F386154
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 284 | 200 | 280 | 163 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10291915|Ga0105240_102919153 |
| Length | 188 |
| Sequence | VQAPRRQTDEQAMAEPTAGRLGSTPMKTLLIVWHSRTGGARRMAQAAAEGAAEEAQVRTRLVGAEAAGPDDLLAAEAFLFVAPENLAGLSGAMKEFFDRCYYPVLDRIQGRPYAAMICAGSDGTGALRQITRIATGWRLRPVAEPLIVCTHAQTPEAILAEKTLSAEALAPCRELGQALAAGLALGVF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 2 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 3 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 4 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 5 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 47 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 53 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 54 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 55 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 57 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 63 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 86 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 87 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 88 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 132 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 134 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 138 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 139 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 140 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 141 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 142 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 143 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 144 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 145 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 146 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 147 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 148 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 149 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 150 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 151 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 152 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 153 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 154 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 155 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 156 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 157 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 158 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 159 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 160 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 161 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 162 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 163 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 164 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 165 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 166 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 167 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 168 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 169 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 170 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 175 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 176 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 177 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 178 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 179 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 180 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 181 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 182 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 183 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 184 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 185 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 186 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 187 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 188 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 189 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 196 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 197 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 198 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 199 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.83 |
| Metatranscriptomes | 1.76 |
| Isolates | 1.41 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.45 |
| Nodule | 0.35 |
| Rhizoplane | 5.63 |
| Rhizosphere | 78.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24747J21853_1020037 | 3300001978 | Bacteria | 723 |
| 2 | JGI24751J29686_10003193 | 3300002459 | Bacteria | 3302 |
| 3 | rootH2_10259165 | 3300003320 | Bacteria | 2060 |
| 4 | Ga0055532_1000075 | 3300003758 | Bacteria | 124604 |
| 5 | Ga0055532_1000112 | 3300003758 | Bacteria | 86782 |
| 6 | Ga0055535_1000013 | 3300003761 | Bacteria | 299614 |
| 7 | Ga0055529_1000085 | 3300003763 | Bacteria | 140832 |
| 8 | Ga0055530_10000140 | 3300003791 | Bacteria | 64560 |
| 9 | Ga0055531_10001048 | 3300003794 | Bacteria | 21804 |
| 10 | Ga0065165_1000412 | 3300005262 | Bacteria | 68242 |
| 11 | Ga0065165_1057743 | 3300005262 | Bacteria | 1074 |
| 12 | Ga0070658_10032237 | 3300005327 | Bacteria | 4213 |
| 13 | Ga0070683_100000274 | 3300005329 | Bacteria | 35360 |
| 14 | Ga0070683_100336879 | 3300005329 | Bacteria | 1436 |
| 15 | Ga0070670_100000139 | 3300005331 | Bacteria | 67826 |
| 16 | Ga0070670_100004357 | 3300005331 | Bacteria | 11843 |
| 17 | Ga0070670_100738190 | 3300005331 | Bacteria | 887 |
| 18 | Ga0070666_10028627 | 3300005335 | Bacteria | 3657 |
| 19 | Ga0070680_100139067 | 3300005336 | Bacteria | 2036 |
| 20 | Ga0068868_100000052 | 3300005338 | Bacteria | 66081 |
| 21 | Ga0070660_100368193 | 3300005339 | Bacteria | 1185 |
| 22 | Ga0070661_100010529 | 3300005344 | Bacteria | 6431 |
| 23 | Ga0070661_100287899 | 3300005344 | Bacteria | 1276 |
| 24 | Ga0070692_10065839 | 3300005345 | Bacteria | 1919 |
| 25 | Ga0070668_100000015 | 3300005347 | Bacteria | 106650 |
| 26 | Ga0070668_100003423 | 3300005347 | Bacteria | 11716 |
| 27 | Ga0070669_100039911 | 3300005353 | Bacteria | 3412 |
| 28 | Ga0070675_100000223 | 3300005354 | Bacteria | 36223 |
| 29 | Ga0070671_100000380 | 3300005355 | Bacteria | 30594 |
| 30 | Ga0070671_100000382 | 3300005355 | Bacteria | 30575 |
| 31 | Ga0070674_100007268 | 3300005356 | Bacteria | 6524 |
| 32 | Ga0070673_100001137 | 3300005364 | Bacteria | 15302 |
| 33 | Ga0070667_100000017 | 3300005367 | Bacteria | 230531 |
| 34 | Ga0070667_100000105 | 3300005367 | Bacteria | 106633 |
| 35 | Ga0070667_100026829 | 3300005367 | Bacteria | 4794 |
| 36 | Ga0070711_100039523 | 3300005439 | Bacteria | 3179 |
| 37 | Ga0070678_100003044 | 3300005456 | Bacteria | 9286 |
| 38 | Ga0070662_100246857 | 3300005457 | Bacteria | 1434 |
| 39 | Ga0068867_100004818 | 3300005459 | Bacteria | 9499 |
| 40 | Ga0070684_100124384 | 3300005535 | Bacteria | 2322 |
| 41 | Ga0068853_100527943 | 3300005539 | Bacteria | 1116 |
| 42 | Ga0068853_100539389 | 3300005539 | Bacteria | 1104 |
| 43 | Ga0070672_100000161 | 3300005543 | Bacteria | 37259 |
| 44 | Ga0070693_101078336 | 3300005547 | Bacteria | 611 |
| 45 | Ga0070665_100001009 | 3300005548 | Bacteria | 35495 |
| 46 | Ga0070665_100278868 | 3300005548 | Bacteria | 1673 |
| 47 | Ga0068855_100064289 | 3300005563 | Bacteria | 4279 |
| 48 | Ga0068855_100171068 | 3300005563 | Bacteria | 2460 |
| 49 | Ga0068855_100502178 | 3300005563 | Bacteria | 1318 |
| 50 | Ga0068855_100598503 | 3300005563 | Bacteria | 1189 |
| 51 | Ga0070664_100006565 | 3300005564 | Bacteria | 9383 |
| 52 | Ga0068854_100001281 | 3300005578 | Bacteria | 15123 |
| 53 | Ga0068854_100022205 | 3300005578 | Bacteria | 4319 |
| 54 | Ga0068854_100749204 | 3300005578 | Bacteria | 847 |
| 55 | Ga0068856_100096375 | 3300005614 | Bacteria | 2947 |
| 56 | Ga0068852_100000154 | 3300005616 | Bacteria | 45758 |
| 57 | Ga0068859_100016335 | 3300005617 | Bacteria | 7458 |
| 58 | Ga0068859_100033438 | 3300005617 | Bacteria | 5163 |
| 59 | Ga0068859_101483935 | 3300005617 | Bacteria | 748 |
| 60 | Ga0068864_100000164 | 3300005618 | Bacteria | 61477 |
| 61 | Ga0068864_100000538 | 3300005618 | Bacteria | 32512 |
| 62 | Ga0068864_100381529 | 3300005618 | Bacteria | 1336 |
| 63 | Ga0068866_10012603 | 3300005718 | Bacteria | 3688 |
| 64 | Ga0068851_10000269 | 3300005834 | Bacteria | 24320 |
| 65 | Ga0068863_100000387 | 3300005841 | Bacteria | 44774 |
| 66 | Ga0068863_100090163 | 3300005841 | Bacteria | 2907 |
| 67 | Ga0068863_100096701 | 3300005841 | Bacteria | 2804 |
| 68 | Ga0068858_100001965 | 3300005842 | Bacteria | 20997 |
| 69 | Ga0068858_100002807 | 3300005842 | Bacteria | 17517 |
| 70 | Ga0068858_101102323 | 3300005842 | Bacteria | 779 |
| 71 | Ga0068860_100000056 | 3300005843 | Bacteria | 202751 |
| 72 | Ga0068860_100000077 | 3300005843 | Bacteria | 171297 |
| 73 | Ga0068862_100000108 | 3300005844 | Bacteria | 99413 |
| 74 | Ga0068862_100000363 | 3300005844 | Bacteria | 49226 |
| 75 | Ga0081455_10061983 | 3300005937 | Bacteria | 3144 |
| 76 | Ga0075368_10009608 | 3300006042 | Bacteria | 3482 |
| 77 | Ga0075364_10001563 | 3300006051 | Bacteria | 12520 |
| 78 | Ga0070716_100121999 | 3300006173 | Bacteria | 1633 |
| 79 | Ga0075367_10000928 | 3300006178 | Bacteria | 11877 |
| 80 | Ga0097621_100001278 | 3300006237 | Bacteria | 17315 |
| 81 | Ga0075370_10060991 | 3300006353 | Bacteria | 2149 |
| 82 | Ga0068871_100000092 | 3300006358 | Bacteria | 52522 |
| 83 | Ga0068865_100010710 | 3300006881 | Bacteria | 5715 |
| 84 | Ga0068865_100111220 | 3300006881 | Bacteria | 2021 |
| 85 | Ga0097620_100016335 | 3300006931 | Bacteria | 7458 |
| 86 | Ga0097620_100033438 | 3300006931 | Bacteria | 5163 |
| 87 | Ga0097620_101484146 | 3300006931 | Bacteria | 748 |
| 88 | Ga0099794_10010470 | 3300007265 | Unclassified | 3938 |
| 89 | Ga0099794_10115340 | 3300007265 | Bacteria | 1348 |
| 90 | Ga0099795_10000820 | 3300007788 | Bacteria | 6147 |
| 91 | Ga0105240_10071075 | 3300009093 | Bacteria | 4304 |
| 92 | Ga0105240_10291915 | 3300009093 | Bacteria | 1869 |
| 93 | Ga0105240_10473514 | 3300009093 | Bacteria | 1397 |
| 94 | Ga0105245_10896147 | 3300009098 | Bacteria | 928 |
| 95 | Ga0105242_10041289 | 3300009176 | Bacteria | 3720 |
| 96 | Ga0105248_10008437 | 3300009177 | Bacteria | 11305 |
| 97 | Ga0105248_10034079 | 3300009177 | Bacteria | 5691 |
| 98 | Ga0105248_11311760 | 3300009177 | Bacteria | 819 |
| 99 | Ga0105237_10071133 | 3300009545 | Bacteria | 3474 |
| 100 | Ga0105237_10091312 | 3300009545 | Bacteria | 3035 |
| 101 | Ga0105237_10469863 | 3300009545 | Bacteria | 1264 |
| 102 | Ga0105249_10019020 | 3300009553 | Bacteria | 6126 |
| 103 | Ga0099796_10007560 | 3300010159 | Bacteria | 2847 |
| 104 | Ga0105239_10502925 | 3300010375 | Bacteria | 1378 |
| 105 | Ga0105239_10614550 | 3300010375 | Bacteria | 1240 |
| 106 | Ga0105239_11785588 | 3300010375 | Bacteria | 712 |
| 107 | Ga0157370_10084896 | 3300013104 | Bacteria | 2975 |
| 108 | Ga0157370_10094741 | 3300013104 | Bacteria | 2801 |
| 109 | Ga0157374_10000136 | 3300013296 | Bacteria | 66574 |
| 110 | Ga0157378_10002978 | 3300013297 | Bacteria | 15047 |
| 111 | Ga0163162_10000403 | 3300013306 | Bacteria | 39589 |
| 112 | Ga0157372_10031221 | 3300013307 | Bacteria | 5833 |
| 113 | Ga0157372_10805915 | 3300013307 | Bacteria | 1091 |
| 114 | Ga0157375_10004199 | 3300013308 | Bacteria | 12507 |
| 115 | Ga0157375_11049992 | 3300013308 | Bacteria | 952 |
| 116 | Ga0163163_10083891 | 3300014325 | Bacteria | 3192 |
| 117 | Ga0163163_10417366 | 3300014325 | Bacteria | 1401 |
| 118 | Ga0157380_10316185 | 3300014326 | Bacteria | 1445 |
| 119 | Ga0157377_10004705 | 3300014745 | Bacteria | 6318 |
| 120 | Ga0157379_10009636 | 3300014968 | Bacteria | 8407 |
| 121 | Ga0157376_10000389 | 3300014969 | Bacteria | 28637 |
| 122 | Ga0163161_10042157 | 3300017792 | Bacteria | 3282 |
| 123 | Ga0206351_10784943 | 3300020077 | Bacteria | 3515 |
| 124 | Ga0154015_1406881 | 3300020610 | Bacteria | 12449 |
| 125 | Ga0213876_10157010 | 3300021384 | Bacteria | 1210 |
| 126 | Ga0213875_10000375 | 3300021388 | Bacteria | 41005 |
| 127 | Ga0209672_100299 | 3300025228 | Bacteria | 34200 |
| 128 | Ga0209672_100322 | 3300025228 | Bacteria | 31292 |
| 129 | Ga0209147_100005 | 3300025229 | Bacteria | 1036530 |
| 130 | Ga0209258_100007 | 3300025242 | Bacteria | 1036530 |
| 131 | Ga0209455_1000011 | 3300025272 | Bacteria | 947242 |
| 132 | Ga0209257_1002224 | 3300025304 | Bacteria | 19957 |
| 133 | Ga0207656_10001533 | 3300025321 | Bacteria | 7656 |
| 134 | Ga0207688_10410493 | 3300025901 | Bacteria | 841 |
| 135 | Ga0207680_10034640 | 3300025903 | Bacteria | 2891 |
| 136 | Ga0207705_10032135 | 3300025909 | Bacteria | 3750 |
| 137 | Ga0207695_10022865 | 3300025913 | Bacteria | 7082 |
| 138 | Ga0207695_10185776 | 3300025913 | Bacteria | 1998 |
| 139 | Ga0207695_10262509 | 3300025913 | Bacteria | 1624 |
| 140 | Ga0207671_10063446 | 3300025914 | Bacteria | 2745 |
| 141 | Ga0207671_10580311 | 3300025914 | Bacteria | 894 |
| 142 | Ga0207663_10019401 | 3300025916 | Bacteria | 3830 |
| 143 | Ga0207660_10049229 | 3300025917 | Bacteria | 2986 |
| 144 | Ga0207657_10450486 | 3300025919 | Bacteria | 1010 |
| 145 | Ga0207649_10040643 | 3300025920 | Bacteria | 2828 |
| 146 | Ga0207681_10033101 | 3300025923 | Bacteria | 3388 |
| 147 | Ga0207681_10343936 | 3300025923 | Bacteria | 1192 |
| 148 | Ga0207694_10004964 | 3300025924 | Bacteria | 10299 |
| 149 | Ga0207650_10000033 | 3300025925 | Bacteria | 226809 |
| 150 | Ga0207650_10001493 | 3300025925 | Bacteria | 16737 |
| 151 | Ga0207650_10003805 | 3300025925 | Bacteria | 10317 |
| 152 | Ga0207659_10000396 | 3300025926 | Bacteria | 26262 |
| 153 | Ga0207687_10598882 | 3300025927 | Bacteria | 929 |
| 154 | Ga0207700_10521402 | 3300025928 | Bacteria | 1053 |
| 155 | Ga0207644_10000066 | 3300025931 | Bacteria | 76450 |
| 156 | Ga0207644_10000475 | 3300025931 | Bacteria | 25868 |
| 157 | Ga0207669_10107713 | 3300025937 | Bacteria | 1859 |
| 158 | Ga0207704_10004543 | 3300025938 | Bacteria | 6349 |
| 159 | Ga0207704_10143929 | 3300025938 | Bacteria | 1672 |
| 160 | Ga0207691_10000043 | 3300025940 | Bacteria | 102398 |
| 161 | Ga0207711_10008351 | 3300025941 | Bacteria | 8666 |
| 162 | Ga0207711_10039017 | 3300025941 | Bacteria | 4039 |
| 163 | Ga0207711_10872921 | 3300025941 | Bacteria | 837 |
| 164 | Ga0207661_10004675 | 3300025944 | Bacteria | 9591 |
| 165 | Ga0207661_10925242 | 3300025944 | Bacteria | 803 |
| 166 | Ga0207679_10003052 | 3300025945 | Bacteria | 10369 |
| 167 | Ga0207667_10076541 | 3300025949 | Bacteria | 3472 |
| 168 | Ga0207667_10082608 | 3300025949 | Bacteria | 3327 |
| 169 | Ga0207667_10156781 | 3300025949 | Bacteria | 2342 |
| 170 | Ga0207651_10002190 | 3300025960 | Bacteria | 9245 |
| 171 | Ga0207712_10011252 | 3300025961 | Bacteria | 5697 |
| 172 | Ga0207668_10000012 | 3300025972 | Bacteria | 182541 |
| 173 | Ga0207668_10000594 | 3300025972 | Bacteria | 22511 |
| 174 | Ga0207640_10001075 | 3300025981 | Bacteria | 15131 |
| 175 | Ga0207640_10005006 | 3300025981 | Bacteria | 7205 |
| 176 | Ga0207640_10839432 | 3300025981 | Bacteria | 799 |
| 177 | Ga0207658_10000011 | 3300025986 | Bacteria | 239620 |
| 178 | Ga0207658_10000848 | 3300025986 | Bacteria | 25553 |
| 179 | Ga0207658_10010819 | 3300025986 | Bacteria | 6208 |
| 180 | Ga0207677_10005289 | 3300026023 | Bacteria | 6998 |
| 181 | Ga0207703_10000474 | 3300026035 | Bacteria | 42009 |
| 182 | Ga0207703_10002013 | 3300026035 | Bacteria | 17939 |
| 183 | Ga0207678_10200992 | 3300026067 | Bacteria | 1704 |
| 184 | Ga0207702_10563506 | 3300026078 | Bacteria | 1115 |
| 185 | Ga0207641_10004186 | 3300026088 | Bacteria | 12567 |
| 186 | Ga0207641_10134833 | 3300026088 | Bacteria | 2221 |
| 187 | Ga0207648_10009174 | 3300026089 | Bacteria | 9504 |
| 188 | Ga0207676_10000175 | 3300026095 | Bacteria | 56138 |
| 189 | Ga0207676_10000336 | 3300026095 | Bacteria | 40418 |
| 190 | Ga0207683_10000091 | 3300026121 | Bacteria | 72654 |
| 191 | Ga0207698_10000264 | 3300026142 | Bacteria | 31928 |
| 192 | Ga0209281_1024538 | 3300027111 | Bacteria | 1132 |
| 193 | Ga0209813_10036065 | 3300027866 | Bacteria | 1484 |
| 194 | Ga0207428_10560057 | 3300027907 | Unclassified | 826 |
| 195 | Ga0268266_10001718 | 3300028379 | Bacteria | 25077 |
| 196 | Ga0268266_10239688 | 3300028379 | Bacteria | 1673 |
| 197 | Ga0268266_10374663 | 3300028379 | Bacteria | 1341 |
| 198 | Ga0268265_10000442 | 3300028380 | Bacteria | 43732 |
| 199 | Ga0268265_10058443 | 3300028380 | Bacteria | 2944 |
| 200 | Ga0268265_10576099 | 3300028380 | Bacteria | 1072 |
| 201 | Ga0268264_10000032 | 3300028381 | Bacteria | 408337 |
| 202 | Ga0268264_10000089 | 3300028381 | Bacteria | 234760 |
| 203 | Ga0307517_10104343 | 3300028786 | Bacteria | 2208 |
| 204 | Ga0307515_10000043 | 3300028794 | Bacteria | 304612 |
| 205 | Ga0265770_1000710 | 3300030878 | Bacteria | 4636 |
| 206 | Ga0265760_10000421 | 3300031090 | Bacteria | 11884 |
| 207 | Ga0307513_10066689 | 3300031456 | Bacteria | 3780 |
| 208 | Ga0307408_100025629 | 3300031548 | Bacteria | 4040 |
| 209 | Ga0307516_10004733 | 3300031730 | Bacteria | 16636 |
| 210 | Ga0307405_10011989 | 3300031731 | Bacteria | 4567 |
| 211 | Ga0307413_10062108 | 3300031824 | Bacteria | 2309 |
| 212 | Ga0307410_10044472 | 3300031852 | Bacteria | 2950 |
| 213 | Ga0307406_10059462 | 3300031901 | Bacteria | 2460 |
| 214 | Ga0307407_10014584 | 3300031903 | Bacteria | 3855 |
| 215 | Ga0307412_10007868 | 3300031911 | Bacteria | 6070 |
| 216 | Ga0307409_100236932 | 3300031995 | Bacteria | 1658 |
| 217 | Ga0307409_100524648 | 3300031995 | Bacteria | 1158 |
| 218 | Ga0307416_100036200 | 3300032002 | Bacteria | 3782 |
| 219 | Ga0307414_10025060 | 3300032004 | Bacteria | 3813 |
| 220 | Ga0307411_10017352 | 3300032005 | Bacteria | 4099 |
| 221 | Ga0307415_100057069 | 3300032126 | Bacteria | 2681 |
| 222 | Ga0373940_0040598 | 3300035088 | Unclassified | 1278 |
| 223 | Ga0373940_0131942 | 3300035088 | Bacteria | 783 |
| 224 | Ga0373946_0468951 | 3300035171 | Bacteria | 643 |
| 225 | Ga0373937_0453679 | 3300036401 | Bacteria | 1218 |
| 226 | Ga0372808_023038 | 3300036459 | Bacteria | 895 |
| 227 | Ga0316582_1126426 | 3300036647 | Bacteria | 535 |
| 228 | Ga0395905_0009910 | 3300037471 | Bacteria | 9285 |
| 229 | Ga0395905_0992356 | 3300037471 | Bacteria | 743 |
| 230 | Ga0436365_0136013 | 3300039437 | Bacteria | 611 |
| 231 | Ga0436365_0501094 | 3300039437 | Archaea | 528 |
| 232 | Ga0436365_1533686 | 3300039437 | Bacteria | 1369 |
| 233 | Ga0436360_0998549 | 3300039438 | Bacteria | 1034 |
| 234 | Ga0436363_0500612 | 3300039450 | Bacteria | 627 |
| 235 | Ga0439445_0082914 | 3300042004 | Bacteria | 897 |
| 236 | Ga0450911_000286 | 3300042115 | Bacteria | 18668 |
| 237 | Ga0466972_0025791 | 3300044658 | Bacteria | 2912 |
| 238 | Ga0466957_0314170 | 3300044842 | Bacteria | 1056 |
| 239 | Ga0466960_0021591 | 3300044901 | Bacteria | 2869 |
| 240 | Ga0451576_0000114 | 3300045051 | Bacteria | 208462 |
| 241 | Ga0495645_0304068 | 3300046543 | Bacteria | 1041 |
| 242 | Ga0495671_0053157 | 3300046692 | Bacteria | 2011 |
| 243 | Ga0495680_0644756 | 3300047322 | Bacteria | 704 |
| 244 | Ga0495602_0544415 | 3300048088 | Bacteria | 805 |
| 245 | Ga0495602_0991446 | 3300048088 | Unclassified | 555 |
| 246 | Ga0496101_0113277 | 3300048904 | Bacteria | 2044 |
| 247 | Ga0496102_0021580 | 3300048905 | Bacteria | 5696 |
| 248 | Ga0496102_0641009 | 3300048905 | Bacteria | 985 |
| 249 | Ga0496104_0245091 | 3300048907 | Bacteria | 1704 |
| 250 | Ga0496105_0005448 | 3300048908 | Bacteria | 9656 |
| 251 | Ga0496105_0343985 | 3300048908 | Bacteria | 1192 |
| 252 | Ga0496107_0115639 | 3300048910 | Bacteria | 1974 |
| 253 | Ga0496107_0394214 | 3300048910 | Bacteria | 1030 |
| 254 | Ga0496108_0008012 | 3300048911 | Bacteria | 8573 |
| 255 | Ga0496109_0000800 | 3300048912 | Bacteria | 26230 |
| 256 | Ga0496110_0000225 | 3300048913 | Bacteria | 36623 |
| 257 | Ga0496110_0142863 | 3300048913 | Bacteria | 2164 |
| 258 | Ga0496111_0069132 | 3300048914 | Bacteria | 2568 |
| 259 | Ga0496114_0055124 | 3300048917 | Bacteria | 3315 |
| 260 | Ga0496114_0134275 | 3300048917 | Bacteria | 2139 |
| 261 | Ga0496115_0005522 | 3300048918 | Bacteria | 9203 |
| 262 | Ga0496119_0015978 | 3300048922 | Bacteria | 5741 |
| 263 | Ga0496122_0095482 | 3300048925 | Bacteria | 2009 |
| 264 | Ga0496123_0022068 | 3300048926 | Bacteria | 4922 |
| 265 | Ga0496123_0040953 | 3300048926 | Bacteria | 3218 |
| 266 | Ga0496123_0217121 | 3300048926 | Bacteria | 967 |
| 267 | Ga0496125_0000233 | 3300048928 | Bacteria | 113820 |
| 268 | Ga0496125_0006316 | 3300048928 | Bacteria | 12864 |
| 269 | Ga0501033_0044610 | 3300049570 | Bacteria | 3300 |
| 270 | Ga0501036_0830629 | 3300049572 | Bacteria | 760 |
| 271 | Ga0501037_0018074 | 3300049573 | Bacteria | 5193 |
| 272 | Ga0501047_0031531 | 3300049581 | Bacteria | 5112 |
| 273 | Ga0501035_0740138 | 3300049822 | Bacteria | 790 |
| 274 | Ga0501044_0356325 | 3300049823 | Bacteria | 1382 |
| 275 | nmdc:mga00v17_11891_c1 | 3300050491 | Bacteria | 1868 |
| 276 | nmdc:mga0k408_282460_c1 | 3300050493 | Bacteria | 991 |
| 277 | nmdc:mga06z11_5800_c1 | 3300050494 | Bacteria | 4982 |
| 278 | nmdc:mga07m45_29900_c1 | 3300050496 | Bacteria | 3016 |
| 279 | Ga0495595_0552955 | 3300053084 | Bacteria | 588 |
| 280 | Ga0500642_0016172 | 3300053130 | Bacteria | 2827 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049570 | Ga0501033_0044610 | Ga0501033_0044610_2068_2601 | 145 |
| 2 | 3300049573 | Ga0501037_0018074 | Ga0501037_0018074_1865_2398 | 145 |
| 3 | 3300002459 | JGI24751J29686_10003193 | JGI24751J29686_100031933 | 148 |
| 4 | 3300005331 | Ga0070670_100004357 | Ga0070670_1000043576 | 148 |
| 5 | 3300005347 | Ga0070668_100000015 | Ga0070668_100000015109 | 148 |
| 6 | 3300005353 | Ga0070669_100039911 | Ga0070669_1000399113 | 148 |
| 7 | 3300005355 | Ga0070671_100000382 | Ga0070671_10000038222 | 148 |
| 8 | 3300005367 | Ga0070667_100000017 | Ga0070667_100000017139 | 148 |
| 9 | 3300005617 | Ga0068859_100016335 | Ga0068859_1000163355 | 148 |
| 10 | 3300005841 | Ga0068863_100096701 | Ga0068863_1000967012 | 148 |
| 11 | 3300005842 | Ga0068858_100001965 | Ga0068858_10000196516 | 148 |
| 12 | 3300005843 | Ga0068860_100000056 | Ga0068860_100000056105 | 148 |
| 13 | 3300005844 | Ga0068862_100000108 | Ga0068862_10000010813 | 148 |
| 14 | 3300006931 | Ga0097620_100016335 | Ga0097620_1000163355 | 148 |
| 15 | 3300009177 | Ga0105248_11311760 | Ga0105248_113117602 | 148 |
| 16 | 3300025903 | Ga0207680_10034640 | Ga0207680_100346402 | 148 |
| 17 | 3300025923 | Ga0207681_10033101 | Ga0207681_100331012 | 148 |
| 18 | 3300025925 | Ga0207650_10001493 | Ga0207650_1000149310 | 148 |
| 19 | 3300025931 | Ga0207644_10000066 | Ga0207644_1000006615 | 148 |
| 20 | 3300025941 | Ga0207711_10872921 | Ga0207711_108729212 | 148 |
| 21 | 3300025972 | Ga0207668_10000012 | Ga0207668_10000012103 | 148 |
| 22 | 3300025986 | Ga0207658_10000011 | Ga0207658_10000011104 | 148 |
| 23 | 3300026035 | Ga0207703_10000474 | Ga0207703_1000047430 | 148 |
| 24 | 3300028380 | Ga0268265_10000442 | Ga0268265_1000044216 | 148 |
| 25 | 3300028381 | Ga0268264_10000089 | Ga0268264_10000089146 | 148 |
| 26 | 3300003791 | Ga0055530_10000140 | Ga0055530_100001409 | 151 |
| 27 | 3300003794 | Ga0055531_10001048 | Ga0055531_1000104815 | 151 |
| 28 | 3300006042 | Ga0075368_10009608 | Ga0075368_100096085 | 152 |
| 29 | 3300006051 | Ga0075364_10001563 | Ga0075364_1000156312 | 152 |
| 30 | 3300006178 | Ga0075367_10000928 | Ga0075367_100009286 | 152 |
| 31 | 3300006353 | Ga0075370_10060991 | Ga0075370_100609913 | 152 |
| 32 | 3300027866 | Ga0209813_10036065 | Ga0209813_100360653 | 152 |
| 33 | 3300050491 | nmdc:mga00v17_11891_c1 | nmdc:mga00v17_11891_c1_856_1347 | 152 |
| 34 | 3300050493 | nmdc:mga0k408_282460_c1 | nmdc:mga0k408_282460_c1_451_942 | 152 |
| 35 | 3300050494 | nmdc:mga06z11_5800_c1 | nmdc:mga06z11_5800_c1_681_1172 | 152 |
| 36 | 3300050496 | nmdc:mga07m45_29900_c1 | nmdc:mga07m45_29900_c1_2339_2830 | 152 |
| 37 | 3300009545 | Ga0105237_10091312 | Ga0105237_100913123 | 153 |
| 38 | 3300014325 | Ga0163163_10083891 | Ga0163163_100838913 | 153 |
| 39 | 3300025914 | Ga0207671_10580311 | Ga0207671_105803111 | 153 |
| 40 | 3300035088 | Ga0373940_0040598 | Ga0373940_0040598_12_473 | 153 |
| 41 | 3300035088 | Ga0373940_0131942 | Ga0373940_0131942_13_474 | 153 |
| 42 | 3300036647 | Ga0316582_1126426 | Ga0316582_1126426_59_520 | 153 |
| 43 | 3300048088 | Ga0495602_0991446 | Ga0495602_0991446_78_539 | 153 |
| 44 | 3300009545 | Ga0105237_10469863 | Ga0105237_104698631 | 154 |
| 45 | 3300021384 | Ga0213876_10157010 | Ga0213876_101570101 | 154 |
| 46 | 3300039437 | Ga0436365_1533686 | Ga0436365_1533686_577_1068 | 154 |
| 47 | 3300005262 | Ga0065165_1000412 | Ga0065165_100041218 | 155 |
| 48 | 3300025304 | Ga0209257_1002224 | Ga0209257_10022243 | 155 |
| 49 | 3300005329 | Ga0070683_100336879 | Ga0070683_1003368792 | 156 |
| 50 | 3300005344 | Ga0070661_100287899 | Ga0070661_1002878991 | 156 |
| 51 | 3300025944 | Ga0207661_10925242 | Ga0207661_109252422 | 156 |
| 52 | 3300028794 | Ga0307515_10000043 | Ga0307515_1000004356 | 156 |
| 53 | 3300053130 | Ga0500642_0016172 | Ga0500642_0016172_1842_2333 | 157 |
| 54 | 3300010375 | Ga0105239_11785588 | Ga0105239_117855881 | 158 |
| 55 | 3300031456 | Ga0307513_10066689 | Ga0307513_100666893 | 158 |
| 56 | 3300048928 | Ga0496125_0006316 | Ga0496125_0006316_46_537 | 158 |
| 57 | 3300013307 | Ga0157372_10805915 | Ga0157372_108059151 | 159 |
| 58 | iso_pu_bacteria | 2896253425 | 2896254705 | 159 |
| 59 | 3300005563 | Ga0068855_100598503 | Ga0068855_1005985032 | 161 |
| 60 | 3300025949 | Ga0207667_10082608 | Ga0207667_100826083 | 161 |
| 61 | 3300049572 | Ga0501036_0830629 | Ga0501036_0830629_196_687 | 161 |
| 62 | 3300049823 | Ga0501044_0356325 | Ga0501044_0356325_867_1358 | 161 |
| 63 | iso_pu_bacteria | 2596583598 | 2597030959 | 161 |
| 64 | iso_pu_bacteria | 2900577576 | 2900578799 | 161 |
| 65 | iso_pu_bacteria | 2932422444 | 2932425076 | 161 |
| 66 | 3300021388 | Ga0213875_10000375 | Ga0213875_1000037524 | 162 |
| 67 | 3300039438 | Ga0436360_0998549 | Ga0436360_0998549_381_869 | 162 |
| 68 | 3300001978 | JGI24747J21853_1020037 | JGI24747J21853_10200371 | 163 |
| 69 | 3300003320 | rootH2_10259165 | rootH2_102591652 | 163 |
| 70 | 3300003758 | Ga0055532_1000075 | Ga0055532_100007595 | 163 |
| 71 | 3300003758 | Ga0055532_1000112 | Ga0055532_100011246 | 163 |
| 72 | 3300003761 | Ga0055535_1000013 | Ga0055535_100001395 | 163 |
| 73 | 3300003763 | Ga0055529_1000085 | Ga0055529_100008522 | 163 |
| 74 | 3300005262 | Ga0065165_1057743 | Ga0065165_10577431 | 163 |
| 75 | 3300005327 | Ga0070658_10032237 | Ga0070658_100322372 | 163 |
| 76 | 3300005329 | Ga0070683_100000274 | Ga0070683_10000027431 | 163 |
| 77 | 3300005331 | Ga0070670_100000139 | Ga0070670_10000013938 | 163 |
| 78 | 3300005331 | Ga0070670_100738190 | Ga0070670_1007381902 | 163 |
| 79 | 3300005335 | Ga0070666_10028627 | Ga0070666_100286272 | 163 |
| 80 | 3300005336 | Ga0070680_100139067 | Ga0070680_1001390672 | 163 |
| 81 | 3300005338 | Ga0068868_100000052 | Ga0068868_10000005237 | 163 |
| 82 | 3300005339 | Ga0070660_100368193 | Ga0070660_1003681932 | 163 |
| 83 | 3300005344 | Ga0070661_100010529 | Ga0070661_1000105292 | 163 |
| 84 | 3300005345 | Ga0070692_10065839 | Ga0070692_100658391 | 163 |
| 85 | 3300005347 | Ga0070668_100003423 | Ga0070668_1000034232 | 163 |
| 86 | 3300005354 | Ga0070675_100000223 | Ga0070675_10000022324 | 163 |
| 87 | 3300005355 | Ga0070671_100000380 | Ga0070671_10000038033 | 163 |
| 88 | 3300005356 | Ga0070674_100007268 | Ga0070674_1000072685 | 163 |
| 89 | 3300005364 | Ga0070673_100001137 | Ga0070673_10000113713 | 163 |
| 90 | 3300005367 | Ga0070667_100000105 | Ga0070667_100000105120 | 163 |
| 91 | 3300005367 | Ga0070667_100026829 | Ga0070667_1000268292 | 163 |
| 92 | 3300005439 | Ga0070711_100039523 | Ga0070711_1000395234 | 163 |
| 93 | 3300005456 | Ga0070678_100003044 | Ga0070678_10000304411 | 163 |
| 94 | 3300005457 | Ga0070662_100246857 | Ga0070662_1002468572 | 163 |
| 95 | 3300005459 | Ga0068867_100004818 | Ga0068867_10000481811 | 163 |
| 96 | 3300005535 | Ga0070684_100124384 | Ga0070684_1001243844 | 163 |
| 97 | 3300005539 | Ga0068853_100527943 | Ga0068853_1005279431 | 163 |
| 98 | 3300005539 | Ga0068853_100539389 | Ga0068853_1005393892 | 163 |
| 99 | 3300005543 | Ga0070672_100000161 | Ga0070672_10000016138 | 163 |
| 100 | 3300005547 | Ga0070693_101078336 | Ga0070693_1010783361 | 163 |
| 101 | 3300005548 | Ga0070665_100001009 | Ga0070665_10000100928 | 163 |
| 102 | 3300005548 | Ga0070665_100278868 | Ga0070665_1002788682 | 163 |
| 103 | 3300005563 | Ga0068855_100064289 | Ga0068855_1000642893 | 163 |
| 104 | 3300005563 | Ga0068855_100171068 | Ga0068855_1001710681 | 163 |
| 105 | 3300005563 | Ga0068855_100502178 | Ga0068855_1005021782 | 163 |
| 106 | 3300005564 | Ga0070664_100006565 | Ga0070664_1000065654 | 163 |
| 107 | 3300005578 | Ga0068854_100001281 | Ga0068854_10000128112 | 163 |
| 108 | 3300005578 | Ga0068854_100022205 | Ga0068854_1000222053 | 163 |
| 109 | 3300005578 | Ga0068854_100749204 | Ga0068854_1007492041 | 163 |
| 110 | 3300005614 | Ga0068856_100096375 | Ga0068856_1000963752 | 163 |
| 111 | 3300005616 | Ga0068852_100000154 | Ga0068852_10000015439 | 163 |
| 112 | 3300005617 | Ga0068859_100033438 | Ga0068859_1000334382 | 163 |
| 113 | 3300005617 | Ga0068859_101483935 | Ga0068859_1014839352 | 163 |
| 114 | 3300005618 | Ga0068864_100000164 | Ga0068864_10000016462 | 163 |
| 115 | 3300005618 | Ga0068864_100000538 | Ga0068864_1000005389 | 163 |
| 116 | 3300005618 | Ga0068864_100381529 | Ga0068864_1003815291 | 163 |
| 117 | 3300005718 | Ga0068866_10012603 | Ga0068866_100126035 | 163 |
| 118 | 3300005834 | Ga0068851_10000269 | Ga0068851_1000026914 | 163 |
| 119 | 3300005841 | Ga0068863_100000387 | Ga0068863_10000038718 | 163 |
| 120 | 3300005841 | Ga0068863_100090163 | Ga0068863_1000901632 | 163 |
| 121 | 3300005842 | Ga0068858_100002807 | Ga0068858_1000028076 | 163 |
| 122 | 3300005842 | Ga0068858_101102323 | Ga0068858_1011023232 | 163 |
| 123 | 3300005843 | Ga0068860_100000077 | Ga0068860_10000007719 | 163 |
| 124 | 3300005844 | Ga0068862_100000363 | Ga0068862_10000036323 | 163 |
| 125 | 3300005937 | Ga0081455_10061983 | Ga0081455_100619834 | 163 |
| 126 | 3300006173 | Ga0070716_100121999 | Ga0070716_1001219992 | 163 |
| 127 | 3300006237 | Ga0097621_100001278 | Ga0097621_10000127814 | 163 |
| 128 | 3300006358 | Ga0068871_100000092 | Ga0068871_10000009213 | 163 |
| 129 | 3300006881 | Ga0068865_100010710 | Ga0068865_1000107105 | 163 |
| 130 | 3300006881 | Ga0068865_100111220 | Ga0068865_1001112203 | 163 |
| 131 | 3300006931 | Ga0097620_100033438 | Ga0097620_1000334382 | 163 |
| 132 | 3300006931 | Ga0097620_101484146 | Ga0097620_1014841462 | 163 |
| 133 | 3300007265 | Ga0099794_10010470 | Ga0099794_100104701 | 163 |
| 134 | 3300007265 | Ga0099794_10115340 | Ga0099794_101153403 | 163 |
| 135 | 3300007788 | Ga0099795_10000820 | Ga0099795_100008202 | 163 |
| 136 | 3300009093 | Ga0105240_10071075 | Ga0105240_100710753 | 163 |
| 137 | 3300009093 | Ga0105240_10291915 | Ga0105240_102919153 | 163 |
| 138 | 3300009093 | Ga0105240_10473514 | Ga0105240_104735142 | 163 |
| 139 | 3300009098 | Ga0105245_10896147 | Ga0105245_108961472 | 163 |
| 140 | 3300009176 | Ga0105242_10041289 | Ga0105242_100412892 | 163 |
| 141 | 3300009177 | Ga0105248_10008437 | Ga0105248_100084375 | 163 |
| 142 | 3300009177 | Ga0105248_10034079 | Ga0105248_100340794 | 163 |
| 143 | 3300009545 | Ga0105237_10071133 | Ga0105237_100711332 | 163 |
| 144 | 3300009553 | Ga0105249_10019020 | Ga0105249_100190207 | 163 |
| 145 | 3300010159 | Ga0099796_10007560 | Ga0099796_100075604 | 163 |
| 146 | 3300010375 | Ga0105239_10502925 | Ga0105239_105029252 | 163 |
| 147 | 3300010375 | Ga0105239_10614550 | Ga0105239_106145501 | 163 |
| 148 | 3300013104 | Ga0157370_10084896 | Ga0157370_100848962 | 163 |
| 149 | 3300013104 | Ga0157370_10094741 | Ga0157370_100947412 | 163 |
| 150 | 3300013296 | Ga0157374_10000136 | Ga0157374_1000013637 | 163 |
| 151 | 3300013297 | Ga0157378_10002978 | Ga0157378_1000297810 | 163 |
| 152 | 3300013306 | Ga0163162_10000403 | Ga0163162_1000040327 | 163 |
| 153 | 3300013307 | Ga0157372_10031221 | Ga0157372_100312216 | 163 |
| 154 | 3300013308 | Ga0157375_10004199 | Ga0157375_100041993 | 163 |
| 155 | 3300013308 | Ga0157375_11049992 | Ga0157375_110499922 | 163 |
| 156 | 3300014325 | Ga0163163_10417366 | Ga0163163_104173663 | 163 |
| 157 | 3300014326 | Ga0157380_10316185 | Ga0157380_103161852 | 163 |
| 158 | 3300014745 | Ga0157377_10004705 | Ga0157377_100047055 | 163 |
| 159 | 3300014968 | Ga0157379_10009636 | Ga0157379_100096361 | 163 |
| 160 | 3300014969 | Ga0157376_10000389 | Ga0157376_1000038930 | 163 |
| 161 | 3300017792 | Ga0163161_10042157 | Ga0163161_100421572 | 163 |
| 162 | 3300020077 | Ga0206351_10784943 | Ga0206351_107849433 | 163 |
| 163 | 3300020610 | Ga0154015_1406881 | Ga0154015_140688111 | 163 |
| 164 | 3300025228 | Ga0209672_100299 | Ga0209672_10029922 | 163 |
| 165 | 3300025228 | Ga0209672_100322 | Ga0209672_10032222 | 163 |
| 166 | 3300025229 | Ga0209147_100005 | Ga0209147_100005600 | 163 |
| 167 | 3300025242 | Ga0209258_100007 | Ga0209258_100007600 | 163 |
| 168 | 3300025272 | Ga0209455_1000011 | Ga0209455_1000011525 | 163 |
| 169 | 3300025321 | Ga0207656_10001533 | Ga0207656_100015337 | 163 |
| 170 | 3300025901 | Ga0207688_10410493 | Ga0207688_104104932 | 163 |
| 171 | 3300025909 | Ga0207705_10032135 | Ga0207705_100321355 | 163 |
| 172 | 3300025913 | Ga0207695_10022865 | Ga0207695_100228655 | 163 |
| 173 | 3300025913 | Ga0207695_10185776 | Ga0207695_101857762 | 163 |
| 174 | 3300025913 | Ga0207695_10262509 | Ga0207695_102625093 | 163 |
| 175 | 3300025914 | Ga0207671_10063446 | Ga0207671_100634464 | 163 |
| 176 | 3300025916 | Ga0207663_10019401 | Ga0207663_100194012 | 163 |
| 177 | 3300025917 | Ga0207660_10049229 | Ga0207660_100492292 | 163 |
| 178 | 3300025919 | Ga0207657_10450486 | Ga0207657_104504862 | 163 |
| 179 | 3300025920 | Ga0207649_10040643 | Ga0207649_100406432 | 163 |
| 180 | 3300025923 | Ga0207681_10343936 | Ga0207681_103439363 | 163 |
| 181 | 3300025924 | Ga0207694_10004964 | Ga0207694_1000496411 | 163 |
| 182 | 3300025925 | Ga0207650_10000033 | Ga0207650_10000033112 | 163 |
| 183 | 3300025925 | Ga0207650_10003805 | Ga0207650_100038059 | 163 |
| 184 | 3300025926 | Ga0207659_10000396 | Ga0207659_1000039623 | 163 |
| 185 | 3300025927 | Ga0207687_10598882 | Ga0207687_105988822 | 163 |
| 186 | 3300025928 | Ga0207700_10521402 | Ga0207700_105214022 | 163 |
| 187 | 3300025931 | Ga0207644_10000475 | Ga0207644_100004759 | 163 |
| 188 | 3300025937 | Ga0207669_10107713 | Ga0207669_101077132 | 163 |
| 189 | 3300025938 | Ga0207704_10004543 | Ga0207704_100045435 | 163 |
| 190 | 3300025938 | Ga0207704_10143929 | Ga0207704_101439292 | 163 |
| 191 | 3300025940 | Ga0207691_10000043 | Ga0207691_1000004337 | 163 |
| 192 | 3300025941 | Ga0207711_10008351 | Ga0207711_100083515 | 163 |
| 193 | 3300025941 | Ga0207711_10039017 | Ga0207711_100390174 | 163 |
| 194 | 3300025944 | Ga0207661_10004675 | Ga0207661_100046757 | 163 |
| 195 | 3300025945 | Ga0207679_10003052 | Ga0207679_100030529 | 163 |
| 196 | 3300025949 | Ga0207667_10076541 | Ga0207667_100765412 | 163 |
| 197 | 3300025949 | Ga0207667_10156781 | Ga0207667_101567812 | 163 |
| 198 | 3300025960 | Ga0207651_10002190 | Ga0207651_100021904 | 163 |
| 199 | 3300025961 | Ga0207712_10011252 | Ga0207712_100112522 | 163 |
| 200 | 3300025972 | Ga0207668_10000594 | Ga0207668_1000059417 | 163 |
| 201 | 3300025981 | Ga0207640_10001075 | Ga0207640_100010754 | 163 |
| 202 | 3300025981 | Ga0207640_10005006 | Ga0207640_100050063 | 163 |
| 203 | 3300025981 | Ga0207640_10839432 | Ga0207640_108394321 | 163 |
| 204 | 3300025986 | Ga0207658_10000848 | Ga0207658_1000084835 | 163 |
| 205 | 3300025986 | Ga0207658_10010819 | Ga0207658_100108193 | 163 |
| 206 | 3300026023 | Ga0207677_10005289 | Ga0207677_100052897 | 163 |
| 207 | 3300026035 | Ga0207703_10002013 | Ga0207703_1000201320 | 163 |
| 208 | 3300026067 | Ga0207678_10200992 | Ga0207678_102009923 | 163 |
| 209 | 3300026078 | Ga0207702_10563506 | Ga0207702_105635062 | 163 |
| 210 | 3300026088 | Ga0207641_10004186 | Ga0207641_100041865 | 163 |
| 211 | 3300026088 | Ga0207641_10134833 | Ga0207641_101348334 | 163 |
| 212 | 3300026089 | Ga0207648_10009174 | Ga0207648_100091742 | 163 |
| 213 | 3300026095 | Ga0207676_10000175 | Ga0207676_1000017512 | 163 |
| 214 | 3300026095 | Ga0207676_10000336 | Ga0207676_1000033631 | 163 |
| 215 | 3300026121 | Ga0207683_10000091 | Ga0207683_1000009130 | 163 |
| 216 | 3300026142 | Ga0207698_10000264 | Ga0207698_1000026429 | 163 |
| 217 | 3300027111 | Ga0209281_1024538 | Ga0209281_10245381 | 163 |
| 218 | 3300027907 | Ga0207428_10560057 | Ga0207428_105600571 | 163 |
| 219 | 3300028379 | Ga0268266_10001718 | Ga0268266_1000171819 | 163 |
| 220 | 3300028379 | Ga0268266_10239688 | Ga0268266_102396882 | 163 |
| 221 | 3300028379 | Ga0268266_10374663 | Ga0268266_103746632 | 163 |
| 222 | 3300028380 | Ga0268265_10058443 | Ga0268265_100584435 | 163 |
| 223 | 3300028380 | Ga0268265_10576099 | Ga0268265_105760992 | 163 |
| 224 | 3300028381 | Ga0268264_10000032 | Ga0268264_10000032397 | 163 |
| 225 | 3300028786 | Ga0307517_10104343 | Ga0307517_101043433 | 163 |
| 226 | 3300030878 | Ga0265770_1000710 | Ga0265770_10007102 | 163 |
| 227 | 3300031090 | Ga0265760_10000421 | Ga0265760_100004217 | 163 |
| 228 | 3300031548 | Ga0307408_100025629 | Ga0307408_1000256292 | 163 |
| 229 | 3300031730 | Ga0307516_10004733 | Ga0307516_1000473316 | 163 |
| 230 | 3300031731 | Ga0307405_10011989 | Ga0307405_100119893 | 163 |
| 231 | 3300031824 | Ga0307413_10062108 | Ga0307413_100621082 | 163 |
| 232 | 3300031852 | Ga0307410_10044472 | Ga0307410_100444723 | 163 |
| 233 | 3300031901 | Ga0307406_10059462 | Ga0307406_100594623 | 163 |
| 234 | 3300031903 | Ga0307407_10014584 | Ga0307407_100145842 | 163 |
| 235 | 3300031911 | Ga0307412_10007868 | Ga0307412_100078683 | 163 |
| 236 | 3300031995 | Ga0307409_100236932 | Ga0307409_1002369322 | 163 |
| 237 | 3300031995 | Ga0307409_100524648 | Ga0307409_1005246482 | 163 |
| 238 | 3300032002 | Ga0307416_100036200 | Ga0307416_1000362005 | 163 |
| 239 | 3300032004 | Ga0307414_10025060 | Ga0307414_100250603 | 163 |
| 240 | 3300032005 | Ga0307411_10017352 | Ga0307411_100173522 | 163 |
| 241 | 3300032126 | Ga0307415_100057069 | Ga0307415_1000570693 | 163 |
| 242 | 3300035171 | Ga0373946_0468951 | Ga0373946_0468951_138_629 | 163 |
| 243 | 3300036401 | Ga0373937_0453679 | Ga0373937_0453679_183_674 | 163 |
| 244 | 3300036459 | Ga0372808_023038 | Ga0372808_023038_96_587 | 163 |
| 245 | 3300037471 | Ga0395905_0009910 | Ga0395905_0009910_1518_2021 | 163 |
| 246 | 3300037471 | Ga0395905_0992356 | Ga0395905_0992356_194_685 | 163 |
| 247 | 3300039437 | Ga0436365_0136013 | Ga0436365_0136013_36_527 | 163 |
| 248 | 3300039437 | Ga0436365_0501094 | Ga0436365_0501094_15_518 | 163 |
| 249 | 3300039450 | Ga0436363_0500612 | Ga0436363_0500612_90_581 | 163 |
| 250 | 3300042004 | Ga0439445_0082914 | Ga0439445_0082914_45_539 | 163 |
| 251 | 3300042115 | Ga0450911_000286 | Ga0450911_000286_3650_4144 | 163 |
| 252 | 3300044658 | Ga0466972_0025791 | Ga0466972_0025791_2045_2539 | 163 |
| 253 | 3300044842 | Ga0466957_0314170 | Ga0466957_0314170_101_592 | 163 |
| 254 | 3300044901 | Ga0466960_0021591 | Ga0466960_0021591_1980_2474 | 163 |
| 255 | 3300045051 | Ga0451576_0000114 | Ga0451576_0000114_124058_124549 | 163 |
| 256 | 3300046543 | Ga0495645_0304068 | Ga0495645_0304068_501_992 | 163 |
| 257 | 3300046692 | Ga0495671_0053157 | Ga0495671_0053157_128_619 | 163 |
| 258 | 3300047322 | Ga0495680_0644756 | Ga0495680_0644756_146_637 | 163 |
| 259 | 3300048088 | Ga0495602_0544415 | Ga0495602_0544415_71_562 | 163 |
| 260 | 3300048904 | Ga0496101_0113277 | Ga0496101_0113277_1194_1685 | 163 |
| 261 | 3300048905 | Ga0496102_0021580 | Ga0496102_0021580_607_1098 | 163 |
| 262 | 3300048905 | Ga0496102_0641009 | Ga0496102_0641009_206_697 | 163 |
| 263 | 3300048907 | Ga0496104_0245091 | Ga0496104_0245091_74_565 | 163 |
| 264 | 3300048908 | Ga0496105_0005448 | Ga0496105_0005448_5138_5629 | 163 |
| 265 | 3300048908 | Ga0496105_0343985 | Ga0496105_0343985_215_706 | 163 |
| 266 | 3300048910 | Ga0496107_0115639 | Ga0496107_0115639_1284_1775 | 163 |
| 267 | 3300048910 | Ga0496107_0394214 | Ga0496107_0394214_203_694 | 163 |
| 268 | 3300048911 | Ga0496108_0008012 | Ga0496108_0008012_7586_8077 | 163 |
| 269 | 3300048912 | Ga0496109_0000800 | Ga0496109_0000800_18150_18641 | 163 |
| 270 | 3300048913 | Ga0496110_0000225 | Ga0496110_0000225_8642_9133 | 163 |
| 271 | 3300048913 | Ga0496110_0142863 | Ga0496110_0142863_808_1308 | 163 |
| 272 | 3300048914 | Ga0496111_0069132 | Ga0496111_0069132_1053_1544 | 163 |
| 273 | 3300048917 | Ga0496114_0055124 | Ga0496114_0055124_1618_2109 | 163 |
| 274 | 3300048917 | Ga0496114_0134275 | Ga0496114_0134275_1254_1745 | 163 |
| 275 | 3300048918 | Ga0496115_0005522 | Ga0496115_0005522_5696_6187 | 163 |
| 276 | 3300048922 | Ga0496119_0015978 | Ga0496119_0015978_5033_5524 | 163 |
| 277 | 3300048925 | Ga0496122_0095482 | Ga0496122_0095482_1057_1611 | 163 |
| 278 | 3300048926 | Ga0496123_0022068 | Ga0496123_0022068_904_1416 | 163 |
| 279 | 3300048926 | Ga0496123_0040953 | Ga0496123_0040953_1876_2388 | 163 |
| 280 | 3300048926 | Ga0496123_0217121 | Ga0496123_0217121_411_920 | 163 |
| 281 | 3300048928 | Ga0496125_0000233 | Ga0496125_0000233_17778_18290 | 163 |
| 282 | 3300049581 | Ga0501047_0031531 | Ga0501047_0031531_893_1384 | 163 |
| 283 | 3300049822 | Ga0501035_0740138 | Ga0501035_0740138_196_687 | 163 |
| 284 | 3300053084 | Ga0495595_0552955 | Ga0495595_0552955_18_509 | 163 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5wid-assembly2.cif.gz_B | structure of a flavodoxin from the domain archaea | 0.8892 | 3 | 158 |
| 4laf-assembly1.cif.gz_C | crystal structure of pnpb complex with fmn | 0.869 | 1 | 162 |
| 5wid-assembly2.cif.gz_B | structure of a flavodoxin from the domain archaea | 0.866 | 3 | 158 |
| 2ohh-assembly1.cif.gz_A | crystal structure of coenzyme f420h2 oxidase (fpra), a diiron flavoprotein, active oxidized state | 0.859 | 2 | 156 |
| 4laf-assembly1.cif.gz_C | crystal structure of pnpb complex with fmn | 0.859 | 1 | 162 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O33313_1_149_3.40.50.360 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9338 | 1 | 158 | 3.40.50.360 |
| af_O33313_1_149_3.40.50.360 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9218 | 1 | 158 | 3.40.50.360 |
| 2fz5A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8565 | 4 | 156 | 3.40.50.360 |
| 1e5dB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8515 | 4 | 157 | 3.40.50.360 |
| af_Q58142_244_391_3.40.50.360 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8511 | 3 | 156 | 3.40.50.360 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A562ZRT7-F1-model_v4 | Flavodoxin family protein | 0.9965 | 2 | 163 |
GO:0010181
GO:0016491 |
| AF-A0A4R7FNV8-F1-model_v4 | NADPH-dependent FMN reductase | 0.9963 | 2 | 163 |
GO:0016491
|
| AF-A0A498RZJ2-F1-model_v4 | deleted | 0.9962 | 1 | 163 |
|
| AF-A0A2T4IFL4-F1-model_v4 | Flavodoxin | 0.9953 | 20 | 163 |
GO:0016491
|
| AF-A0A0J0XP36-F1-model_v4 | Flavo protein | 0.9944 | 2 | 163 |
GO:0010181
GO:0016491 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar