F386154

General Info

Members Datasets Scaffolds Average Seq Length
284 200 280 163

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10291915|Ga0105240_102919153
Length 188
Sequence VQAPRRQTDEQAMAEPTAGRLGSTPMKTLLIVWHSRTGGARRMAQAAAEGAAEEAQVRTRLVGAEAAGPDDLLAAEAFLFVAPENLAGLSGAMKEFFDRCYYPVLDRIQGRPYAAMICAGSDGTGALRQITRIATGWRLRPVAEPLIVCTHAQTPEAILAEKTLSAEALAPCRELGQALAAGLALGVF

Samples

Sample ID Description Type Environment
1 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
2 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
3 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
4 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
5 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
9 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
10 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
88 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
132 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
138 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
139 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
156 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
159 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
163 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
164 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
165 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
166 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
167 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
168 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
172 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
173 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
186 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
187 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
188 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
196 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
197 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
198 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
199 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
200 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.83
Metatranscriptomes 1.76
Isolates 1.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.45
Nodule 0.35
Rhizoplane 5.63
Rhizosphere 78.52
Stem 0
Stem Tuber 0
Unclassified 7.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24747J21853_1020037 3300001978 Bacteria 723
2 JGI24751J29686_10003193 3300002459 Bacteria 3302
3 rootH2_10259165 3300003320 Bacteria 2060
4 Ga0055532_1000075 3300003758 Bacteria 124604
5 Ga0055532_1000112 3300003758 Bacteria 86782
6 Ga0055535_1000013 3300003761 Bacteria 299614
7 Ga0055529_1000085 3300003763 Bacteria 140832
8 Ga0055530_10000140 3300003791 Bacteria 64560
9 Ga0055531_10001048 3300003794 Bacteria 21804
10 Ga0065165_1000412 3300005262 Bacteria 68242
11 Ga0065165_1057743 3300005262 Bacteria 1074
12 Ga0070658_10032237 3300005327 Bacteria 4213
13 Ga0070683_100000274 3300005329 Bacteria 35360
14 Ga0070683_100336879 3300005329 Bacteria 1436
15 Ga0070670_100000139 3300005331 Bacteria 67826
16 Ga0070670_100004357 3300005331 Bacteria 11843
17 Ga0070670_100738190 3300005331 Bacteria 887
18 Ga0070666_10028627 3300005335 Bacteria 3657
19 Ga0070680_100139067 3300005336 Bacteria 2036
20 Ga0068868_100000052 3300005338 Bacteria 66081
21 Ga0070660_100368193 3300005339 Bacteria 1185
22 Ga0070661_100010529 3300005344 Bacteria 6431
23 Ga0070661_100287899 3300005344 Bacteria 1276
24 Ga0070692_10065839 3300005345 Bacteria 1919
25 Ga0070668_100000015 3300005347 Bacteria 106650
26 Ga0070668_100003423 3300005347 Bacteria 11716
27 Ga0070669_100039911 3300005353 Bacteria 3412
28 Ga0070675_100000223 3300005354 Bacteria 36223
29 Ga0070671_100000380 3300005355 Bacteria 30594
30 Ga0070671_100000382 3300005355 Bacteria 30575
31 Ga0070674_100007268 3300005356 Bacteria 6524
32 Ga0070673_100001137 3300005364 Bacteria 15302
33 Ga0070667_100000017 3300005367 Bacteria 230531
34 Ga0070667_100000105 3300005367 Bacteria 106633
35 Ga0070667_100026829 3300005367 Bacteria 4794
36 Ga0070711_100039523 3300005439 Bacteria 3179
37 Ga0070678_100003044 3300005456 Bacteria 9286
38 Ga0070662_100246857 3300005457 Bacteria 1434
39 Ga0068867_100004818 3300005459 Bacteria 9499
40 Ga0070684_100124384 3300005535 Bacteria 2322
41 Ga0068853_100527943 3300005539 Bacteria 1116
42 Ga0068853_100539389 3300005539 Bacteria 1104
43 Ga0070672_100000161 3300005543 Bacteria 37259
44 Ga0070693_101078336 3300005547 Bacteria 611
45 Ga0070665_100001009 3300005548 Bacteria 35495
46 Ga0070665_100278868 3300005548 Bacteria 1673
47 Ga0068855_100064289 3300005563 Bacteria 4279
48 Ga0068855_100171068 3300005563 Bacteria 2460
49 Ga0068855_100502178 3300005563 Bacteria 1318
50 Ga0068855_100598503 3300005563 Bacteria 1189
51 Ga0070664_100006565 3300005564 Bacteria 9383
52 Ga0068854_100001281 3300005578 Bacteria 15123
53 Ga0068854_100022205 3300005578 Bacteria 4319
54 Ga0068854_100749204 3300005578 Bacteria 847
55 Ga0068856_100096375 3300005614 Bacteria 2947
56 Ga0068852_100000154 3300005616 Bacteria 45758
57 Ga0068859_100016335 3300005617 Bacteria 7458
58 Ga0068859_100033438 3300005617 Bacteria 5163
59 Ga0068859_101483935 3300005617 Bacteria 748
60 Ga0068864_100000164 3300005618 Bacteria 61477
61 Ga0068864_100000538 3300005618 Bacteria 32512
62 Ga0068864_100381529 3300005618 Bacteria 1336
63 Ga0068866_10012603 3300005718 Bacteria 3688
64 Ga0068851_10000269 3300005834 Bacteria 24320
65 Ga0068863_100000387 3300005841 Bacteria 44774
66 Ga0068863_100090163 3300005841 Bacteria 2907
67 Ga0068863_100096701 3300005841 Bacteria 2804
68 Ga0068858_100001965 3300005842 Bacteria 20997
69 Ga0068858_100002807 3300005842 Bacteria 17517
70 Ga0068858_101102323 3300005842 Bacteria 779
71 Ga0068860_100000056 3300005843 Bacteria 202751
72 Ga0068860_100000077 3300005843 Bacteria 171297
73 Ga0068862_100000108 3300005844 Bacteria 99413
74 Ga0068862_100000363 3300005844 Bacteria 49226
75 Ga0081455_10061983 3300005937 Bacteria 3144
76 Ga0075368_10009608 3300006042 Bacteria 3482
77 Ga0075364_10001563 3300006051 Bacteria 12520
78 Ga0070716_100121999 3300006173 Bacteria 1633
79 Ga0075367_10000928 3300006178 Bacteria 11877
80 Ga0097621_100001278 3300006237 Bacteria 17315
81 Ga0075370_10060991 3300006353 Bacteria 2149
82 Ga0068871_100000092 3300006358 Bacteria 52522
83 Ga0068865_100010710 3300006881 Bacteria 5715
84 Ga0068865_100111220 3300006881 Bacteria 2021
85 Ga0097620_100016335 3300006931 Bacteria 7458
86 Ga0097620_100033438 3300006931 Bacteria 5163
87 Ga0097620_101484146 3300006931 Bacteria 748
88 Ga0099794_10010470 3300007265 Unclassified 3938
89 Ga0099794_10115340 3300007265 Bacteria 1348
90 Ga0099795_10000820 3300007788 Bacteria 6147
91 Ga0105240_10071075 3300009093 Bacteria 4304
92 Ga0105240_10291915 3300009093 Bacteria 1869
93 Ga0105240_10473514 3300009093 Bacteria 1397
94 Ga0105245_10896147 3300009098 Bacteria 928
95 Ga0105242_10041289 3300009176 Bacteria 3720
96 Ga0105248_10008437 3300009177 Bacteria 11305
97 Ga0105248_10034079 3300009177 Bacteria 5691
98 Ga0105248_11311760 3300009177 Bacteria 819
99 Ga0105237_10071133 3300009545 Bacteria 3474
100 Ga0105237_10091312 3300009545 Bacteria 3035
101 Ga0105237_10469863 3300009545 Bacteria 1264
102 Ga0105249_10019020 3300009553 Bacteria 6126
103 Ga0099796_10007560 3300010159 Bacteria 2847
104 Ga0105239_10502925 3300010375 Bacteria 1378
105 Ga0105239_10614550 3300010375 Bacteria 1240
106 Ga0105239_11785588 3300010375 Bacteria 712
107 Ga0157370_10084896 3300013104 Bacteria 2975
108 Ga0157370_10094741 3300013104 Bacteria 2801
109 Ga0157374_10000136 3300013296 Bacteria 66574
110 Ga0157378_10002978 3300013297 Bacteria 15047
111 Ga0163162_10000403 3300013306 Bacteria 39589
112 Ga0157372_10031221 3300013307 Bacteria 5833
113 Ga0157372_10805915 3300013307 Bacteria 1091
114 Ga0157375_10004199 3300013308 Bacteria 12507
115 Ga0157375_11049992 3300013308 Bacteria 952
116 Ga0163163_10083891 3300014325 Bacteria 3192
117 Ga0163163_10417366 3300014325 Bacteria 1401
118 Ga0157380_10316185 3300014326 Bacteria 1445
119 Ga0157377_10004705 3300014745 Bacteria 6318
120 Ga0157379_10009636 3300014968 Bacteria 8407
121 Ga0157376_10000389 3300014969 Bacteria 28637
122 Ga0163161_10042157 3300017792 Bacteria 3282
123 Ga0206351_10784943 3300020077 Bacteria 3515
124 Ga0154015_1406881 3300020610 Bacteria 12449
125 Ga0213876_10157010 3300021384 Bacteria 1210
126 Ga0213875_10000375 3300021388 Bacteria 41005
127 Ga0209672_100299 3300025228 Bacteria 34200
128 Ga0209672_100322 3300025228 Bacteria 31292
129 Ga0209147_100005 3300025229 Bacteria 1036530
130 Ga0209258_100007 3300025242 Bacteria 1036530
131 Ga0209455_1000011 3300025272 Bacteria 947242
132 Ga0209257_1002224 3300025304 Bacteria 19957
133 Ga0207656_10001533 3300025321 Bacteria 7656
134 Ga0207688_10410493 3300025901 Bacteria 841
135 Ga0207680_10034640 3300025903 Bacteria 2891
136 Ga0207705_10032135 3300025909 Bacteria 3750
137 Ga0207695_10022865 3300025913 Bacteria 7082
138 Ga0207695_10185776 3300025913 Bacteria 1998
139 Ga0207695_10262509 3300025913 Bacteria 1624
140 Ga0207671_10063446 3300025914 Bacteria 2745
141 Ga0207671_10580311 3300025914 Bacteria 894
142 Ga0207663_10019401 3300025916 Bacteria 3830
143 Ga0207660_10049229 3300025917 Bacteria 2986
144 Ga0207657_10450486 3300025919 Bacteria 1010
145 Ga0207649_10040643 3300025920 Bacteria 2828
146 Ga0207681_10033101 3300025923 Bacteria 3388
147 Ga0207681_10343936 3300025923 Bacteria 1192
148 Ga0207694_10004964 3300025924 Bacteria 10299
149 Ga0207650_10000033 3300025925 Bacteria 226809
150 Ga0207650_10001493 3300025925 Bacteria 16737
151 Ga0207650_10003805 3300025925 Bacteria 10317
152 Ga0207659_10000396 3300025926 Bacteria 26262
153 Ga0207687_10598882 3300025927 Bacteria 929
154 Ga0207700_10521402 3300025928 Bacteria 1053
155 Ga0207644_10000066 3300025931 Bacteria 76450
156 Ga0207644_10000475 3300025931 Bacteria 25868
157 Ga0207669_10107713 3300025937 Bacteria 1859
158 Ga0207704_10004543 3300025938 Bacteria 6349
159 Ga0207704_10143929 3300025938 Bacteria 1672
160 Ga0207691_10000043 3300025940 Bacteria 102398
161 Ga0207711_10008351 3300025941 Bacteria 8666
162 Ga0207711_10039017 3300025941 Bacteria 4039
163 Ga0207711_10872921 3300025941 Bacteria 837
164 Ga0207661_10004675 3300025944 Bacteria 9591
165 Ga0207661_10925242 3300025944 Bacteria 803
166 Ga0207679_10003052 3300025945 Bacteria 10369
167 Ga0207667_10076541 3300025949 Bacteria 3472
168 Ga0207667_10082608 3300025949 Bacteria 3327
169 Ga0207667_10156781 3300025949 Bacteria 2342
170 Ga0207651_10002190 3300025960 Bacteria 9245
171 Ga0207712_10011252 3300025961 Bacteria 5697
172 Ga0207668_10000012 3300025972 Bacteria 182541
173 Ga0207668_10000594 3300025972 Bacteria 22511
174 Ga0207640_10001075 3300025981 Bacteria 15131
175 Ga0207640_10005006 3300025981 Bacteria 7205
176 Ga0207640_10839432 3300025981 Bacteria 799
177 Ga0207658_10000011 3300025986 Bacteria 239620
178 Ga0207658_10000848 3300025986 Bacteria 25553
179 Ga0207658_10010819 3300025986 Bacteria 6208
180 Ga0207677_10005289 3300026023 Bacteria 6998
181 Ga0207703_10000474 3300026035 Bacteria 42009
182 Ga0207703_10002013 3300026035 Bacteria 17939
183 Ga0207678_10200992 3300026067 Bacteria 1704
184 Ga0207702_10563506 3300026078 Bacteria 1115
185 Ga0207641_10004186 3300026088 Bacteria 12567
186 Ga0207641_10134833 3300026088 Bacteria 2221
187 Ga0207648_10009174 3300026089 Bacteria 9504
188 Ga0207676_10000175 3300026095 Bacteria 56138
189 Ga0207676_10000336 3300026095 Bacteria 40418
190 Ga0207683_10000091 3300026121 Bacteria 72654
191 Ga0207698_10000264 3300026142 Bacteria 31928
192 Ga0209281_1024538 3300027111 Bacteria 1132
193 Ga0209813_10036065 3300027866 Bacteria 1484
194 Ga0207428_10560057 3300027907 Unclassified 826
195 Ga0268266_10001718 3300028379 Bacteria 25077
196 Ga0268266_10239688 3300028379 Bacteria 1673
197 Ga0268266_10374663 3300028379 Bacteria 1341
198 Ga0268265_10000442 3300028380 Bacteria 43732
199 Ga0268265_10058443 3300028380 Bacteria 2944
200 Ga0268265_10576099 3300028380 Bacteria 1072
201 Ga0268264_10000032 3300028381 Bacteria 408337
202 Ga0268264_10000089 3300028381 Bacteria 234760
203 Ga0307517_10104343 3300028786 Bacteria 2208
204 Ga0307515_10000043 3300028794 Bacteria 304612
205 Ga0265770_1000710 3300030878 Bacteria 4636
206 Ga0265760_10000421 3300031090 Bacteria 11884
207 Ga0307513_10066689 3300031456 Bacteria 3780
208 Ga0307408_100025629 3300031548 Bacteria 4040
209 Ga0307516_10004733 3300031730 Bacteria 16636
210 Ga0307405_10011989 3300031731 Bacteria 4567
211 Ga0307413_10062108 3300031824 Bacteria 2309
212 Ga0307410_10044472 3300031852 Bacteria 2950
213 Ga0307406_10059462 3300031901 Bacteria 2460
214 Ga0307407_10014584 3300031903 Bacteria 3855
215 Ga0307412_10007868 3300031911 Bacteria 6070
216 Ga0307409_100236932 3300031995 Bacteria 1658
217 Ga0307409_100524648 3300031995 Bacteria 1158
218 Ga0307416_100036200 3300032002 Bacteria 3782
219 Ga0307414_10025060 3300032004 Bacteria 3813
220 Ga0307411_10017352 3300032005 Bacteria 4099
221 Ga0307415_100057069 3300032126 Bacteria 2681
222 Ga0373940_0040598 3300035088 Unclassified 1278
223 Ga0373940_0131942 3300035088 Bacteria 783
224 Ga0373946_0468951 3300035171 Bacteria 643
225 Ga0373937_0453679 3300036401 Bacteria 1218
226 Ga0372808_023038 3300036459 Bacteria 895
227 Ga0316582_1126426 3300036647 Bacteria 535
228 Ga0395905_0009910 3300037471 Bacteria 9285
229 Ga0395905_0992356 3300037471 Bacteria 743
230 Ga0436365_0136013 3300039437 Bacteria 611
231 Ga0436365_0501094 3300039437 Archaea 528
232 Ga0436365_1533686 3300039437 Bacteria 1369
233 Ga0436360_0998549 3300039438 Bacteria 1034
234 Ga0436363_0500612 3300039450 Bacteria 627
235 Ga0439445_0082914 3300042004 Bacteria 897
236 Ga0450911_000286 3300042115 Bacteria 18668
237 Ga0466972_0025791 3300044658 Bacteria 2912
238 Ga0466957_0314170 3300044842 Bacteria 1056
239 Ga0466960_0021591 3300044901 Bacteria 2869
240 Ga0451576_0000114 3300045051 Bacteria 208462
241 Ga0495645_0304068 3300046543 Bacteria 1041
242 Ga0495671_0053157 3300046692 Bacteria 2011
243 Ga0495680_0644756 3300047322 Bacteria 704
244 Ga0495602_0544415 3300048088 Bacteria 805
245 Ga0495602_0991446 3300048088 Unclassified 555
246 Ga0496101_0113277 3300048904 Bacteria 2044
247 Ga0496102_0021580 3300048905 Bacteria 5696
248 Ga0496102_0641009 3300048905 Bacteria 985
249 Ga0496104_0245091 3300048907 Bacteria 1704
250 Ga0496105_0005448 3300048908 Bacteria 9656
251 Ga0496105_0343985 3300048908 Bacteria 1192
252 Ga0496107_0115639 3300048910 Bacteria 1974
253 Ga0496107_0394214 3300048910 Bacteria 1030
254 Ga0496108_0008012 3300048911 Bacteria 8573
255 Ga0496109_0000800 3300048912 Bacteria 26230
256 Ga0496110_0000225 3300048913 Bacteria 36623
257 Ga0496110_0142863 3300048913 Bacteria 2164
258 Ga0496111_0069132 3300048914 Bacteria 2568
259 Ga0496114_0055124 3300048917 Bacteria 3315
260 Ga0496114_0134275 3300048917 Bacteria 2139
261 Ga0496115_0005522 3300048918 Bacteria 9203
262 Ga0496119_0015978 3300048922 Bacteria 5741
263 Ga0496122_0095482 3300048925 Bacteria 2009
264 Ga0496123_0022068 3300048926 Bacteria 4922
265 Ga0496123_0040953 3300048926 Bacteria 3218
266 Ga0496123_0217121 3300048926 Bacteria 967
267 Ga0496125_0000233 3300048928 Bacteria 113820
268 Ga0496125_0006316 3300048928 Bacteria 12864
269 Ga0501033_0044610 3300049570 Bacteria 3300
270 Ga0501036_0830629 3300049572 Bacteria 760
271 Ga0501037_0018074 3300049573 Bacteria 5193
272 Ga0501047_0031531 3300049581 Bacteria 5112
273 Ga0501035_0740138 3300049822 Bacteria 790
274 Ga0501044_0356325 3300049823 Bacteria 1382
275 nmdc:mga00v17_11891_c1 3300050491 Bacteria 1868
276 nmdc:mga0k408_282460_c1 3300050493 Bacteria 991
277 nmdc:mga06z11_5800_c1 3300050494 Bacteria 4982
278 nmdc:mga07m45_29900_c1 3300050496 Bacteria 3016
279 Ga0495595_0552955 3300053084 Bacteria 588
280 Ga0500642_0016172 3300053130 Bacteria 2827

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049570 Ga0501033_0044610 Ga0501033_0044610_2068_2601 145
2 3300049573 Ga0501037_0018074 Ga0501037_0018074_1865_2398 145
3 3300002459 JGI24751J29686_10003193 JGI24751J29686_100031933 148
4 3300005331 Ga0070670_100004357 Ga0070670_1000043576 148
5 3300005347 Ga0070668_100000015 Ga0070668_100000015109 148
6 3300005353 Ga0070669_100039911 Ga0070669_1000399113 148
7 3300005355 Ga0070671_100000382 Ga0070671_10000038222 148
8 3300005367 Ga0070667_100000017 Ga0070667_100000017139 148
9 3300005617 Ga0068859_100016335 Ga0068859_1000163355 148
10 3300005841 Ga0068863_100096701 Ga0068863_1000967012 148
11 3300005842 Ga0068858_100001965 Ga0068858_10000196516 148
12 3300005843 Ga0068860_100000056 Ga0068860_100000056105 148
13 3300005844 Ga0068862_100000108 Ga0068862_10000010813 148
14 3300006931 Ga0097620_100016335 Ga0097620_1000163355 148
15 3300009177 Ga0105248_11311760 Ga0105248_113117602 148
16 3300025903 Ga0207680_10034640 Ga0207680_100346402 148
17 3300025923 Ga0207681_10033101 Ga0207681_100331012 148
18 3300025925 Ga0207650_10001493 Ga0207650_1000149310 148
19 3300025931 Ga0207644_10000066 Ga0207644_1000006615 148
20 3300025941 Ga0207711_10872921 Ga0207711_108729212 148
21 3300025972 Ga0207668_10000012 Ga0207668_10000012103 148
22 3300025986 Ga0207658_10000011 Ga0207658_10000011104 148
23 3300026035 Ga0207703_10000474 Ga0207703_1000047430 148
24 3300028380 Ga0268265_10000442 Ga0268265_1000044216 148
25 3300028381 Ga0268264_10000089 Ga0268264_10000089146 148
26 3300003791 Ga0055530_10000140 Ga0055530_100001409 151
27 3300003794 Ga0055531_10001048 Ga0055531_1000104815 151
28 3300006042 Ga0075368_10009608 Ga0075368_100096085 152
29 3300006051 Ga0075364_10001563 Ga0075364_1000156312 152
30 3300006178 Ga0075367_10000928 Ga0075367_100009286 152
31 3300006353 Ga0075370_10060991 Ga0075370_100609913 152
32 3300027866 Ga0209813_10036065 Ga0209813_100360653 152
33 3300050491 nmdc:mga00v17_11891_c1 nmdc:mga00v17_11891_c1_856_1347 152
34 3300050493 nmdc:mga0k408_282460_c1 nmdc:mga0k408_282460_c1_451_942 152
35 3300050494 nmdc:mga06z11_5800_c1 nmdc:mga06z11_5800_c1_681_1172 152
36 3300050496 nmdc:mga07m45_29900_c1 nmdc:mga07m45_29900_c1_2339_2830 152
37 3300009545 Ga0105237_10091312 Ga0105237_100913123 153
38 3300014325 Ga0163163_10083891 Ga0163163_100838913 153
39 3300025914 Ga0207671_10580311 Ga0207671_105803111 153
40 3300035088 Ga0373940_0040598 Ga0373940_0040598_12_473 153
41 3300035088 Ga0373940_0131942 Ga0373940_0131942_13_474 153
42 3300036647 Ga0316582_1126426 Ga0316582_1126426_59_520 153
43 3300048088 Ga0495602_0991446 Ga0495602_0991446_78_539 153
44 3300009545 Ga0105237_10469863 Ga0105237_104698631 154
45 3300021384 Ga0213876_10157010 Ga0213876_101570101 154
46 3300039437 Ga0436365_1533686 Ga0436365_1533686_577_1068 154
47 3300005262 Ga0065165_1000412 Ga0065165_100041218 155
48 3300025304 Ga0209257_1002224 Ga0209257_10022243 155
49 3300005329 Ga0070683_100336879 Ga0070683_1003368792 156
50 3300005344 Ga0070661_100287899 Ga0070661_1002878991 156
51 3300025944 Ga0207661_10925242 Ga0207661_109252422 156
52 3300028794 Ga0307515_10000043 Ga0307515_1000004356 156
53 3300053130 Ga0500642_0016172 Ga0500642_0016172_1842_2333 157
54 3300010375 Ga0105239_11785588 Ga0105239_117855881 158
55 3300031456 Ga0307513_10066689 Ga0307513_100666893 158
56 3300048928 Ga0496125_0006316 Ga0496125_0006316_46_537 158
57 3300013307 Ga0157372_10805915 Ga0157372_108059151 159
58 iso_pu_bacteria 2896253425 2896254705 159
59 3300005563 Ga0068855_100598503 Ga0068855_1005985032 161
60 3300025949 Ga0207667_10082608 Ga0207667_100826083 161
61 3300049572 Ga0501036_0830629 Ga0501036_0830629_196_687 161
62 3300049823 Ga0501044_0356325 Ga0501044_0356325_867_1358 161
63 iso_pu_bacteria 2596583598 2597030959 161
64 iso_pu_bacteria 2900577576 2900578799 161
65 iso_pu_bacteria 2932422444 2932425076 161
66 3300021388 Ga0213875_10000375 Ga0213875_1000037524 162
67 3300039438 Ga0436360_0998549 Ga0436360_0998549_381_869 162
68 3300001978 JGI24747J21853_1020037 JGI24747J21853_10200371 163
69 3300003320 rootH2_10259165 rootH2_102591652 163
70 3300003758 Ga0055532_1000075 Ga0055532_100007595 163
71 3300003758 Ga0055532_1000112 Ga0055532_100011246 163
72 3300003761 Ga0055535_1000013 Ga0055535_100001395 163
73 3300003763 Ga0055529_1000085 Ga0055529_100008522 163
74 3300005262 Ga0065165_1057743 Ga0065165_10577431 163
75 3300005327 Ga0070658_10032237 Ga0070658_100322372 163
76 3300005329 Ga0070683_100000274 Ga0070683_10000027431 163
77 3300005331 Ga0070670_100000139 Ga0070670_10000013938 163
78 3300005331 Ga0070670_100738190 Ga0070670_1007381902 163
79 3300005335 Ga0070666_10028627 Ga0070666_100286272 163
80 3300005336 Ga0070680_100139067 Ga0070680_1001390672 163
81 3300005338 Ga0068868_100000052 Ga0068868_10000005237 163
82 3300005339 Ga0070660_100368193 Ga0070660_1003681932 163
83 3300005344 Ga0070661_100010529 Ga0070661_1000105292 163
84 3300005345 Ga0070692_10065839 Ga0070692_100658391 163
85 3300005347 Ga0070668_100003423 Ga0070668_1000034232 163
86 3300005354 Ga0070675_100000223 Ga0070675_10000022324 163
87 3300005355 Ga0070671_100000380 Ga0070671_10000038033 163
88 3300005356 Ga0070674_100007268 Ga0070674_1000072685 163
89 3300005364 Ga0070673_100001137 Ga0070673_10000113713 163
90 3300005367 Ga0070667_100000105 Ga0070667_100000105120 163
91 3300005367 Ga0070667_100026829 Ga0070667_1000268292 163
92 3300005439 Ga0070711_100039523 Ga0070711_1000395234 163
93 3300005456 Ga0070678_100003044 Ga0070678_10000304411 163
94 3300005457 Ga0070662_100246857 Ga0070662_1002468572 163
95 3300005459 Ga0068867_100004818 Ga0068867_10000481811 163
96 3300005535 Ga0070684_100124384 Ga0070684_1001243844 163
97 3300005539 Ga0068853_100527943 Ga0068853_1005279431 163
98 3300005539 Ga0068853_100539389 Ga0068853_1005393892 163
99 3300005543 Ga0070672_100000161 Ga0070672_10000016138 163
100 3300005547 Ga0070693_101078336 Ga0070693_1010783361 163
101 3300005548 Ga0070665_100001009 Ga0070665_10000100928 163
102 3300005548 Ga0070665_100278868 Ga0070665_1002788682 163
103 3300005563 Ga0068855_100064289 Ga0068855_1000642893 163
104 3300005563 Ga0068855_100171068 Ga0068855_1001710681 163
105 3300005563 Ga0068855_100502178 Ga0068855_1005021782 163
106 3300005564 Ga0070664_100006565 Ga0070664_1000065654 163
107 3300005578 Ga0068854_100001281 Ga0068854_10000128112 163
108 3300005578 Ga0068854_100022205 Ga0068854_1000222053 163
109 3300005578 Ga0068854_100749204 Ga0068854_1007492041 163
110 3300005614 Ga0068856_100096375 Ga0068856_1000963752 163
111 3300005616 Ga0068852_100000154 Ga0068852_10000015439 163
112 3300005617 Ga0068859_100033438 Ga0068859_1000334382 163
113 3300005617 Ga0068859_101483935 Ga0068859_1014839352 163
114 3300005618 Ga0068864_100000164 Ga0068864_10000016462 163
115 3300005618 Ga0068864_100000538 Ga0068864_1000005389 163
116 3300005618 Ga0068864_100381529 Ga0068864_1003815291 163
117 3300005718 Ga0068866_10012603 Ga0068866_100126035 163
118 3300005834 Ga0068851_10000269 Ga0068851_1000026914 163
119 3300005841 Ga0068863_100000387 Ga0068863_10000038718 163
120 3300005841 Ga0068863_100090163 Ga0068863_1000901632 163
121 3300005842 Ga0068858_100002807 Ga0068858_1000028076 163
122 3300005842 Ga0068858_101102323 Ga0068858_1011023232 163
123 3300005843 Ga0068860_100000077 Ga0068860_10000007719 163
124 3300005844 Ga0068862_100000363 Ga0068862_10000036323 163
125 3300005937 Ga0081455_10061983 Ga0081455_100619834 163
126 3300006173 Ga0070716_100121999 Ga0070716_1001219992 163
127 3300006237 Ga0097621_100001278 Ga0097621_10000127814 163
128 3300006358 Ga0068871_100000092 Ga0068871_10000009213 163
129 3300006881 Ga0068865_100010710 Ga0068865_1000107105 163
130 3300006881 Ga0068865_100111220 Ga0068865_1001112203 163
131 3300006931 Ga0097620_100033438 Ga0097620_1000334382 163
132 3300006931 Ga0097620_101484146 Ga0097620_1014841462 163
133 3300007265 Ga0099794_10010470 Ga0099794_100104701 163
134 3300007265 Ga0099794_10115340 Ga0099794_101153403 163
135 3300007788 Ga0099795_10000820 Ga0099795_100008202 163
136 3300009093 Ga0105240_10071075 Ga0105240_100710753 163
137 3300009093 Ga0105240_10291915 Ga0105240_102919153 163
138 3300009093 Ga0105240_10473514 Ga0105240_104735142 163
139 3300009098 Ga0105245_10896147 Ga0105245_108961472 163
140 3300009176 Ga0105242_10041289 Ga0105242_100412892 163
141 3300009177 Ga0105248_10008437 Ga0105248_100084375 163
142 3300009177 Ga0105248_10034079 Ga0105248_100340794 163
143 3300009545 Ga0105237_10071133 Ga0105237_100711332 163
144 3300009553 Ga0105249_10019020 Ga0105249_100190207 163
145 3300010159 Ga0099796_10007560 Ga0099796_100075604 163
146 3300010375 Ga0105239_10502925 Ga0105239_105029252 163
147 3300010375 Ga0105239_10614550 Ga0105239_106145501 163
148 3300013104 Ga0157370_10084896 Ga0157370_100848962 163
149 3300013104 Ga0157370_10094741 Ga0157370_100947412 163
150 3300013296 Ga0157374_10000136 Ga0157374_1000013637 163
151 3300013297 Ga0157378_10002978 Ga0157378_1000297810 163
152 3300013306 Ga0163162_10000403 Ga0163162_1000040327 163
153 3300013307 Ga0157372_10031221 Ga0157372_100312216 163
154 3300013308 Ga0157375_10004199 Ga0157375_100041993 163
155 3300013308 Ga0157375_11049992 Ga0157375_110499922 163
156 3300014325 Ga0163163_10417366 Ga0163163_104173663 163
157 3300014326 Ga0157380_10316185 Ga0157380_103161852 163
158 3300014745 Ga0157377_10004705 Ga0157377_100047055 163
159 3300014968 Ga0157379_10009636 Ga0157379_100096361 163
160 3300014969 Ga0157376_10000389 Ga0157376_1000038930 163
161 3300017792 Ga0163161_10042157 Ga0163161_100421572 163
162 3300020077 Ga0206351_10784943 Ga0206351_107849433 163
163 3300020610 Ga0154015_1406881 Ga0154015_140688111 163
164 3300025228 Ga0209672_100299 Ga0209672_10029922 163
165 3300025228 Ga0209672_100322 Ga0209672_10032222 163
166 3300025229 Ga0209147_100005 Ga0209147_100005600 163
167 3300025242 Ga0209258_100007 Ga0209258_100007600 163
168 3300025272 Ga0209455_1000011 Ga0209455_1000011525 163
169 3300025321 Ga0207656_10001533 Ga0207656_100015337 163
170 3300025901 Ga0207688_10410493 Ga0207688_104104932 163
171 3300025909 Ga0207705_10032135 Ga0207705_100321355 163
172 3300025913 Ga0207695_10022865 Ga0207695_100228655 163
173 3300025913 Ga0207695_10185776 Ga0207695_101857762 163
174 3300025913 Ga0207695_10262509 Ga0207695_102625093 163
175 3300025914 Ga0207671_10063446 Ga0207671_100634464 163
176 3300025916 Ga0207663_10019401 Ga0207663_100194012 163
177 3300025917 Ga0207660_10049229 Ga0207660_100492292 163
178 3300025919 Ga0207657_10450486 Ga0207657_104504862 163
179 3300025920 Ga0207649_10040643 Ga0207649_100406432 163
180 3300025923 Ga0207681_10343936 Ga0207681_103439363 163
181 3300025924 Ga0207694_10004964 Ga0207694_1000496411 163
182 3300025925 Ga0207650_10000033 Ga0207650_10000033112 163
183 3300025925 Ga0207650_10003805 Ga0207650_100038059 163
184 3300025926 Ga0207659_10000396 Ga0207659_1000039623 163
185 3300025927 Ga0207687_10598882 Ga0207687_105988822 163
186 3300025928 Ga0207700_10521402 Ga0207700_105214022 163
187 3300025931 Ga0207644_10000475 Ga0207644_100004759 163
188 3300025937 Ga0207669_10107713 Ga0207669_101077132 163
189 3300025938 Ga0207704_10004543 Ga0207704_100045435 163
190 3300025938 Ga0207704_10143929 Ga0207704_101439292 163
191 3300025940 Ga0207691_10000043 Ga0207691_1000004337 163
192 3300025941 Ga0207711_10008351 Ga0207711_100083515 163
193 3300025941 Ga0207711_10039017 Ga0207711_100390174 163
194 3300025944 Ga0207661_10004675 Ga0207661_100046757 163
195 3300025945 Ga0207679_10003052 Ga0207679_100030529 163
196 3300025949 Ga0207667_10076541 Ga0207667_100765412 163
197 3300025949 Ga0207667_10156781 Ga0207667_101567812 163
198 3300025960 Ga0207651_10002190 Ga0207651_100021904 163
199 3300025961 Ga0207712_10011252 Ga0207712_100112522 163
200 3300025972 Ga0207668_10000594 Ga0207668_1000059417 163
201 3300025981 Ga0207640_10001075 Ga0207640_100010754 163
202 3300025981 Ga0207640_10005006 Ga0207640_100050063 163
203 3300025981 Ga0207640_10839432 Ga0207640_108394321 163
204 3300025986 Ga0207658_10000848 Ga0207658_1000084835 163
205 3300025986 Ga0207658_10010819 Ga0207658_100108193 163
206 3300026023 Ga0207677_10005289 Ga0207677_100052897 163
207 3300026035 Ga0207703_10002013 Ga0207703_1000201320 163
208 3300026067 Ga0207678_10200992 Ga0207678_102009923 163
209 3300026078 Ga0207702_10563506 Ga0207702_105635062 163
210 3300026088 Ga0207641_10004186 Ga0207641_100041865 163
211 3300026088 Ga0207641_10134833 Ga0207641_101348334 163
212 3300026089 Ga0207648_10009174 Ga0207648_100091742 163
213 3300026095 Ga0207676_10000175 Ga0207676_1000017512 163
214 3300026095 Ga0207676_10000336 Ga0207676_1000033631 163
215 3300026121 Ga0207683_10000091 Ga0207683_1000009130 163
216 3300026142 Ga0207698_10000264 Ga0207698_1000026429 163
217 3300027111 Ga0209281_1024538 Ga0209281_10245381 163
218 3300027907 Ga0207428_10560057 Ga0207428_105600571 163
219 3300028379 Ga0268266_10001718 Ga0268266_1000171819 163
220 3300028379 Ga0268266_10239688 Ga0268266_102396882 163
221 3300028379 Ga0268266_10374663 Ga0268266_103746632 163
222 3300028380 Ga0268265_10058443 Ga0268265_100584435 163
223 3300028380 Ga0268265_10576099 Ga0268265_105760992 163
224 3300028381 Ga0268264_10000032 Ga0268264_10000032397 163
225 3300028786 Ga0307517_10104343 Ga0307517_101043433 163
226 3300030878 Ga0265770_1000710 Ga0265770_10007102 163
227 3300031090 Ga0265760_10000421 Ga0265760_100004217 163
228 3300031548 Ga0307408_100025629 Ga0307408_1000256292 163
229 3300031730 Ga0307516_10004733 Ga0307516_1000473316 163
230 3300031731 Ga0307405_10011989 Ga0307405_100119893 163
231 3300031824 Ga0307413_10062108 Ga0307413_100621082 163
232 3300031852 Ga0307410_10044472 Ga0307410_100444723 163
233 3300031901 Ga0307406_10059462 Ga0307406_100594623 163
234 3300031903 Ga0307407_10014584 Ga0307407_100145842 163
235 3300031911 Ga0307412_10007868 Ga0307412_100078683 163
236 3300031995 Ga0307409_100236932 Ga0307409_1002369322 163
237 3300031995 Ga0307409_100524648 Ga0307409_1005246482 163
238 3300032002 Ga0307416_100036200 Ga0307416_1000362005 163
239 3300032004 Ga0307414_10025060 Ga0307414_100250603 163
240 3300032005 Ga0307411_10017352 Ga0307411_100173522 163
241 3300032126 Ga0307415_100057069 Ga0307415_1000570693 163
242 3300035171 Ga0373946_0468951 Ga0373946_0468951_138_629 163
243 3300036401 Ga0373937_0453679 Ga0373937_0453679_183_674 163
244 3300036459 Ga0372808_023038 Ga0372808_023038_96_587 163
245 3300037471 Ga0395905_0009910 Ga0395905_0009910_1518_2021 163
246 3300037471 Ga0395905_0992356 Ga0395905_0992356_194_685 163
247 3300039437 Ga0436365_0136013 Ga0436365_0136013_36_527 163
248 3300039437 Ga0436365_0501094 Ga0436365_0501094_15_518 163
249 3300039450 Ga0436363_0500612 Ga0436363_0500612_90_581 163
250 3300042004 Ga0439445_0082914 Ga0439445_0082914_45_539 163
251 3300042115 Ga0450911_000286 Ga0450911_000286_3650_4144 163
252 3300044658 Ga0466972_0025791 Ga0466972_0025791_2045_2539 163
253 3300044842 Ga0466957_0314170 Ga0466957_0314170_101_592 163
254 3300044901 Ga0466960_0021591 Ga0466960_0021591_1980_2474 163
255 3300045051 Ga0451576_0000114 Ga0451576_0000114_124058_124549 163
256 3300046543 Ga0495645_0304068 Ga0495645_0304068_501_992 163
257 3300046692 Ga0495671_0053157 Ga0495671_0053157_128_619 163
258 3300047322 Ga0495680_0644756 Ga0495680_0644756_146_637 163
259 3300048088 Ga0495602_0544415 Ga0495602_0544415_71_562 163
260 3300048904 Ga0496101_0113277 Ga0496101_0113277_1194_1685 163
261 3300048905 Ga0496102_0021580 Ga0496102_0021580_607_1098 163
262 3300048905 Ga0496102_0641009 Ga0496102_0641009_206_697 163
263 3300048907 Ga0496104_0245091 Ga0496104_0245091_74_565 163
264 3300048908 Ga0496105_0005448 Ga0496105_0005448_5138_5629 163
265 3300048908 Ga0496105_0343985 Ga0496105_0343985_215_706 163
266 3300048910 Ga0496107_0115639 Ga0496107_0115639_1284_1775 163
267 3300048910 Ga0496107_0394214 Ga0496107_0394214_203_694 163
268 3300048911 Ga0496108_0008012 Ga0496108_0008012_7586_8077 163
269 3300048912 Ga0496109_0000800 Ga0496109_0000800_18150_18641 163
270 3300048913 Ga0496110_0000225 Ga0496110_0000225_8642_9133 163
271 3300048913 Ga0496110_0142863 Ga0496110_0142863_808_1308 163
272 3300048914 Ga0496111_0069132 Ga0496111_0069132_1053_1544 163
273 3300048917 Ga0496114_0055124 Ga0496114_0055124_1618_2109 163
274 3300048917 Ga0496114_0134275 Ga0496114_0134275_1254_1745 163
275 3300048918 Ga0496115_0005522 Ga0496115_0005522_5696_6187 163
276 3300048922 Ga0496119_0015978 Ga0496119_0015978_5033_5524 163
277 3300048925 Ga0496122_0095482 Ga0496122_0095482_1057_1611 163
278 3300048926 Ga0496123_0022068 Ga0496123_0022068_904_1416 163
279 3300048926 Ga0496123_0040953 Ga0496123_0040953_1876_2388 163
280 3300048926 Ga0496123_0217121 Ga0496123_0217121_411_920 163
281 3300048928 Ga0496125_0000233 Ga0496125_0000233_17778_18290 163
282 3300049581 Ga0501047_0031531 Ga0501047_0031531_893_1384 163
283 3300049822 Ga0501035_0740138 Ga0501035_0740138_196_687 163
284 3300053084 Ga0495595_0552955 Ga0495595_0552955_18_509 163

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

69

154

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wid-assembly2.cif.gz_B structure of a flavodoxin from the domain archaea 0.8892 3 158
4laf-assembly1.cif.gz_C crystal structure of pnpb complex with fmn 0.869 1 162
5wid-assembly2.cif.gz_B structure of a flavodoxin from the domain archaea 0.866 3 158
2ohh-assembly1.cif.gz_A crystal structure of coenzyme f420h2 oxidase (fpra), a diiron flavoprotein, active oxidized state 0.859 2 156
4laf-assembly1.cif.gz_C crystal structure of pnpb complex with fmn 0.859 1 162
ID Description Score Start End Superfamily
af_O33313_1_149_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9338 1 158 3.40.50.360
af_O33313_1_149_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9218 1 158 3.40.50.360
2fz5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8565 4 156 3.40.50.360
1e5dB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8515 4 157 3.40.50.360
af_Q58142_244_391_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8511 3 156 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A562ZRT7-F1-model_v4 Flavodoxin family protein 0.9965 2 163 GO:0010181
GO:0016491
AF-A0A4R7FNV8-F1-model_v4 NADPH-dependent FMN reductase 0.9963 2 163 GO:0016491
AF-A0A498RZJ2-F1-model_v4 deleted 0.9962 1 163
AF-A0A2T4IFL4-F1-model_v4 Flavodoxin 0.9953 20 163 GO:0016491
AF-A0A0J0XP36-F1-model_v4 Flavo protein 0.9944 2 163 GO:0010181
GO:0016491

Feature Viewer

pLDDT pTM Quality
96.07 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map