F386228

General Info

Members Datasets Scaffolds Average Seq Length
284 179 278 538

Family's Representative Sequence

Representative Sequence 3300025914|Ga0207671_10049485|Ga0207671_100494852
Length 585
Sequence VLDGEQCHSRGKVIIRVQNQGLRGAAGDPHLILASSATLPLTYRENDLETIGRDLTEMQRVPLAQSHVAAMRNVGRVVSYAAGTFLVQPGDPADRFVYVEEGEIEVVNPFTQERFFPSTLGPTQFMAEIAFLSGGTWSMPMRAVRDTRALEVPRQEMLRLMSQIPEMSDIIITVLAARRRRQLEVRNSALVLIGEEIDRNVRRIAEFASRNHLPHSSYPLASPEATRIATSCAIPTDRPAVIFGRDRVVPDPTPDKIARLLGVNYDLADEEAFDVLIVGGGPAGVAAGVYAGAEGLSALVVEDTAIGGQAGTSSRIENYMGFPTGISGADLLWRGEVQAMKFGTRFVTPRRVTQLERLEGAQFCATFDSGQRVRAGAAVIATGVQYRRLPIDRLVEFEGAGAYYAATEAEARYCKNAEVIIIGGGNSAGQAAMFLSRAARHVRLLVRGTSLASSMSSYLSSRLEADPAITIEYNAEVVALHGAERLEAVTIRDARHGTNRTIPTCAVFIMVGAEPNTAWLAGLVELDRKGFILTGAAVRADSPFATSCPGIFAVGDVRAGSVKRVASSVGEGSVVISKVWEHLNG

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
3 2842747753 Variovorax sp. R-72060 Isolate Unclassified
4 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
5 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
6 2857558681 Duganella sp. R-74565 Isolate Unclassified
7 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
8 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
13 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
14 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
60 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
64 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
67 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
70 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
106 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
107 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
108 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
111 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
112 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
113 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
114 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
115 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
116 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
117 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
118 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
119 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
120 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
121 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
122 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
123 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
124 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
125 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
126 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
127 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
128 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
129 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
130 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
131 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
132 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
133 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
134 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
135 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
136 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
137 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
138 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
139 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
140 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
141 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
142 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
143 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
144 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
145 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
146 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
151 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
152 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
153 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
154 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
155 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
156 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
157 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
158 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
159 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
160 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
161 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
162 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
163 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
166 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
167 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
168 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
169 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
170 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
171 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
172 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
173 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
174 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
175 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
176 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
177 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
178 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
179 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.18
Metatranscriptomes 0.35
Isolates 2.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.38
Nodule 0
Rhizoplane 2.11
Rhizosphere 63.73
Stem 0
Stem Tuber 0
Unclassified 20.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10024573 3300001979 Bacteria 2043
2 JGI25153J46596_10017526 3300003215 Bacteria 2818
3 rootH1_10000877 3300003316 Bacteria 19081
4 rootH1_10000877 3300003323 Bacteria 40245
5 rootH1_10005782 3300003316 Bacteria 16867
6 rootH2_10005716 3300003320 Bacteria 23580
7 rootH2_10054931 3300003320 Bacteria 4385
8 rootH2_10185793 3300003320 Bacteria 3498
9 Ga0055539_1000327 3300003752 Bacteria 24000
10 Ga0055533_1000028 3300003756 Bacteria 311012
11 Ga0055535_1003498 3300003761 Bacteria 4402
12 Ga0055542_1000286 3300003762 Bacteria 56470
13 Ga0055529_1000207 3300003763 Bacteria 78124
14 Ga0055526_1000046 3300003771 Bacteria 120614
15 Ga0055531_10003315 3300003794 Bacteria 10308
16 Ga0065165_1000030 3300005262 Bacteria 218104
17 Ga0065704_10091757 3300005289 Bacteria 2695
18 Ga0070676_10074402 3300005328 Bacteria 2046
19 Ga0070670_100000081 3300005331 Bacteria 92043
20 Ga0070660_100095862 3300005339 Bacteria 2345
21 Ga0070661_100003960 3300005344 Bacteria 10187
22 Ga0070674_100000934 3300005356 Bacteria 15241
23 Ga0070667_100001429 3300005367 Bacteria 21397
24 Ga0070667_100003631 3300005367 Bacteria 13130
25 Ga0070667_100057808 3300005367 Bacteria 3279
26 Ga0070714_100000439 3300005435 Bacteria 30200
27 Ga0070713_100032205 3300005436 Bacteria 4184
28 Ga0070663_100042603 3300005455 Bacteria 3191
29 Ga0070678_100000152 3300005456 Bacteria 28847
30 Ga0068867_100101981 3300005459 Bacteria 2193
31 Ga0068853_100000093 3300005539 Bacteria 61353
32 Ga0070696_100000439 3300005546 Bacteria 26046
33 Ga0070665_100024110 3300005548 Bacteria 6127
34 Ga0068855_100000174 3300005563 Bacteria 82404
35 Ga0068855_100108744 3300005563 Bacteria 3184
36 Ga0070664_100022193 3300005564 Bacteria 5235
37 Ga0068857_100000118 3300005577 Bacteria 47043
38 Ga0068857_100035882 3300005577 Bacteria 4392
39 Ga0068854_100000026 3300005578 Bacteria 118880
40 Ga0068854_100000460 3300005578 Bacteria 25093
41 Ga0068854_100014703 3300005578 Bacteria 5165
42 Ga0068854_100065288 3300005578 Bacteria 2646
43 Ga0068864_100000016 3300005618 Bacteria 292454
44 Ga0068851_10017801 3300005834 Bacteria 3419
45 Ga0068851_10021979 3300005834 Bacteria 3102
46 Ga0068863_100001887 3300005841 Bacteria 20811
47 Ga0068863_100027099 3300005841 Bacteria 5466
48 Ga0068860_100044980 3300005843 Bacteria 4208
49 Ga0068862_100000068 3300005844 Bacteria 123535
50 Ga0075367_10000048 3300006178 Bacteria 27978
51 Ga0105251_10002065 3300009011 Bacteria 16214
52 Ga0105240_10001507 3300009093 Bacteria 39670
53 Ga0105240_10001559 3300009093 Bacteria 38902
54 Ga0105240_10003043 3300009093 Bacteria 26374
55 Ga0105240_10003365 3300009093 Bacteria 24874
56 Ga0105240_10017872 3300009093 Bacteria 9541
57 Ga0105240_10033802 3300009093 Bacteria 6603
58 Ga0105240_10051396 3300009093 Bacteria 5186
59 Ga0105240_10223298 3300009093 Bacteria 2193
60 Ga0105245_10000250 3300009098 Bacteria 51190
61 Ga0105243_10000278 3300009148 Bacteria 57245
62 Ga0105243_10031015 3300009148 Bacteria 4120
63 Ga0105248_10120507 3300009177 Bacteria 2960
64 Ga0105237_10000079 3300009545 Bacteria 127925
65 Ga0105237_10116577 3300009545 Bacteria 2664
66 Ga0105238_10012222 3300009551 Bacteria 8657
67 Ga0105238_10110343 3300009551 Bacteria 2731
68 Ga0105249_10002409 3300009553 Bacteria 16250
69 Ga0105239_10000164 3300010375 Bacteria 95286
70 Ga0105239_10012650 3300010375 Bacteria 9390
71 Ga0105239_10242759 3300010375 Bacteria 2022
72 Ga0157314_1000002 3300012500 Bacteria 42978
73 Ga0157371_10000600 3300013102 Bacteria 42883
74 Ga0163162_10102341 3300013306 Bacteria 2957
75 Ga0157375_10142965 3300013308 Bacteria 2521
76 Ga0163163_10127457 3300014325 Bacteria 2584
77 Ga0213872_10004452 3300021361 Bacteria 7442
78 Ga0209674_100007 3300025226 Bacteria 1077082
79 Ga0209563_100033 3300025230 Bacteria 457883
80 Ga0209563_100105 3300025230 Bacteria 147936
81 Ga0209258_100359 3300025242 Bacteria 61630
82 Ga0209026_1000512 3300025250 Bacteria 27393
83 Ga0209677_100243 3300025253 Bacteria 37239
84 Ga0209677_105128 3300025253 Bacteria 3517
85 Ga0209148_1000011 3300025254 Bacteria 1196503
86 Ga0209129_1001370 3300025258 Bacteria 13682
87 Ga0209455_1000006 3300025272 Bacteria 1196503
88 Ga0209564_1000277 3300025295 Bacteria 105818
89 Ga0209758_1000023 3300025297 Bacteria 612453
90 Ga0209758_1000315 3300025297 Bacteria 93638
91 Ga0209758_1001114 3300025297 Bacteria 34580
92 Ga0209050_1000169 3300025298 Bacteria 151269
93 Ga0209257_1000954 3300025304 Bacteria 39793
94 Ga0207656_10005179 3300025321 Bacteria 4587
95 Ga0207713_1002261 3300025735 Bacteria 14219
96 Ga0207647_10012447 3300025904 Bacteria 5921
97 Ga0207705_10012118 3300025909 Bacteria 6231
98 Ga0207654_10002498 3300025911 Bacteria 9348
99 Ga0207695_10000401 3300025913 Bacteria 96946
100 Ga0207695_10000541 3300025913 Bacteria 78696
101 Ga0207695_10001146 3300025913 Bacteria 45967
102 Ga0207695_10002555 3300025913 Bacteria 26734
103 Ga0207695_10005665 3300025913 Bacteria 16487
104 Ga0207695_10009698 3300025913 Bacteria 11856
105 Ga0207695_10017591 3300025913 Bacteria 8307
106 Ga0207695_10027642 3300025913 Bacteria 6313
107 Ga0207695_10030052 3300025913 Bacteria 5989
108 Ga0207671_10000009 3300025914 Bacteria 724862
109 Ga0207671_10005687 3300025914 Bacteria 11398
110 Ga0207671_10049485 3300025914 Bacteria 3112
111 Ga0207671_10062384 3300025914 Bacteria 2768
112 Ga0207649_10001949 3300025920 Bacteria 11761
113 Ga0207694_10086342 3300025924 Bacteria 2471
114 Ga0207650_10000288 3300025925 Bacteria 51267
115 Ga0207687_10000184 3300025927 Bacteria 41508
116 Ga0207664_10000808 3300025929 Bacteria 21219
117 Ga0207706_10022493 3300025933 Bacteria 5658
118 Ga0207709_10000039 3300025935 Bacteria 260127
119 Ga0207669_10000299 3300025937 Bacteria 22844
120 Ga0207669_10000778 3300025937 Bacteria 13668
121 Ga0207711_10000025 3300025941 Bacteria 289972
122 Ga0207679_10075046 3300025945 Bacteria 2564
123 Ga0207667_10000006 3300025949 Bacteria 679876
124 Ga0207667_10000077 3300025949 Bacteria 166095
125 Ga0207667_10056611 3300025949 Bacteria 4118
126 Ga0207712_10006421 3300025961 Bacteria 7418
127 Ga0207640_10000032 3300025981 Bacteria 116582
128 Ga0207640_10001183 3300025981 Bacteria 14274
129 Ga0207640_10009670 3300025981 Bacteria 5407
130 Ga0207640_10013871 3300025981 Bacteria 4627
131 Ga0207640_10014482 3300025981 Bacteria 4543
132 Ga0207640_10056419 3300025981 Bacteria 2578
133 Ga0207658_10000466 3300025986 Bacteria 37801
134 Ga0207658_10000989 3300025986 Bacteria 23363
135 Ga0207639_10020267 3300026041 Bacteria 4757
136 Ga0207678_10004869 3300026067 Bacteria 12055
137 Ga0207678_10031593 3300026067 Bacteria 4619
138 Ga0207641_10000103 3300026088 Bacteria 122350
139 Ga0207641_10010856 3300026088 Bacteria 7462
140 Ga0207648_10119858 3300026089 Bacteria 2313
141 Ga0207676_10000044 3300026095 Bacteria 161679
142 Ga0207674_10000128 3300026116 Bacteria 88789
143 Ga0207674_10003295 3300026116 Bacteria 19862
144 Ga0207674_10008661 3300026116 Bacteria 11719
145 Ga0207674_10024386 3300026116 Bacteria 6466
146 Ga0207683_10050375 3300026121 Bacteria 3647
147 Ga0268266_10000015 3300028379 Bacteria 630629
148 Ga0268266_10014983 3300028379 Bacteria 6655
149 Ga0268265_10000142 3300028380 Bacteria 91165
150 Ga0307517_10041514 3300028786 Bacteria 4966
151 Ga0265338_10082606 3300028800 Bacteria 2689
152 Ga0265760_10000046 3300031090 Bacteria 37190
153 Ga0307513_10004256 3300031456 Bacteria 19152
154 Ga0307513_10162544 3300031456 Bacteria 2123
155 Ga0307516_10001187 3300031730 Bacteria 36428
156 Ga0307412_10008041 3300031911 Bacteria 6010
157 Ga0373936_0016410 3300035113 Bacteria 2849
158 Ga0395898_0028693 3300037466 Bacteria 5577
159 Ga0436361_1002550 3300039447 Bacteria 40141
160 Ga0451807_1767063 3300041486 Bacteria 3829
161 Ga0466972_0020615 3300044658 Bacteria 3293
162 Ga0466982_0000001 3300044672 Bacteria 514662
163 Ga0466965_0046319 3300044683 Bacteria 2152
164 Ga0466966_0004122 3300044684 Bacteria 9600
165 Ga0466971_0003260 3300044719 Bacteria 6925
166 Ga0466968_0033200 3300044735 Bacteria 2150
167 Ga0495627_000103 3300046453 Bacteria 104335
168 Ga0495627_000105 3300046453 Bacteria 103413
169 Ga0495638_0027646 3300046460 Bacteria 3670
170 Ga0495650_0000355 3300046471 Bacteria 81062
171 Ga0495584_0004178 3300046491 Bacteria 7791
172 Ga0495585_0002003 3300046492 Bacteria 15103
173 Ga0495585_0024474 3300046492 Bacteria 3462
174 Ga0495607_0002341 3300046501 Bacteria 15503
175 Ga0495583_0000860 3300046506 Bacteria 36891
176 Ga0495583_0015882 3300046506 Bacteria 4073
177 Ga0495583_0016259 3300046506 Bacteria 4010
178 Ga0495606_0001409 3300046507 Bacteria 32327
179 Ga0495606_0112082 3300046507 Bacteria 1644
180 Ga0495616_0002167 3300046513 Bacteria 13125
181 Ga0495616_0058447 3300046513 Bacteria 1899
182 Ga0495632_0001628 3300046519 Bacteria 18404
183 Ga0495637_0009941 3300046520 Bacteria 4628
184 Ga0495643_0000720 3300046522 Bacteria 37814
185 Ga0495643_0001754 3300046522 Bacteria 18671
186 Ga0495643_0031672 3300046522 Bacteria 2941
187 Ga0495648_0000502 3300046524 Bacteria 42054
188 Ga0495648_0007661 3300046524 Bacteria 8609
189 Ga0495663_0000402 3300046525 Bacteria 15931
190 Ga0495642_0018198 3300046528 Bacteria 2748
191 Ga0495633_0000623 3300046558 Bacteria 33278
192 Ga0495668_0001102 3300046616 Bacteria 27954
193 Ga0495668_0004523 3300046616 Bacteria 9830
194 Ga0495611_0008282 3300046648 Bacteria 4405
195 Ga0495625_0000915 3300046660 Bacteria 39689
196 Ga0495625_0029115 3300046660 Bacteria 4134
197 Ga0495625_0066147 3300046660 Bacteria 2546
198 Ga0495669_0000363 3300046684 Bacteria 23133
199 Ga0495669_0003610 3300046684 Bacteria 6371
200 Ga0495671_0030620 3300046692 Bacteria 2755
201 Ga0495589_0001304 3300046794 Bacteria 14677
202 Ga0495660_0006111 3300046810 Bacteria 7148
203 Ga0495683_0001531 3300047323 Bacteria 14987
204 Ga0495683_0014215 3300047323 Bacteria 4147
205 Ga0495687_000109 3300047443 Bacteria 125648
206 Ga0495687_000228 3300047443 Bacteria 78882
207 Ga0495679_005724 3300047446 Bacteria 5476
208 Ga0495673_0000096 3300047469 Bacteria 182792
209 Ga0495681_0000174 3300047470 Bacteria 53932
210 Ga0495681_0002210 3300047470 Bacteria 14019
211 Ga0495681_0006052 3300047470 Bacteria 7997
212 Ga0495686_0000171 3300047472 Bacteria 123194
213 Ga0496102_0000126 3300048905 Bacteria 105053
214 Ga0496103_0000089 3300048906 Bacteria 104353
215 Ga0496103_0000395 3300048906 Bacteria 38785
216 Ga0496105_0000574 3300048908 Bacteria 24332
217 Ga0496115_0000376 3300048918 Bacteria 36873
218 Ga0496116_0000486 3300048919 Bacteria 54596
219 Ga0496116_0002801 3300048919 Bacteria 17913
220 Ga0496116_0037319 3300048919 Bacteria 3390
221 Ga0496117_0000117 3300048920 Bacteria 177596
222 Ga0496117_0000329 3300048920 Bacteria 83691
223 Ga0496117_0000824 3300048920 Bacteria 48048
224 Ga0496117_0013085 3300048920 Bacteria 7265
225 Ga0496118_0000025 3300048921 Bacteria 379363
226 Ga0496118_0000133 3300048921 Bacteria 131319
227 Ga0496118_0000164 3300048921 Bacteria 119381
228 Ga0496118_0001099 3300048921 Bacteria 42066
229 Ga0496118_0030085 3300048921 Bacteria 4541
230 Ga0496118_0072918 3300048921 Bacteria 2463
231 Ga0496119_0017527 3300048922 Bacteria 5381
232 Ga0496119_0022909 3300048922 Bacteria 4450
233 Ga0496120_0049675 3300048923 Bacteria 2406
234 Ga0496120_0078874 3300048923 Bacteria 1789
235 Ga0496121_0000072 3300048924 Bacteria 244975
236 Ga0496121_0000232 3300048924 Bacteria 119519
237 Ga0496121_0000391 3300048924 Bacteria 89610
238 Ga0496121_0007176 3300048924 Bacteria 13500
239 Ga0496121_0020234 3300048924 Bacteria 6600
240 Ga0496121_0020829 3300048924 Bacteria 6462
241 Ga0496121_0044334 3300048924 Bacteria 3838
242 Ga0496122_0032250 3300048925 Bacteria 4337
243 Ga0496122_0033943 3300048925 Bacteria 4187
244 Ga0496122_0048808 3300048925 Bacteria 3250
245 Ga0496122_0115127 3300048925 Bacteria 1753
246 Ga0496123_0034351 3300048926 Bacteria 3634
247 Ga0496124_0000041 3300048927 Bacteria 303887
248 Ga0496124_0000188 3300048927 Bacteria 122361
249 Ga0496124_0000686 3300048927 Bacteria 55722
250 Ga0496124_0000903 3300048927 Bacteria 48007
251 Ga0496124_0022048 3300048927 Bacteria 5850
252 Ga0496124_0037416 3300048927 Bacteria 4221
253 Ga0496124_0100022 3300048927 Bacteria 2351
254 Ga0496125_0000752 3300048928 Bacteria 53483
255 Ga0496125_0000962 3300048928 Bacteria 45231
256 Ga0496125_0008571 3300048928 Bacteria 10679
257 Ga0496125_0019406 3300048928 Bacteria 6414
258 Ga0496126_0000324 3300048929 Bacteria 101936
259 Ga0496126_0009273 3300048929 Bacteria 10484
260 Ga0495678_001436 3300049459 Bacteria 18742
261 Ga0495678_001605 3300049459 Bacteria 17313
262 Ga0501033_0039492 3300049570 Bacteria 3525
263 Ga0501043_0073007 3300049579 Bacteria 2695
264 Ga0501068_0014342 3300049584 Bacteria 4529
265 nmdc:mga06z11_25_c1 3300050494 Bacteria 65281
266 Ga0500610_0000058 3300053079 Bacteria 34405
267 Ga0500643_001319 3300053087 Bacteria 14560
268 Ga0500583_0062193 3300053092 Bacteria 1765
269 Ga0500562_000436 3300053108 Bacteria 10149
270 Ga0500642_0000461 3300053130 Bacteria 12915
271 Ga0500652_000428 3300053131 Bacteria 14965
272 Ga0500616_0000057 3300053153 Bacteria 278571
273 Ga0500622_0018035 3300053156 Bacteria 3753
274 Ga0500639_000044 3300053163 Bacteria 60301
275 Ga0500636_0000273 3300053177 Bacteria 28617
276 Ga0500645_000001 3300053730 Bacteria 455558
277 Ga0500596_000035 3300053735 Bacteria 18519
278 Ga0466962_0000781 3300061719 Bacteria 14318

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048921 Ga0496118_0072918 Ga0496118_0072918_36_1412 458
2 3300048925 Ga0496122_0115127 Ga0496122_0115127_284_1702 458
3 3300003752 Ga0055539_1000327 Ga0055539_100032710 499
4 3300003756 Ga0055533_1000028 Ga0055533_100002845 499
5 3300025226 Ga0209674_100007 Ga0209674_100007996 499
6 3300025230 Ga0209563_100033 Ga0209563_10003345 499
7 3300025253 Ga0209677_100243 Ga0209677_10024313 499
8 3300049584 Ga0501068_0014342 Ga0501068_0014342_2661_4313 499
9 3300048927 Ga0496124_0000188 Ga0496124_0000188_78823_80445 501
10 3300048925 Ga0496122_0032250 Ga0496122_0032250_67_1689 503
11 3300044719 Ga0466971_0003260 Ga0466971_0003260_3237_4823 505
12 3300044735 Ga0466968_0033200 Ga0466968_0033200_326_1912 505
13 3300061719 Ga0466962_0000781 Ga0466962_0000781_7038_8624 505
14 3300046507 Ga0495606_0112082 Ga0495606_0112082_103_1632 509
15 3300053092 Ga0500583_0062193 Ga0500583_0062193_15_1544 509
16 3300003320 rootH2_10005716 rootH2_100057165 512
17 3300044658 Ga0466972_0020615 Ga0466972_0020615_47_1663 515
18 3300044672 Ga0466982_0000001 Ga0466982_0000001_500795_502411 515
19 3300044683 Ga0466965_0046319 Ga0466965_0046319_298_1914 515
20 3300044684 Ga0466966_0004122 Ga0466966_0004122_5878_7494 515
21 3300053156 Ga0500622_0018035 Ga0500622_0018035_278_1897 525
22 3300048927 Ga0496124_0037416 Ga0496124_0037416_2300_3886 526
23 3300005563 Ga0068855_100000174 Ga0068855_10000017443 528
24 3300005578 Ga0068854_100000026 Ga0068854_10000002646 528
25 3300009093 Ga0105240_10001559 Ga0105240_1000155915 528
26 3300009093 Ga0105240_10033802 Ga0105240_100338026 528
27 3300025913 Ga0207695_10005665 Ga0207695_100056658 528
28 3300025949 Ga0207667_10000077 Ga0207667_10000077106 528
29 3300025981 Ga0207640_10000032 Ga0207640_1000003257 528
30 3300046648 Ga0495611_0008282 Ga0495611_0008282_22_1608 528
31 3300046794 Ga0495589_0001304 Ga0495589_0001304_4115_5701 528
32 3300048919 Ga0496116_0037319 Ga0496116_0037319_830_2455 528
33 3300048921 Ga0496118_0030085 Ga0496118_0030085_897_2522 528
34 3300048927 Ga0496124_0022048 Ga0496124_0022048_829_2433 528
35 3300053087 Ga0500643_001319 Ga0500643_001319_7750_9372 529
36 3300003316 rootH1_10005782 rootH1_1000578212 530
37 3300048906 Ga0496103_0000395 Ga0496103_0000395_22674_24290 531
38 3300048919 Ga0496116_0000486 Ga0496116_0000486_30409_32025 531
39 3300048920 Ga0496117_0000824 Ga0496117_0000824_14489_16105 531
40 3300048921 Ga0496118_0000133 Ga0496118_0000133_14496_16112 531
41 3300048922 Ga0496119_0022909 Ga0496119_0022909_2733_4349 531
42 3300048927 Ga0496124_0000903 Ga0496124_0000903_31896_33512 531
43 3300049459 Ga0495678_001436 Ga0495678_001436_11847_13463 531
44 iso_pu_bacteria 2830075706 2830077243 532
45 iso_pu_bacteria 2842747753 2842750617 532
46 iso_pu_bacteria 2848297114 2848297852 532
47 iso_pu_bacteria 2857524615 2857529444 532
48 iso_pu_bacteria 2857558681 2857560678 532
49 3300003320 rootH2_10185793 rootH2_101857932 533
50 3300048924 Ga0496121_0000391 Ga0496121_0000391_6591_8198 534
51 iso_pu_bacteria 2537561836 2538834714 534
52 iso_pu_bacteria 2902405164 2902409398 534
53 3300046460 Ga0495638_0027646 Ga0495638_0027646_984_2591 535
54 3300046491 Ga0495584_0004178 Ga0495584_0004178_2382_3989 535
55 3300046501 Ga0495607_0002341 Ga0495607_0002341_6661_8268 535
56 3300046513 Ga0495616_0002167 Ga0495616_0002167_5626_7233 535
57 3300046616 Ga0495668_0004523 Ga0495668_0004523_6842_8449 535
58 3300046660 Ga0495625_0066147 Ga0495625_0066147_901_2508 535
59 3300046684 Ga0495669_0003610 Ga0495669_0003610_1206_2813 535
60 3300046692 Ga0495671_0030620 Ga0495671_0030620_386_1993 535
61 3300046810 Ga0495660_0006111 Ga0495660_0006111_4359_5966 535
62 3300047446 Ga0495679_005724 Ga0495679_005724_2849_4456 535
63 3300047470 Ga0495681_0002210 Ga0495681_0002210_7022_8629 535
64 3300005367 Ga0070667_100003631 Ga0070667_1000036313 536
65 3300005455 Ga0070663_100042603 Ga0070663_1000426032 536
66 3300005841 Ga0068863_100027099 Ga0068863_1000270991 536
67 3300005843 Ga0068860_100044980 Ga0068860_1000449805 536
68 3300025986 Ga0207658_10000989 Ga0207658_100009896 536
69 3300026067 Ga0207678_10004869 Ga0207678_1000486911 536
70 3300026088 Ga0207641_10010856 Ga0207641_100108562 536
71 3300041486 Ga0451807_1767063 Ga0451807_1767063_1834_3450 536
72 3300046520 Ga0495637_0009941 Ga0495637_0009941_2658_4280 536
73 3300047469 Ga0495673_0000096 Ga0495673_0000096_120767_122389 536
74 3300048923 Ga0496120_0078874 Ga0496120_0078874_30_1646 536
75 3300048924 Ga0496121_0020234 Ga0496121_0020234_1111_2730 536
76 3300048927 Ga0496124_0000686 Ga0496124_0000686_1136_2752 536
77 3300048927 Ga0496124_0100022 Ga0496124_0100022_477_2186 536
78 3300053131 Ga0500652_000428 Ga0500652_000428_9729_11339 536
79 3300053153 Ga0500616_0000057 Ga0500616_0000057_176014_177624 536
80 3300005289 Ga0065704_10091757 Ga0065704_100917572 537
81 3300005331 Ga0070670_100000081 Ga0070670_10000008117 537
82 3300005367 Ga0070667_100001429 Ga0070667_10000142919 537
83 3300005618 Ga0068864_100000016 Ga0068864_10000001618 537
84 3300005841 Ga0068863_100001887 Ga0068863_1000018875 537
85 3300005844 Ga0068862_100000068 Ga0068862_10000006818 537
86 3300006178 Ga0075367_10000048 Ga0075367_1000004811 537
87 3300009011 Ga0105251_10002065 Ga0105251_100020658 537
88 3300009177 Ga0105248_10120507 Ga0105248_101205073 537
89 3300009553 Ga0105249_10002409 Ga0105249_100024099 537
90 3300013306 Ga0163162_10102341 Ga0163162_101023412 537
91 3300014325 Ga0163163_10127457 Ga0163163_101274572 537
92 3300025735 Ga0207713_1002261 Ga0207713_10022616 537
93 3300025925 Ga0207650_10000288 Ga0207650_1000028843 537
94 3300025941 Ga0207711_10000025 Ga0207711_10000025299 537
95 3300025961 Ga0207712_10006421 Ga0207712_100064214 537
96 3300025986 Ga0207658_10000466 Ga0207658_1000046624 537
97 3300026088 Ga0207641_10000103 Ga0207641_1000010317 537
98 3300026095 Ga0207676_10000044 Ga0207676_1000004417 537
99 3300028380 Ga0268265_10000142 Ga0268265_1000014217 537
100 3300046453 Ga0495627_000105 Ga0495627_000105_40849_42462 537
101 3300046524 Ga0495648_0007661 Ga0495648_0007661_5302_6915 537
102 3300047472 Ga0495686_0000171 Ga0495686_0000171_36753_38366 537
103 3300048920 Ga0496117_0013085 Ga0496117_0013085_2667_4325 537
104 3300048921 Ga0496118_0001099 Ga0496118_0001099_3472_5130 537
105 3300049459 Ga0495678_001605 Ga0495678_001605_11868_13481 537
106 3300050494 nmdc:mga06z11_25_c1 nmdc:mga06z11_25_c1_63099_64751 537
107 3300053108 Ga0500562_000436 Ga0500562_000436_8311_9924 537
108 3300001979 JGI24740J21852_10024573 JGI24740J21852_100245732 538
109 3300003215 JGI25153J46596_10017526 JGI25153J46596_100175262 538
110 3300003316 rootH1_10000877 rootH1_1000087710 538
111 3300003320 rootH2_10054931 rootH2_100549311 538
112 3300003761 Ga0055535_1003498 Ga0055535_10034984 538
113 3300003762 Ga0055542_1000286 Ga0055542_100028630 538
114 3300003763 Ga0055529_1000207 Ga0055529_100020730 538
115 3300003771 Ga0055526_1000046 Ga0055526_100004693 538
116 3300003794 Ga0055531_10003315 Ga0055531_100033156 538
117 3300005262 Ga0065165_1000030 Ga0065165_100003016 538
118 3300005328 Ga0070676_10074402 Ga0070676_100744021 538
119 3300005339 Ga0070660_100095862 Ga0070660_1000958622 538
120 3300005344 Ga0070661_100003960 Ga0070661_1000039608 538
121 3300005356 Ga0070674_100000934 Ga0070674_10000093414 538
122 3300005367 Ga0070667_100057808 Ga0070667_1000578083 538
123 3300005435 Ga0070714_100000439 Ga0070714_10000043931 538
124 3300005436 Ga0070713_100032205 Ga0070713_1000322054 538
125 3300005456 Ga0070678_100000152 Ga0070678_10000015226 538
126 3300005459 Ga0068867_100101981 Ga0068867_1001019812 538
127 3300005539 Ga0068853_100000093 Ga0068853_10000009312 538
128 3300005546 Ga0070696_100000439 Ga0070696_1000004399 538
129 3300005548 Ga0070665_100024110 Ga0070665_1000241104 538
130 3300005563 Ga0068855_100108744 Ga0068855_1001087442 538
131 3300005564 Ga0070664_100022193 Ga0070664_1000221933 538
132 3300005577 Ga0068857_100000118 Ga0068857_10000011824 538
133 3300005577 Ga0068857_100035882 Ga0068857_1000358824 538
134 3300005578 Ga0068854_100000460 Ga0068854_1000004606 538
135 3300005578 Ga0068854_100014703 Ga0068854_1000147033 538
136 3300005578 Ga0068854_100065288 Ga0068854_1000652884 538
137 3300005834 Ga0068851_10017801 Ga0068851_100178012 538
138 3300005834 Ga0068851_10021979 Ga0068851_100219792 538
139 3300009093 Ga0105240_10001507 Ga0105240_100015078 538
140 3300009093 Ga0105240_10003043 Ga0105240_1000304320 538
141 3300009093 Ga0105240_10003365 Ga0105240_100033654 538
142 3300009093 Ga0105240_10017872 Ga0105240_100178729 538
143 3300009093 Ga0105240_10051396 Ga0105240_100513962 538
144 3300009093 Ga0105240_10223298 Ga0105240_102232981 538
145 3300009098 Ga0105245_10000250 Ga0105245_1000025053 538
146 3300009148 Ga0105243_10000278 Ga0105243_100002785 538
147 3300009148 Ga0105243_10031015 Ga0105243_100310154 538
148 3300009545 Ga0105237_10000079 Ga0105237_1000007955 538
149 3300009545 Ga0105237_10116577 Ga0105237_101165772 538
150 3300009551 Ga0105238_10012222 Ga0105238_100122229 538
151 3300009551 Ga0105238_10110343 Ga0105238_101103432 538
152 3300010375 Ga0105239_10000164 Ga0105239_1000016436 538
153 3300010375 Ga0105239_10012650 Ga0105239_100126509 538
154 3300010375 Ga0105239_10242759 Ga0105239_102427592 538
155 3300012500 Ga0157314_1000002 Ga0157314_100000245 538
156 3300013102 Ga0157371_10000600 Ga0157371_1000060015 538
157 3300013308 Ga0157375_10142965 Ga0157375_101429652 538
158 3300021361 Ga0213872_10004452 Ga0213872_100044524 538
159 3300025230 Ga0209563_100105 Ga0209563_10010521 538
160 3300025242 Ga0209258_100359 Ga0209258_10035941 538
161 3300025250 Ga0209026_1000512 Ga0209026_10005126 538
162 3300025253 Ga0209677_105128 Ga0209677_1051283 538
163 3300025254 Ga0209148_1000011 Ga0209148_10000111162 538
164 3300025258 Ga0209129_1001370 Ga0209129_10013703 538
165 3300025272 Ga0209455_1000006 Ga0209455_100000630 538
166 3300025295 Ga0209564_1000277 Ga0209564_100027715 538
167 3300025297 Ga0209758_1000023 Ga0209758_1000023563 538
168 3300025297 Ga0209758_1000315 Ga0209758_100031552 538
169 3300025297 Ga0209758_1001114 Ga0209758_100111424 538
170 3300025298 Ga0209050_1000169 Ga0209050_1000169125 538
171 3300025304 Ga0209257_1000954 Ga0209257_100095415 538
172 3300025321 Ga0207656_10005179 Ga0207656_100051794 538
173 3300025904 Ga0207647_10012447 Ga0207647_100124474 538
174 3300025909 Ga0207705_10012118 Ga0207705_100121187 538
175 3300025911 Ga0207654_10002498 Ga0207654_100024983 538
176 3300025913 Ga0207695_10000401 Ga0207695_1000040142 538
177 3300025913 Ga0207695_10000541 Ga0207695_1000054154 538
178 3300025913 Ga0207695_10001146 Ga0207695_1000114628 538
179 3300025913 Ga0207695_10002555 Ga0207695_1000255522 538
180 3300025913 Ga0207695_10009698 Ga0207695_100096983 538
181 3300025913 Ga0207695_10017591 Ga0207695_100175917 538
182 3300025913 Ga0207695_10027642 Ga0207695_100276425 538
183 3300025913 Ga0207695_10030052 Ga0207695_100300522 538
184 3300025914 Ga0207671_10000009 Ga0207671_10000009322 538
185 3300025914 Ga0207671_10005687 Ga0207671_100056879 538
186 3300025914 Ga0207671_10049485 Ga0207671_100494852 538
187 3300025914 Ga0207671_10062384 Ga0207671_100623842 538
188 3300025920 Ga0207649_10001949 Ga0207649_100019499 538
189 3300025924 Ga0207694_10086342 Ga0207694_100863422 538
190 3300025927 Ga0207687_10000184 Ga0207687_1000018442 538
191 3300025929 Ga0207664_10000808 Ga0207664_100008084 538
192 3300025933 Ga0207706_10022493 Ga0207706_100224933 538
193 3300025935 Ga0207709_10000039 Ga0207709_1000003927 538
194 3300025937 Ga0207669_10000299 Ga0207669_1000029916 538
195 3300025937 Ga0207669_10000778 Ga0207669_100007787 538
196 3300025945 Ga0207679_10075046 Ga0207679_100750463 538
197 3300025949 Ga0207667_10000006 Ga0207667_10000006479 538
198 3300025949 Ga0207667_10056611 Ga0207667_100566113 538
199 3300025981 Ga0207640_10001183 Ga0207640_1000118310 538
200 3300025981 Ga0207640_10009670 Ga0207640_100096704 538
201 3300025981 Ga0207640_10013871 Ga0207640_100138712 538
202 3300025981 Ga0207640_10014482 Ga0207640_100144827 538
203 3300025981 Ga0207640_10056419 Ga0207640_100564193 538
204 3300026041 Ga0207639_10020267 Ga0207639_100202674 538
205 3300026067 Ga0207678_10031593 Ga0207678_100315932 538
206 3300026089 Ga0207648_10119858 Ga0207648_101198582 538
207 3300026116 Ga0207674_10000128 Ga0207674_1000012894 538
208 3300026116 Ga0207674_10003295 Ga0207674_1000329521 538
209 3300026116 Ga0207674_10008661 Ga0207674_100086615 538
210 3300026116 Ga0207674_10024386 Ga0207674_100243865 538
211 3300026121 Ga0207683_10050375 Ga0207683_100503753 538
212 3300028379 Ga0268266_10000015 Ga0268266_1000001523 538
213 3300028379 Ga0268266_10014983 Ga0268266_100149833 538
214 3300028786 Ga0307517_10041514 Ga0307517_100415144 538
215 3300028800 Ga0265338_10082606 Ga0265338_100826063 538
216 3300031090 Ga0265760_10000046 Ga0265760_100000464 538
217 3300031456 Ga0307513_10004256 Ga0307513_1000425617 538
218 3300031456 Ga0307513_10162544 Ga0307513_101625442 538
219 3300031730 Ga0307516_10001187 Ga0307516_100011879 538
220 3300031911 Ga0307412_10008041 Ga0307412_100080412 538
221 3300035113 Ga0373936_0016410 Ga0373936_0016410_688_2304 538
222 3300037466 Ga0395898_0028693 Ga0395898_0028693_2692_4308 538
223 3300039447 Ga0436361_1002550 Ga0436361_1002550_22205_23821 538
224 3300046453 Ga0495627_000103 Ga0495627_000103_39660_41399 538
225 3300046471 Ga0495650_0000355 Ga0495650_0000355_14388_16004 538
226 3300046492 Ga0495585_0002003 Ga0495585_0002003_752_2371 538
227 3300046492 Ga0495585_0024474 Ga0495585_0024474_1233_2849 538
228 3300046506 Ga0495583_0000860 Ga0495583_0000860_12382_13998 538
229 3300046506 Ga0495583_0015882 Ga0495583_0015882_1641_3257 538
230 3300046506 Ga0495583_0016259 Ga0495583_0016259_1879_3498 538
231 3300046507 Ga0495606_0001409 Ga0495606_0001409_29150_30766 538
232 3300046513 Ga0495616_0058447 Ga0495616_0058447_105_1721 538
233 3300046519 Ga0495632_0001628 Ga0495632_0001628_15456_17081 538
234 3300046522 Ga0495643_0000720 Ga0495643_0000720_19983_21599 538
235 3300046522 Ga0495643_0001754 Ga0495643_0001754_1346_2962 538
236 3300046522 Ga0495643_0031672 Ga0495643_0031672_959_2575 538
237 3300046524 Ga0495648_0000502 Ga0495648_0000502_10112_11731 538
238 3300046525 Ga0495663_0000402 Ga0495663_0000402_4211_5830 538
239 3300046528 Ga0495642_0018198 Ga0495642_0018198_222_1838 538
240 3300046558 Ga0495633_0000623 Ga0495633_0000623_13002_14618 538
241 3300046616 Ga0495668_0001102 Ga0495668_0001102_11573_13189 538
242 3300046660 Ga0495625_0000915 Ga0495625_0000915_25339_26958 538
243 3300046660 Ga0495625_0029115 Ga0495625_0029115_1152_2771 538
244 3300046684 Ga0495669_0000363 Ga0495669_0000363_11340_12956 538
245 3300047323 Ga0495683_0001531 Ga0495683_0001531_9235_10854 538
246 3300047323 Ga0495683_0014215 Ga0495683_0014215_1349_2965 538
247 3300047443 Ga0495687_000109 Ga0495687_000109_57336_58952 538
248 3300047443 Ga0495687_000228 Ga0495687_000228_28735_30351 538
249 3300047470 Ga0495681_0000174 Ga0495681_0000174_23323_25062 538
250 3300047470 Ga0495681_0006052 Ga0495681_0006052_2483_4099 538
251 3300048905 Ga0496102_0000126 Ga0496102_0000126_68853_70472 538
252 3300048906 Ga0496103_0000089 Ga0496103_0000089_33785_35404 538
253 3300048908 Ga0496105_0000574 Ga0496105_0000574_19950_21569 538
254 3300048918 Ga0496115_0000376 Ga0496115_0000376_3944_5563 538
255 3300048919 Ga0496116_0002801 Ga0496116_0002801_5803_7422 538
256 3300048920 Ga0496117_0000117 Ga0496117_0000117_169611_171230 538
257 3300048920 Ga0496117_0000329 Ga0496117_0000329_31601_33220 538
258 3300048921 Ga0496118_0000025 Ga0496118_0000025_371616_373235 538
259 3300048921 Ga0496118_0000164 Ga0496118_0000164_68787_70406 538
260 3300048922 Ga0496119_0017527 Ga0496119_0017527_3663_5282 538
261 3300048923 Ga0496120_0049675 Ga0496120_0049675_56_1675 538
262 3300048924 Ga0496121_0000072 Ga0496121_0000072_162355_163971 538
263 3300048924 Ga0496121_0000232 Ga0496121_0000232_49003_50622 538
264 3300048924 Ga0496121_0007176 Ga0496121_0007176_6060_7679 538
265 3300048924 Ga0496121_0020829 Ga0496121_0020829_4577_6205 538
266 3300048924 Ga0496121_0044334 Ga0496121_0044334_982_2598 538
267 3300048925 Ga0496122_0033943 Ga0496122_0033943_454_2070 538
268 3300048925 Ga0496122_0048808 Ga0496122_0048808_456_2075 538
269 3300048926 Ga0496123_0034351 Ga0496123_0034351_625_2244 538
270 3300048927 Ga0496124_0000041 Ga0496124_0000041_270900_272519 538
271 3300048928 Ga0496125_0000752 Ga0496125_0000752_31973_33601 538
272 3300048928 Ga0496125_0000962 Ga0496125_0000962_20297_21913 538
273 3300048928 Ga0496125_0008571 Ga0496125_0008571_4864_6483 538
274 3300048928 Ga0496125_0019406 Ga0496125_0019406_4593_6212 538
275 3300048929 Ga0496126_0000324 Ga0496126_0000324_31451_33070 538
276 3300048929 Ga0496126_0009273 Ga0496126_0009273_2737_4356 538
277 3300049570 Ga0501033_0039492 Ga0501033_0039492_1647_3263 538
278 3300049579 Ga0501043_0073007 Ga0501043_0073007_552_2168 538
279 3300053079 Ga0500610_0000058 Ga0500610_0000058_21174_22790 538
280 3300053130 Ga0500642_0000461 Ga0500642_0000461_8117_9736 538
281 3300053163 Ga0500639_000044 Ga0500639_000044_44332_45948 538
282 3300053177 Ga0500636_0000273 Ga0500636_0000273_4195_5814 538
283 3300053730 Ga0500645_000001 Ga0500645_000001_394811_396427 538
284 3300053735 Ga0500596_000035 Ga0500596_000035_4468_6087 538

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

418

495

0.94

PF00027

cNMP_binding

Cyclic nucleotide-binding domain

77

164

0.91

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

273

572

0.9

PF12831

FAD_oxidored

FAD dependent oxidoreductase

274

357

0.84

PF13738

Pyr_redox_3

Pyridine nucleotide-disulphide oxidoreductase

332

555

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
1i8t-assembly1.cif.gz_B structure of udp-galactopyranose mutase from e.coli 0.9904 226 256
4mig-assembly1.cif.gz_A pyranose 2-oxidase from phanerochaete chrysosporium, recombinant wild type 0.9802 226 255
4mig-assembly1.cif.gz_C pyranose 2-oxidase from phanerochaete chrysosporium, recombinant wild type 0.9793 226 255
4mif-assembly1.cif.gz_D pyranose 2-oxidase from phanerochaete chrysosporium, wild type from natural source 0.9788 226 255
4mif-assembly1.cif.gz_B pyranose 2-oxidase from phanerochaete chrysosporium, wild type from natural source 0.9752 226 255
ID Description Score Start End Superfamily
af_A0A1D6E7M3_47_537_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9906 227 255 3.50.50.60
af_P9WP27_7_319_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9665 227 254 3.40.50.720
4mo2B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9648 226 256 3.40.50.720
af_Q8LLD4_13_381_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9586 224 254 3.50.50.60
af_Q5ADQ8_44_340_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9517 226 254 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A3A8JRF0-F1-model_v4 FAD-binding protein 0.9176 9 537 GO:0008270
GO:0016491
AF-A0A3R9VQP6-F1-model_v4 Cyclic nucleotide-binding protein 0.9143 16 488 GO:0016491
AF-A0A2Z4LR94-F1-model_v4 Thioredoxin-disulfide reductase (EC 1.8.1.9) 0.9129 6 538 GO:0004791
AF-A0A3N5H7S7-F1-model_v4 FAD-dependent oxidoreductase 0.9097 9 538 GO:0016491
AF-A0A3R9VQP6-F1-model_v4 Cyclic nucleotide-binding protein 0.9088 16 488 GO:0016491

Feature Viewer

pLDDT pTM Quality
86.84 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map