_0091770
489 Ga0496108_0001483
490 Ga0496108_0019468
491 Ga0496108_0031024
492 Ga0496108_0063043
493 Ga0496108_0089668
494 Ga0496109_0006346
495 Ga0496109_0006862
496 Ga0496109_0008709
497 Ga0496109_0013212
498 Ga0496109_0024552
499 Ga0496109_0086997
500 Ga0496110_0002412
501 Ga0496110_0037310
502 Ga0496110_0059254
503 Ga0496110_0064287
504 Ga0496111_0027921
505 Ga0496111_0058761
506 Ga0496112_0002831
507 Ga0496112_0155753
508 Ga0496113_0071387
509 Ga0496113_0158162
510 Ga0496114_0006288
511 Ga0496114_0006319
512 Ga0496114_0119148
513 Ga0496115_0021090
514 Ga0495678_000009
515 Ga0501031_0024278
516 Ga0501033_0046729
517 Ga0501034_0127477
518 Ga0501036_0005884
519 Ga0501038_0107845
520 Ga0501039_0264667
521 Ga0501040_0008343
522 Ga0501040_0069009
523 Ga0501041_0122128
524 Ga0501042_0116916
525 Ga0501067_0094873
526 Ga0501072_0001828
527 Ga0501072_0029289
528 Ga0501073_0019954
529 Ga0501075_0053932
530 Ga0501075_0057222
531 Ga0501075_0095345
532 Ga0501076_0004225
533 Ga0501076_0016168
534 Ga0501076_0086957
535 Ga0501077_0076442
536 Ga0501077_0098686
537 Ga0501079_0014462
538 Ga0501079_0075707
539 Ga0501080_0098955
540 Ga0501081_0022966
541 Ga0501083_0007061
542 Ga0501035_0181556
543 Ga0501045_0005830
544 nmdc:mga0k408_517_c1
545 nmdc:mga05p37_296259_c1
546 nmdc:mga09592_110530_c1
547 nmdc:mga0qj67_201812_c1
548 nmdc:mga06r32_4852_c1
549 nmdc:mga08y16_10250_c1
550 nmdc:mga0n895_185802_c1
551 Ga0495601_0012817
552 Ga0495612_0000763
553 Ga0495619_0005013
554 Ga0500647_0044658
555 Ga0500640_001441
556 Ga0500595_001472
557 Ga0500614_000477
558 Ga0500559_0004591
559 Ga0500638_000007
560 Ga0501084_0011825
561 Ga0501084_0058226
562 Ga0501082_0038126
563 Ga0501082_0050085
564 Ga0501082_0332311
565 Ga0530510_0075873
566 Ga0530510_0082768
567 8016545005
568 8019677279

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1a0c-assembly1.cif.gz_A xylose isomerase from thermoanaerobacterium thermosulfurigenes 0.9726 6 437
1a0d-assembly1.cif.gz_A xylose isomerase from bacillus stearothermophilus 0.9726 6 437
1a0e-assembly1.cif.gz_A xylose isomerase from thermotoga neapolitana 0.9718 5 437
5nh4-assembly1.cif.gz_C crystal structure of xylose isomerase from piromyces e2 in complex with one mg2+ ions and glycerol 0.9715 4 438
6t8f-assembly1.cif.gz_D crystal structure of mutant xylose isomerase (v270a/a273g) from piromyces e2 grown in yeast, in complex with xylose 0.9714 5 438
ID Description Score Start End Superfamily
1a0dA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9726 6 437 3.20.20.150
af_A0A1D6QER4_85_310_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9703 43 278 3.20.20.150
af_A0A1D6QER4_85_310_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9619 43 278 3.20.20.150
1a0dA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9551 6 437 3.20.20.150
af_P45541_1_270_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8391 84 364 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A0P9MDF4-F1-model_v4 Xylose isomerase (EC 5.3.1.5) 0.9923 41 151 GO:0005737
GO:0009045
GO:0042732
GO:0046872
AF-A0A377DB46-F1-model_v4 xylose isomerase (EC 5.3.1.5) 0.9921 4 101 GO:0009045
GO:0042732
GO:0046872
AF-A0A6L6ZZA1-F1-model_v4 xylose isomerase (EC 5.3.1.5) 0.9902 4 127 GO:0009045
GO:0042732
GO:0046872
AF-A0A381GW61-F1-model_v4 deleted 0.9901 4 151
AF-A0A4P0XTC0-F1-model_v4 xylose isomerase (EC 5.3.1.5) 0.9893 3 116 GO:0009045
GO:0042732
GO:0046872

Map