F386194

General Info

Members Datasets Scaffolds Average Seq Length
284 211 255 168

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10058421|Ga0157370_100584214
Length 203
Sequence VRGDAVTRFDAVIARSASVEAIQSTLTENFREASMSISLPMTSGFDGGYRSLYIAAIAGLACAFVIGKALPVSMDAISAIVAPLCADSSPAASSPLDKVELIASHALPNVPGKRVTIVRVFYGPGGFTRAHRHAGTVTAYVTKGEIRSQLGGGPVEVFKVGQSFFEPPGTTHLVSANASNTEPAELIAVFVADEGAELTTYLD

Samples

Sample ID Description Type Environment
1 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
2 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
3 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
4 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
5 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
6 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
7 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
8 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
9 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
10 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
11 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
12 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
13 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
14 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
15 2904699407
16 2906610324
17 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
18 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
19 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
20 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
21 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
22 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
23 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
24 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
60 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
61 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
62 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
77 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
78 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
104 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
105 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
106 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
107 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
111 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
112 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
113 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
127 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
128 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
129 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
130 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
131 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
132 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
133 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
134 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
135 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
136 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
137 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
138 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
139 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
140 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
141 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
142 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
143 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
144 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
145 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
146 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
147 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
148 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
149 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
150 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
151 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
152 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
153 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
154 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
155 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
158 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
159 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
160 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
161 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
162 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
163 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
164 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
165 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
166 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
167 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
168 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
169 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
176 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
177 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
178 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
184 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
185 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
186 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
187 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
188 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
189 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
190 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
191 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
192 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
193 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
194 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
195 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
196 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
197 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
198 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
199 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
200 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
201 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
202 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
203 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
204 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
205 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
208 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
209 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
210 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
211 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.07
Metatranscriptomes 0.35
Isolates 9.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.68
Nodule 10.56
Rhizoplane 2.11
Rhizosphere 61.97
Stem 0
Stem Tuber 0
Unclassified 12.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10209261 3300005327 Bacteria 1647
2 Ga0070680_100041347 3300005336 Bacteria 3738
3 Ga0070680_100908987 3300005336 Bacteria 759
4 Ga0070660_100149086 3300005339 Bacteria 1880
5 Ga0070660_100618300 3300005339 Bacteria 906
6 Ga0070691_10059637 3300005341 Bacteria 1834
7 Ga0070661_100170689 3300005344 Unclassified 1651
8 Ga0070674_100223477 3300005356 Bacteria 1466
9 Ga0070688_100840361 3300005365 Bacteria 721
10 Ga0070659_100517355 3300005366 Bacteria 1019
11 Ga0070714_100519533 3300005435 Bacteria 1137
12 Ga0070713_100172417 3300005436 Bacteria 1939
13 Ga0070678_100387039 3300005456 Bacteria 1211
14 Ga0070662_101074701 3300005457 Bacteria 690
15 Ga0070681_10016905 3300005458 Bacteria 7288
16 Ga0070681_10120754 3300005458 Bacteria 2555
17 Ga0070681_10194954 3300005458 Unclassified 1945
18 Ga0070706_100953031 3300005467 Bacteria 792
19 Ga0070679_100063561 3300005530 Bacteria 3679
20 Ga0070679_100092055 3300005530 Bacteria 3020
21 Ga0070679_100334722 3300005530 Bacteria 1462
22 Ga0070679_100562890 3300005530 Bacteria 1083
23 Ga0070684_100023053 3300005535 Bacteria 5199
24 Ga0070684_100228833 3300005535 Bacteria 1697
25 Ga0068853_100383555 3300005539 Bacteria 1313
26 Ga0070693_100877994 3300005547 Bacteria 670
27 Ga0068855_100196640 3300005563 Bacteria 2271
28 Ga0068855_100618560 3300005563 Bacteria 1166
29 Ga0070664_100165647 3300005564 Bacteria 1958
30 Ga0068857_100062042 3300005577 Bacteria 3323
31 Ga0068856_100235940 3300005614 Unclassified 1844
32 Ga0068852_100083733 3300005616 Bacteria 2837
33 Ga0068851_10071279 3300005834 Bacteria 1798
34 Ga0081540_1001231 3300005983 Bacteria 22351
35 Ga0081540_1004145 3300005983 Bacteria 11178
36 Ga0075365_10143500 3300006038 Bacteria 1658
37 Ga0075365_10425279 3300006038 Bacteria 938
38 Ga0075363_100003787 3300006048 Bacteria 6520
39 Ga0075364_10030824 3300006051 Bacteria 3443
40 Ga0070716_100290487 3300006173 Bacteria 1132
41 Ga0070712_100032189 3300006175 Bacteria 3539
42 Ga0075362_10196148 3300006177 Bacteria 982
43 Ga0075367_10330634 3300006178 Bacteria 961
44 Ga0075369_10005646 3300006186 Bacteria 4687
45 Ga0075370_10051033 3300006353 Bacteria 2347
46 Ga0099825_1036044 3300006941 Bacteria 1728
47 Ga0099824_1015465 3300006942 Bacteria 7214
48 Ga0099822_1000418 3300006943 Bacteria 38171
49 Ga0099822_1044876 3300006943 Bacteria 2157
50 Ga0099795_10017412 3300007788 Bacteria 2291
51 Ga0105240_10039623 3300009093 Bacteria 6031
52 Ga0105240_10256323 3300009093 Bacteria 2020
53 Ga0105240_10626829 3300009093 Bacteria 1181
54 Ga0105240_10675161 3300009093 Bacteria 1130
55 Ga0105240_11011388 3300009093 Bacteria 888
56 Ga0105245_10816319 3300009098 Bacteria 971
57 Ga0105248_10983696 3300009177 Bacteria 953
58 Ga0105237_10011335 3300009545 Bacteria 9431
59 Ga0105237_10430283 3300009545 Bacteria 1325
60 Ga0105237_10433567 3300009545 Bacteria 1320
61 Ga0105238_10043350 3300009551 Bacteria 4552
62 Ga0105238_10079633 3300009551 Bacteria 3266
63 Ga0105238_10156493 3300009551 Bacteria 2254
64 Ga0105238_10652619 3300009551 Bacteria 1062
65 Ga0099796_10141538 3300010159 Bacteria 940
66 Ga0105239_10121452 3300010375 Bacteria 2901
67 Ga0157373_10008261 3300013100 Bacteria 7739
68 Ga0157373_10169149 3300013100 Unclassified 1538
69 Ga0157370_10058421 3300013104 Bacteria 3666
70 Ga0157370_10099075 3300013104 Bacteria 2732
71 Ga0157369_10006011 3300013105 Bacteria 14101
72 Ga0157372_11960761 3300013307 Bacteria 673
73 Ga0182008_10027835 3300014497 Bacteria 2860
74 Ga0213876_10000882 3300021384 Bacteria 20073
75 Ga0213876_10169675 3300021384 Bacteria 1161
76 Ga0213876_10174024 3300021384 Bacteria 1145
77 Ga0213871_10125714 3300021441 Bacteria 767
78 Ga0209233_1004168 3300025261 Bacteria 4970
79 Ga0209564_1018717 3300025295 Bacteria 2626
80 Ga0207647_10056029 3300025904 Bacteria 2420
81 Ga0207647_10205444 3300025904 Bacteria 1139
82 Ga0207699_10032001 3300025906 Bacteria 2960
83 Ga0207699_10053828 3300025906 Bacteria 2388
84 Ga0207699_10138303 3300025906 Bacteria 1598
85 Ga0207707_10008157 3300025912 Bacteria 9086
86 Ga0207707_10165600 3300025912 Unclassified 1932
87 Ga0207707_10319298 3300025912 Bacteria 1341
88 Ga0207695_10047386 3300025913 Bacteria 4550
89 Ga0207695_10682906 3300025913 Bacteria 907
90 Ga0207671_10007288 3300025914 Bacteria 9622
91 Ga0207671_10200151 3300025914 Bacteria 1560
92 Ga0207693_10037233 3300025915 Bacteria 3835
93 Ga0207663_10403256 3300025916 Bacteria 1046
94 Ga0207660_10006673 3300025917 Bacteria 7483
95 Ga0207660_10100371 3300025917 Bacteria 2161
96 Ga0207660_10884308 3300025917 Bacteria 729
97 Ga0207657_10006568 3300025919 Bacteria 12044
98 Ga0207657_10149607 3300025919 Bacteria 1902
99 Ga0207649_10412855 3300025920 Bacteria 1012
100 Ga0207652_10013100 3300025921 Bacteria 6712
101 Ga0207652_10279780 3300025921 Bacteria 1505
102 Ga0207652_11611995 3300025921 Bacteria 553
103 Ga0207694_10026382 3300025924 Bacteria 4419
104 Ga0207694_10377677 3300025924 Bacteria 1176
105 Ga0207700_10115451 3300025928 Bacteria 2168
106 Ga0207700_10230965 3300025928 Bacteria 1573
107 Ga0207644_11114000 3300025931 Bacteria 663
108 Ga0207669_10235736 3300025937 Bacteria 1353
109 Ga0207665_10437810 3300025939 Bacteria 1001
110 Ga0207665_10833059 3300025939 Bacteria 730
111 Ga0207661_10083847 3300025944 Bacteria 2638
112 Ga0207661_10409434 3300025944 Bacteria 1230
113 Ga0207667_10061144 3300025949 Bacteria 3941
114 Ga0207667_10116570 3300025949 Bacteria 2752
115 Ga0207667_10226257 3300025949 Bacteria 1916
116 Ga0207639_10216526 3300026041 Bacteria 1651
117 Ga0207639_10273914 3300026041 Bacteria 1482
118 Ga0207639_10693794 3300026041 Bacteria 944
119 Ga0207678_10013911 3300026067 Bacteria 7072
120 Ga0207678_10154371 3300026067 Bacteria 1960
121 Ga0207702_10000956 3300026078 Bacteria 29726
122 Ga0207674_10111312 3300026116 Bacteria 2712
123 Ga0207683_10959835 3300026121 Bacteria 794
124 Ga0207698_10293208 3300026142 Bacteria 1510
125 Ga0209389_1000371 3300027296 Bacteria 26980
126 Ga0209389_1001311 3300027296 Bacteria 17364
127 Ga0209589_1000003 3300027357 Bacteria 629130
128 Ga0209589_1005194 3300027357 Bacteria 22161
129 Ga0209489_100003 3300027361 Bacteria 663105
130 Ga0209489_105336 3300027361 Bacteria 22405
131 Ga0209700_100003 3300027363 Bacteria 663105
132 Ga0209700_102860 3300027363 Bacteria 34208
133 Ga0265763_1002875 3300030763 Bacteria 1340
134 Ga0265339_10016071 3300031249 Bacteria 4470
135 Ga0307408_100358990 3300031548 Bacteria 1239
136 Ga0265314_10010704 3300031711 Bacteria 7632
137 Ga0265342_10024905 3300031712 Bacteria 3770
138 Ga0307516_10755635 3300031730 Bacteria 632
139 Ga0307406_10573361 3300031901 Bacteria 927
140 Ga0307412_10051864 3300031911 Bacteria 2714
141 Ga0307416_100848652 3300032002 Bacteria 1011
142 Ga0315911_1000001 3300033442 Bacteria 1088602
143 Ga0373927_0025705 3300035695 Bacteria 3849
144 Ga0373933_0374334 3300035724 Bacteria 927
145 Ga0373937_0034663 3300036401 Bacteria 4591
146 Ga0373925_0162609 3300037068 Bacteria 1759
147 Ga0395899_0054903 3300037312 Unclassified 2947
148 Ga0395900_0010048 3300037418 Bacteria 9682
149 Ga0395900_0574955 3300037418 Bacteria 1069
150 Ga0395898_0056034 3300037466 Bacteria 3844
151 Ga0395898_0130892 3300037466 Bacteria 2403
152 Ga0395898_0400007 3300037466 Bacteria 1310
153 Ga0395898_0501117 3300037466 Bacteria 1155
154 Ga0395901_0074772 3300038443 Bacteria 3534
155 Ga0436365_1686621 3300039437 Bacteria 2005
156 Ga0436365_1822426 3300039437 Bacteria 12503
157 Ga0436360_0270088 3300039438 Bacteria 1695
158 Ga0436361_0501006 3300039447 Bacteria 6607
159 Ga0451839_0350022 3300041496 Bacteria 1054
160 Ga0439458_0069872 3300042157 Bacteria 886
161 Ga0466969_0291324 3300044656 Bacteria 739
162 Ga0495603_0043370 3300046455 Bacteria 2686
163 Ga0495638_0077631 3300046460 Bacteria 2021
164 Ga0495651_0204762 3300046462 Bacteria 1378
165 Ga0495583_0103889 3300046506 Bacteria 1210
166 Ga0495606_0302567 3300046507 Bacteria 866
167 Ga0495610_0104785 3300046512 Bacteria 1261
168 Ga0495616_0005644 3300046513 Bacteria 7661
169 Ga0495620_0131149 3300046515 Bacteria 983
170 Ga0495628_0594365 3300046516 Bacteria 791
171 Ga0495631_0092331 3300046518 Bacteria 1303
172 Ga0495654_0008190 3300046530 Bacteria 5788
173 Ga0495609_0073077 3300046538 Bacteria 1505
174 Ga0495622_0268432 3300046557 Bacteria 748
175 Ga0495625_0033522 3300046660 Bacteria 3796
176 Ga0495625_0626435 3300046660 Bacteria 643
177 Ga0495661_0019263 3300046665 Bacteria 4475
178 Ga0495624_0408736 3300046690 Bacteria 815
179 Ga0495670_0003189 3300046691 Bacteria 8076
180 Ga0495671_0005505 3300046692 Bacteria 7413
181 Ga0495660_0052516 3300046810 Bacteria 2214
182 Ga0495604_0317588 3300047317 Bacteria 1042
183 Ga0495672_0058102 3300047320 Bacteria 2244
184 Ga0495683_0267399 3300047323 Bacteria 745
185 Ga0495675_0398976 3300047444 Bacteria 802
186 Ga0495686_0027564 3300047472 Bacteria 3708
187 Ga0495602_0220303 3300048088 Bacteria 1433
188 Ga0496102_0296653 3300048905 Bacteria 1524
189 Ga0496102_0523839 3300048905 Bacteria 1108
190 Ga0496115_0028467 3300048918 Bacteria 4380
191 Ga0496115_0588550 3300048918 Bacteria 886
192 Ga0496116_0024251 3300048919 Bacteria 4491
193 Ga0496117_0088505 3300048920 Bacteria 2003
194 Ga0496117_0195262 3300048920 Bacteria 1148
195 Ga0496118_0030727 3300048921 Bacteria 4472
196 Ga0496118_0057947 3300048921 Bacteria 2899
197 Ga0496119_0215521 3300048922 Bacteria 985
198 Ga0496120_0171773 3300048923 Bacteria 1072
199 Ga0496121_0039853 3300048924 Bacteria 4131
200 Ga0496121_0332119 3300048924 Bacteria 1019
201 Ga0496121_0372994 3300048924 Bacteria 943
202 Ga0496122_0063520 3300048925 Bacteria 2693
203 Ga0496123_0094002 3300048926 Bacteria 1768
204 Ga0496124_0252968 3300048927 Bacteria 1302
205 Ga0496125_0015845 3300048928 Bacteria 7262
206 Ga0496125_0024420 3300048928 Bacteria 5559
207 Ga0496126_0030076 3300048929 Bacteria 5152
208 Ga0496126_0072859 3300048929 Bacteria 3055
209 Ga0496126_0146104 3300048929 Bacteria 2031
210 Ga0496126_0453667 3300048929 Bacteria 1031
211 Ga0501033_0202766 3300049570 Bacteria 1416
212 Ga0501036_0287448 3300049572 Bacteria 1376
213 Ga0501039_0299203 3300049575 Bacteria 1265
214 Ga0501039_0800183 3300049575 Bacteria 735
215 Ga0501041_0704016 3300049577 Bacteria 646
216 Ga0501043_0541087 3300049579 Bacteria 866
217 Ga0501047_0016894 3300049581 Bacteria 6975
218 Ga0501067_0209658 3300049583 Bacteria 1085
219 Ga0501073_0195585 3300049589 Bacteria 1399
220 Ga0501075_0169670 3300049591 Bacteria 1665
221 Ga0501079_0592718 3300049741 Bacteria 872
222 Ga0501080_0263530 3300049742 Bacteria 1569
223 Ga0501083_0808791 3300049744 Bacteria 610
224 Ga0501035_0088956 3300049822 Bacteria 2720
225 Ga0501035_0170502 3300049822 Bacteria 1880
226 Ga0501044_0071253 3300049823 Bacteria 3534
227 Ga0501044_0120028 3300049823 Bacteria 2631
228 nmdc:mga03n38_4229_c1 3300050490 Bacteria 4722
229 nmdc:mga0yw44_30487_c1 3300050492 Bacteria 3126
230 nmdc:mga0yw44_393130_c1 3300050492 Bacteria 937
231 nmdc:mga0yw44_856205_c1 3300050492 Bacteria 617
232 nmdc:mga0sz30_13995_c1 3300050516 Bacteria 3151
233 Ga0500581_126084 3300053089 Bacteria 1230
234 Ga0500646_0015626 3300053090 Bacteria 1978
235 Ga0500651_0042103 3300053093 Bacteria 2878
236 Ga0500650_0001583 3300053098 Bacteria 6982
237 Ga0500554_014662 3300053102 Bacteria 2028
238 Ga0500556_0000006 3300053104 Bacteria 453982
239 Ga0500592_005700 3300053116 Bacteria 1981
240 Ga0500593_222468 3300053117 Bacteria 662
241 Ga0500594_0022879 3300053118 Bacteria 1579
242 Ga0500608_001256 3300053122 Bacteria 9030
243 Ga0500642_0000046 3300053130 Bacteria 82391
244 Ga0500658_0084843 3300053134 Bacteria 1360
245 Ga0500658_0285561 3300053134 Bacteria 758
246 Ga0500568_0000218 3300053139 Bacteria 49152
247 Ga0500588_0014658 3300053146 Bacteria 1992
248 Ga0500616_0000022 3300053153 Bacteria 460463
249 Ga0500622_0000755 3300053156 Bacteria 28169
250 Ga0500627_0134124 3300053158 Bacteria 1118
251 Ga0500633_0118184 3300053160 Bacteria 985
252 Ga0500645_030002 3300053730 Bacteria 1639
253 Ga0500609_021163 3300053731 Bacteria 887
254 Ga0501084_0622209 3300054114 Bacteria 912
255 Ga0501082_0893416 3300060353 Bacteria 777

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013100 Ga0157373_10008261 Ga0157373_100082614 163
2 3300042157 Ga0439458_0069872 Ga0439458_0069872_232_729 163
3 3300005983 Ga0081540_1001231 Ga0081540_10012312 164
4 3300031548 Ga0307408_100358990 Ga0307408_1003589902 164
5 3300032002 Ga0307416_100848652 Ga0307416_1008486522 164
6 3300049572 Ga0501036_0287448 Ga0501036_0287448_762_1259 164
7 3300049575 Ga0501039_0800183 Ga0501039_0800183_46_543 164
8 3300049577 Ga0501041_0704016 Ga0501041_0704016_67_564 164
9 3300049591 Ga0501075_0169670 Ga0501075_0169670_636_1133 164
10 3300049744 Ga0501083_0808791 Ga0501083_0808791_52_549 164
11 3300054114 Ga0501084_0622209 Ga0501084_0622209_338_835 164
12 3300060353 Ga0501082_0893416 Ga0501082_0893416_68_565 164
13 iso_pu_bacteria 2513237096 2513654595 164
14 iso_pu_bacteria 2513237137 2513860966 164
15 iso_pu_bacteria 2513237145 2513915226 164
16 iso_pu_bacteria 2524023228 2524540030 164
17 iso_pu_bacteria 2667528175 2671122373 164
18 iso_pu_bacteria 2728368998 2728751561 164
19 iso_pu_bacteria 2791355197 2793068654 164
20 iso_pu_bacteria 2885374607 2885375297 164
21 iso_pu_bacteria 2903748898 2903759291 164
22 iso_pu_bacteria 2904699407 2904703286 164
23 iso_pu_bacteria 2906610324 2906618489 164
24 iso_pu_bacteria 2906635258 2906640938 164
25 iso_pu_bacteria 2906660503 2906664185 164
26 iso_pu_bacteria 2908739725 2908742845 164
27 iso_pu_bacteria 2935630451 2935631786 164
28 iso_pu_bacteria 2941507105 2941513099 164
29 iso_pu_bacteria 2941515067 2941520997 164
30 iso_pu_bacteria 2941523033 2941526139 164
31 iso_pu_bacteria 8006933436 8006940806 164
32 iso_pu_bacteria 8006973647 8006980496 164
33 iso_pu_bacteria 8019555841 8019556890 164
34 3300005356 Ga0070674_100223477 Ga0070674_1002234772 165
35 3300005365 Ga0070688_100840361 Ga0070688_1008403611 165
36 3300005983 Ga0081540_1004145 Ga0081540_10041453 165
37 3300006038 Ga0075365_10425279 Ga0075365_104252792 165
38 3300007788 Ga0099795_10017412 Ga0099795_100174123 165
39 3300010159 Ga0099796_10141538 Ga0099796_101415382 165
40 3300021384 Ga0213876_10169675 Ga0213876_101696752 165
41 3300025906 Ga0207699_10032001 Ga0207699_100320013 165
42 3300025924 Ga0207694_10026382 Ga0207694_100263823 165
43 3300025937 Ga0207669_10235736 Ga0207669_102357362 165
44 3300025939 Ga0207665_10833059 Ga0207665_108330591 165
45 3300039437 Ga0436365_1686621 Ga0436365_1686621_170_667 165
46 3300048918 Ga0496115_0588550 Ga0496115_0588550_312_809 165
47 3300049583 Ga0501067_0209658 Ga0501067_0209658_113_613 165
48 iso_pu_bacteria 2513237098 2513678143 165
49 iso_pu_bacteria 2602042107 2603861905 165
50 iso_pu_bacteria 2857524615 2857526074 165
51 iso_pu_bacteria 2893066018 2893067652 165
52 iso_pu_bacteria 2903768456 2903770297 165
53 iso_pu_bacteria 2919073203 2919074074 165
54 iso_pu_bacteria 8019555841 8019559170 165
55 iso_pu_bacteria 8019565922 8019566130 165
56 3300005336 Ga0070680_100908987 Ga0070680_1009089871 166
57 3300005339 Ga0070660_100149086 Ga0070660_1001490862 166
58 3300005341 Ga0070691_10059637 Ga0070691_100596372 166
59 3300005458 Ga0070681_10120754 Ga0070681_101207543 166
60 3300005530 Ga0070679_100562890 Ga0070679_1005628902 166
61 3300006173 Ga0070716_100290487 Ga0070716_1002904872 166
62 3300006942 Ga0099824_1015465 Ga0099824_10154658 166
63 3300006943 Ga0099822_1000418 Ga0099822_100041829 166
64 3300009093 Ga0105240_10256323 Ga0105240_102563232 166
65 3300009093 Ga0105240_10626829 Ga0105240_106268291 166
66 3300009177 Ga0105248_10983696 Ga0105248_109836961 166
67 3300009545 Ga0105237_10433567 Ga0105237_104335672 166
68 3300009551 Ga0105238_10156493 Ga0105238_101564933 166
69 3300013104 Ga0157370_10099075 Ga0157370_100990753 166
70 3300013105 Ga0157369_10006011 Ga0157369_100060113 166
71 3300021441 Ga0213871_10125714 Ga0213871_101257141 166
72 3300025261 Ga0209233_1004168 Ga0209233_10041682 166
73 3300025912 Ga0207707_10008157 Ga0207707_100081572 166
74 3300025913 Ga0207695_10682906 Ga0207695_106829062 166
75 3300025916 Ga0207663_10403256 Ga0207663_104032562 166
76 3300025917 Ga0207660_10100371 Ga0207660_101003712 166
77 3300025919 Ga0207657_10149607 Ga0207657_101496072 166
78 3300026041 Ga0207639_10216526 Ga0207639_102165262 166
79 3300026041 Ga0207639_10693794 Ga0207639_106937942 166
80 3300027357 Ga0209589_1000003 Ga0209589_1000003450 166
81 3300027361 Ga0209489_100003 Ga0209489_100003501 166
82 3300027363 Ga0209700_100003 Ga0209700_100003501 166
83 3300033442 Ga0315911_1000001 Ga0315911_1000001280 166
84 3300037068 Ga0373925_0162609 Ga0373925_0162609_977_1477 166
85 3300048905 Ga0496102_0523839 Ga0496102_0523839_474_974 166
86 3300048924 Ga0496121_0332119 Ga0496121_0332119_421_921 166
87 3300048929 Ga0496126_0146104 Ga0496126_0146104_413_919 166
88 3300005436 Ga0070713_100172417 Ga0070713_1001724172 167
89 3300005458 Ga0070681_10016905 Ga0070681_100169051 167
90 3300005467 Ga0070706_100953031 Ga0070706_1009530312 167
91 3300005530 Ga0070679_100063561 Ga0070679_1000635611 167
92 3300005530 Ga0070679_100092055 Ga0070679_1000920552 167
93 3300005535 Ga0070684_100023053 Ga0070684_1000230535 167
94 3300005547 Ga0070693_100877994 Ga0070693_1008779941 167
95 3300005563 Ga0068855_100196640 Ga0068855_1001966402 167
96 3300005563 Ga0068855_100618560 Ga0068855_1006185602 167
97 3300005577 Ga0068857_100062042 Ga0068857_1000620424 167
98 3300006048 Ga0075363_100003787 Ga0075363_1000037872 167
99 3300006943 Ga0099822_1044876 Ga0099822_10448762 167
100 3300009093 Ga0105240_11011388 Ga0105240_110113882 167
101 3300009545 Ga0105237_10011335 Ga0105237_100113351 167
102 3300009545 Ga0105237_10430283 Ga0105237_104302832 167
103 3300009551 Ga0105238_10043350 Ga0105238_100433502 167
104 3300009551 Ga0105238_10079633 Ga0105238_100796331 167
105 3300013307 Ga0157372_11960761 Ga0157372_119607611 167
106 3300021384 Ga0213876_10000882 Ga0213876_100008826 167
107 3300021384 Ga0213876_10174024 Ga0213876_101740242 167
108 3300025906 Ga0207699_10053828 Ga0207699_100538282 167
109 3300025906 Ga0207699_10138303 Ga0207699_101383032 167
110 3300025912 Ga0207707_10319298 Ga0207707_103192982 167
111 3300025914 Ga0207671_10007288 Ga0207671_100072888 167
112 3300025914 Ga0207671_10200151 Ga0207671_102001512 167
113 3300025917 Ga0207660_10006673 Ga0207660_100066736 167
114 3300025921 Ga0207652_10013100 Ga0207652_100131002 167
115 3300025921 Ga0207652_10279780 Ga0207652_102797801 167
116 3300025924 Ga0207694_10377677 Ga0207694_103776772 167
117 3300025928 Ga0207700_10115451 Ga0207700_101154512 167
118 3300025931 Ga0207644_11114000 Ga0207644_111140001 167
119 3300025939 Ga0207665_10437810 Ga0207665_104378102 167
120 3300025944 Ga0207661_10409434 Ga0207661_104094342 167
121 3300025949 Ga0207667_10226257 Ga0207667_102262572 167
122 3300026078 Ga0207702_10000956 Ga0207702_1000095621 167
123 3300027296 Ga0209389_1000371 Ga0209389_100037116 167
124 3300027357 Ga0209589_1005194 Ga0209589_100519415 167
125 3300030763 Ga0265763_1002875 Ga0265763_10028752 167
126 3300035695 Ga0373927_0025705 Ga0373927_0025705_935_1438 167
127 3300039437 Ga0436365_1822426 Ga0436365_1822426_8309_8812 167
128 3300039438 Ga0436360_0270088 Ga0436360_0270088_159_662 167
129 3300039447 Ga0436361_0501006 Ga0436361_0501006_2329_2832 167
130 3300046455 Ga0495603_0043370 Ga0495603_0043370_1760_2272 167
131 3300046557 Ga0495622_0268432 Ga0495622_0268432_105_617 167
132 3300046660 Ga0495625_0626435 Ga0495625_0626435_69_581 167
133 3300046690 Ga0495624_0408736 Ga0495624_0408736_12_524 167
134 3300048929 Ga0496126_0072859 Ga0496126_0072859_863_1366 167
135 3300050490 nmdc:mga03n38_4229_c1 nmdc:mga03n38_4229_c1_132_635 167
136 3300005344 Ga0070661_100170689 Ga0070661_1001706892 168
137 3300005435 Ga0070714_100519533 Ga0070714_1005195332 168
138 3300005456 Ga0070678_100387039 Ga0070678_1003870392 168
139 3300005457 Ga0070662_101074701 Ga0070662_1010747011 168
140 3300005458 Ga0070681_10194954 Ga0070681_101949542 168
141 3300005530 Ga0070679_100334722 Ga0070679_1003347222 168
142 3300005535 Ga0070684_100228833 Ga0070684_1002288332 168
143 3300005539 Ga0068853_100383555 Ga0068853_1003835551 168
144 3300005564 Ga0070664_100165647 Ga0070664_1001656473 168
145 3300005614 Ga0068856_100235940 Ga0068856_1002359402 168
146 3300005616 Ga0068852_100083733 Ga0068852_1000837333 168
147 3300005834 Ga0068851_10071279 Ga0068851_100712792 168
148 3300006175 Ga0070712_100032189 Ga0070712_1000321893 168
149 3300006941 Ga0099825_1036044 Ga0099825_10360442 168
150 3300009093 Ga0105240_10039623 Ga0105240_100396235 168
151 3300009093 Ga0105240_10675161 Ga0105240_106751612 168
152 3300009098 Ga0105245_10816319 Ga0105245_108163192 168
153 3300009551 Ga0105238_10652619 Ga0105238_106526192 168
154 3300010375 Ga0105239_10121452 Ga0105239_101214523 168
155 3300013100 Ga0157373_10169149 Ga0157373_101691492 168
156 3300014497 Ga0182008_10027835 Ga0182008_100278353 168
157 3300025904 Ga0207647_10205444 Ga0207647_102054442 168
158 3300025912 Ga0207707_10165600 Ga0207707_101656002 168
159 3300025913 Ga0207695_10047386 Ga0207695_100473864 168
160 3300025915 Ga0207693_10037233 Ga0207693_100372332 168
161 3300025920 Ga0207649_10412855 Ga0207649_104128552 168
162 3300025921 Ga0207652_11611995 Ga0207652_116119951 168
163 3300025928 Ga0207700_10230965 Ga0207700_102309651 168
164 3300025944 Ga0207661_10083847 Ga0207661_100838472 168
165 3300025949 Ga0207667_10061144 Ga0207667_100611442 168
166 3300025949 Ga0207667_10116570 Ga0207667_101165704 168
167 3300026041 Ga0207639_10273914 Ga0207639_102739142 168
168 3300026067 Ga0207678_10154371 Ga0207678_101543712 168
169 3300026116 Ga0207674_10111312 Ga0207674_101113122 168
170 3300026121 Ga0207683_10959835 Ga0207683_109598351 168
171 3300026142 Ga0207698_10293208 Ga0207698_102932082 168
172 3300027296 Ga0209389_1001311 Ga0209389_100131111 168
173 3300027361 Ga0209489_105336 Ga0209489_10533621 168
174 3300027363 Ga0209700_102860 Ga0209700_10286020 168
175 3300031730 Ga0307516_10755635 Ga0307516_107556351 168
176 3300037312 Ga0395899_0054903 Ga0395899_0054903_323_835 168
177 3300037418 Ga0395900_0010048 Ga0395900_0010048_7251_7763 168
178 3300037418 Ga0395900_0574955 Ga0395900_0574955_478_987 168
179 3300037466 Ga0395898_0056034 Ga0395898_0056034_1047_1559 168
180 3300037466 Ga0395898_0130892 Ga0395898_0130892_297_803 168
181 3300037466 Ga0395898_0400007 Ga0395898_0400007_754_1263 168
182 3300037466 Ga0395898_0501117 Ga0395898_0501117_39_551 168
183 3300038443 Ga0395901_0074772 Ga0395901_0074772_1633_2145 168
184 3300044656 Ga0466969_0291324 Ga0466969_0291324_39_551 168
185 3300049570 Ga0501033_0202766 Ga0501033_0202766_192_698 168
186 3300049579 Ga0501043_0541087 Ga0501043_0541087_134_640 168
187 3300049581 Ga0501047_0016894 Ga0501047_0016894_2588_3094 168
188 3300049589 Ga0501073_0195585 Ga0501073_0195585_134_640 168
189 3300049823 Ga0501044_0120028 Ga0501044_0120028_34_567 168
190 3300050492 nmdc:mga0yw44_856205_c1 nmdc:mga0yw44_856205_c1_43_549 168
191 3300005327 Ga0070658_10209261 Ga0070658_102092612 169
192 3300005336 Ga0070680_100041347 Ga0070680_1000413472 169
193 3300005339 Ga0070660_100618300 Ga0070660_1006183002 169
194 3300005366 Ga0070659_100517355 Ga0070659_1005173551 169
195 3300006038 Ga0075365_10143500 Ga0075365_101435003 169
196 3300006051 Ga0075364_10030824 Ga0075364_100308245 169
197 3300006177 Ga0075362_10196148 Ga0075362_101961481 169
198 3300006178 Ga0075367_10330634 Ga0075367_103306342 169
199 3300006186 Ga0075369_10005646 Ga0075369_100056462 169
200 3300006353 Ga0075370_10051033 Ga0075370_100510334 169
201 3300013104 Ga0157370_10058421 Ga0157370_100584214 169
202 3300025295 Ga0209564_1018717 Ga0209564_10187173 169
203 3300025904 Ga0207647_10056029 Ga0207647_100560292 169
204 3300025917 Ga0207660_10884308 Ga0207660_108843082 169
205 3300025919 Ga0207657_10006568 Ga0207657_100065687 169
206 3300026067 Ga0207678_10013911 Ga0207678_100139113 169
207 3300031249 Ga0265339_10016071 Ga0265339_100160712 169
208 3300031711 Ga0265314_10010704 Ga0265314_100107042 169
209 3300031712 Ga0265342_10024905 Ga0265342_100249054 169
210 3300031901 Ga0307406_10573361 Ga0307406_105733612 169
211 3300031911 Ga0307412_10051864 Ga0307412_100518643 169
212 3300035724 Ga0373933_0374334 Ga0373933_0374334_244_756 169
213 3300036401 Ga0373937_0034663 Ga0373937_0034663_1486_1998 169
214 3300041496 Ga0451839_0350022 Ga0451839_0350022_164_673 169
215 3300046460 Ga0495638_0077631 Ga0495638_0077631_1189_1698 169
216 3300046462 Ga0495651_0204762 Ga0495651_0204762_308_820 169
217 3300046506 Ga0495583_0103889 Ga0495583_0103889_203_712 169
218 3300046507 Ga0495606_0302567 Ga0495606_0302567_297_806 169
219 3300046512 Ga0495610_0104785 Ga0495610_0104785_614_1123 169
220 3300046513 Ga0495616_0005644 Ga0495616_0005644_6298_6807 169
221 3300046515 Ga0495620_0131149 Ga0495620_0131149_323_832 169
222 3300046516 Ga0495628_0594365 Ga0495628_0594365_10_519 169
223 3300046518 Ga0495631_0092331 Ga0495631_0092331_626_1135 169
224 3300046530 Ga0495654_0008190 Ga0495654_0008190_1870_2379 169
225 3300046538 Ga0495609_0073077 Ga0495609_0073077_192_701 169
226 3300046660 Ga0495625_0033522 Ga0495625_0033522_2021_2530 169
227 3300046665 Ga0495661_0019263 Ga0495661_0019263_135_644 169
228 3300046691 Ga0495670_0003189 Ga0495670_0003189_5661_6170 169
229 3300046692 Ga0495671_0005505 Ga0495671_0005505_499_1008 169
230 3300046810 Ga0495660_0052516 Ga0495660_0052516_273_782 169
231 3300047317 Ga0495604_0317588 Ga0495604_0317588_36_545 169
232 3300047320 Ga0495672_0058102 Ga0495672_0058102_873_1382 169
233 3300047323 Ga0495683_0267399 Ga0495683_0267399_202_711 169
234 3300047444 Ga0495675_0398976 Ga0495675_0398976_91_603 169
235 3300047472 Ga0495686_0027564 Ga0495686_0027564_2399_2908 169
236 3300048088 Ga0495602_0220303 Ga0495602_0220303_636_1148 169
237 3300048905 Ga0496102_0296653 Ga0496102_0296653_43_552 169
238 3300048918 Ga0496115_0028467 Ga0496115_0028467_1383_1895 169
239 3300048919 Ga0496116_0024251 Ga0496116_0024251_467_976 169
240 3300048920 Ga0496117_0088505 Ga0496117_0088505_662_1174 169
241 3300048920 Ga0496117_0195262 Ga0496117_0195262_566_1075 169
242 3300048921 Ga0496118_0030727 Ga0496118_0030727_2156_2668 169
243 3300048921 Ga0496118_0057947 Ga0496118_0057947_851_1360 169
244 3300048922 Ga0496119_0215521 Ga0496119_0215521_89_598 169
245 3300048923 Ga0496120_0171773 Ga0496120_0171773_350_859 169
246 3300048924 Ga0496121_0039853 Ga0496121_0039853_1535_2044 169
247 3300048924 Ga0496121_0372994 Ga0496121_0372994_215_724 169
248 3300048925 Ga0496122_0063520 Ga0496122_0063520_695_1204 169
249 3300048926 Ga0496123_0094002 Ga0496123_0094002_203_712 169
250 3300048927 Ga0496124_0252968 Ga0496124_0252968_302_811 169
251 3300048928 Ga0496125_0015845 Ga0496125_0015845_1625_2134 169
252 3300048928 Ga0496125_0024420 Ga0496125_0024420_4453_4962 169
253 3300048929 Ga0496126_0030076 Ga0496126_0030076_141_653 169
254 3300048929 Ga0496126_0453667 Ga0496126_0453667_338_850 169
255 3300049575 Ga0501039_0299203 Ga0501039_0299203_62_571 169
256 3300049741 Ga0501079_0592718 Ga0501079_0592718_79_588 169
257 3300049742 Ga0501080_0263530 Ga0501080_0263530_137_646 169
258 3300049822 Ga0501035_0088956 Ga0501035_0088956_1257_1766 169
259 3300049822 Ga0501035_0170502 Ga0501035_0170502_776_1285 169
260 3300049823 Ga0501044_0071253 Ga0501044_0071253_2349_2858 169
261 3300050492 nmdc:mga0yw44_30487_c1 nmdc:mga0yw44_30487_c1_569_1078 169
262 3300050492 nmdc:mga0yw44_393130_c1 nmdc:mga0yw44_393130_c1_31_540 169
263 3300050516 nmdc:mga0sz30_13995_c1 nmdc:mga0sz30_13995_c1_914_1423 169
264 3300053089 Ga0500581_126084 Ga0500581_126084_335_844 169
265 3300053090 Ga0500646_0015626 Ga0500646_0015626_338_847 169
266 3300053093 Ga0500651_0042103 Ga0500651_0042103_2210_2719 169
267 3300053098 Ga0500650_0001583 Ga0500650_0001583_575_1084 169
268 3300053102 Ga0500554_014662 Ga0500554_014662_1188_1697 169
269 3300053104 Ga0500556_0000006 Ga0500556_0000006_19435_19944 169
270 3300053116 Ga0500592_005700 Ga0500592_005700_1002_1511 169
271 3300053117 Ga0500593_222468 Ga0500593_222468_57_566 169
272 3300053118 Ga0500594_0022879 Ga0500594_0022879_771_1280 169
273 3300053122 Ga0500608_001256 Ga0500608_001256_1782_2291 169
274 3300053130 Ga0500642_0000046 Ga0500642_0000046_79836_80345 169
275 3300053134 Ga0500658_0084843 Ga0500658_0084843_237_746 169
276 3300053134 Ga0500658_0285561 Ga0500658_0285561_147_659 169
277 3300053139 Ga0500568_0000218 Ga0500568_0000218_27181_27690 169
278 3300053146 Ga0500588_0014658 Ga0500588_0014658_1338_1847 169
279 3300053153 Ga0500616_0000022 Ga0500616_0000022_48880_49389 169
280 3300053156 Ga0500622_0000755 Ga0500622_0000755_3561_4070 169
281 3300053158 Ga0500627_0134124 Ga0500627_0134124_287_796 169
282 3300053160 Ga0500633_0118184 Ga0500633_0118184_10_519 169
283 3300053730 Ga0500645_030002 Ga0500645_030002_687_1196 169
284 3300053731 Ga0500609_021163 Ga0500609_021163_35_544 169

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

118

190

0.93

PF00190

Cupin_1

Cupin

85

201

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bu7-assembly1.cif.gz_B crystal structure and biochemical characterization of gdosp, a gentisate 1,2-dioxygenase from silicibacter pomeroyi 0.9146 81 155
2b8m-assembly1.cif.gz_A-2 crystal structure of a rmlc-like cupin family protein with a double-stranded beta-helix fold (mj0764) from methanocaldococcus jannaschii at 1.70 a resolution 0.8998 63 161
5jsp-assembly1.cif.gz_A new mechanistic insight from substrate and product bound structures of the metal-dependent dimethylsulfoniopropionate lyase dddq 0.8977 81 168
5jwp-assembly1.cif.gz_A crystal structure of human fih d201e variant in complex with zn, alpha-ketoglutarate, and hif1 alpha peptide. 0.896 82 159
3d8c-assembly1.cif.gz_A factor inhibiting hif-1 alpha d201g mutant in complex with zn(ii), alpha-ketoglutarate and hif-1 alpha 19mer 0.8954 82 159
ID Description Score Start End Superfamily
3bu7B00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9146 81 155 2.60.120.10
af_Q9FEC5_21_286_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9033 81 156 2.60.120.10
5jspB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8986 81 168 2.60.120.10
2yc0A01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8962 82 159 2.60.120.10
af_Q23540_37_144_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8807 63 88 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A2A5EFU2-F1-model_v4 Cupin 0.9885 63 168
AF-S9SZC4-F1-model_v4 deleted 0.9881 63 168
AF-J8RTN8-F1-model_v4 deleted 0.9839 83 168
AF-A0A2R7QSB1-F1-model_v4 deleted 0.9813 63 169
AF-A0A6A7L502-F1-model_v4 Cupin domain-containing protein 0.9809 76 167

Feature Viewer

pLDDT pTM Quality
74.66 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map