F386135

General Info

Members Datasets Scaffolds Average Seq Length
284 194 568 126

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10000534|Ga0075433_100005346
Length 139
Sequence VRLPRLTKLELQIMEALWSGGALSVREIQEAFPERERPAYTTVQTMVYRLEGKKAIRRVKKIGNAHIFEAVVSRTSAHRRLIDELLSLFGGRSQPVVMHLIESGNLTLQDVKEAEQLLIKLKSGTSSDGSARSRKVKPE

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
78 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
79 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
118 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
119 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
120 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
130 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
131 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
132 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
133 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
134 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
135 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
136 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
137 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
138 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
139 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
140 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
141 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
142 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
145 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
146 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
157 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
158 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
159 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
160 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
161 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
162 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
163 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
164 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
165 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
166 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
167 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
168 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
169 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
170 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
171 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
174 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
175 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
176 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
177 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
181 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
188 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
189 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
190 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
191 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
192 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
193 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
194 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.76
Nodule 0
Rhizoplane 0.35
Rhizosphere 96.13
Stem 0
Stem Tuber 0
Unclassified 34.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10000534 3300006852 Bacteria 24984
2 Ga0065712_10153987 3300005290 Unclassified 1348
3 Ga0065715_10032438 3300005293 Bacteria 1564
4 Ga0065715_11090889 3300005293 Bacteria 522
5 Ga0065707_10014618 3300005295 Bacteria 3616
6 Ga0065707_10553188 3300005295 Unclassified 719
7 Ga0070683_100021832 3300005329 Bacteria 5715
8 Ga0070690_100211016 3300005330 Bacteria 1356
9 Ga0070690_101019282 3300005330 Bacteria 653
10 Ga0070670_101052634 3300005331 Bacteria 741
11 Ga0068869_100165211 3300005334 Bacteria 1726
12 Ga0070666_10030911 3300005335 Bacteria 3531
13 Ga0070666_10113965 3300005335 Unclassified 1871
14 Ga0070680_100714630 3300005336 Unclassified 862
15 Ga0070680_100724613 3300005336 Bacteria 856
16 Ga0070689_100994255 3300005340 Bacteria 746
17 Ga0070691_10157774 3300005341 Bacteria 1168
18 Ga0070687_100050440 3300005343 Unclassified 2149
19 Ga0070687_100752493 3300005343 Bacteria 686
20 Ga0070692_10545265 3300005345 Bacteria 759
21 Ga0070668_101084422 3300005347 Unclassified 722
22 Ga0070669_100102831 3300005353 Unclassified 2158
23 Ga0070675_100051801 3300005354 Bacteria 3374
24 Ga0070675_100236385 3300005354 Bacteria 1595
25 Ga0070671_100147548 3300005355 Bacteria 1986
26 Ga0070671_100617610 3300005355 Bacteria 937
27 Ga0070674_100925291 3300005356 Bacteria 761
28 Ga0070674_100960427 3300005356 Unclassified 748
29 Ga0070674_101449735 3300005356 Unclassified 616
30 Ga0070673_100316330 3300005364 Unclassified 1378
31 Ga0070688_100040044 3300005365 Bacteria 2870
32 Ga0070688_100530462 3300005365 Bacteria 892
33 Ga0070667_100290043 3300005367 Unclassified 1471
34 Ga0070667_100895493 3300005367 Unclassified 826
35 Ga0070709_10249936 3300005434 Unclassified 1277
36 Ga0070714_100772443 3300005435 Unclassified 929
37 Ga0070713_100074763 3300005436 Bacteria 2872
38 Ga0070713_100569101 3300005436 Unclassified 1074
39 Ga0070701_10176521 3300005438 Bacteria 1248
40 Ga0070700_100350812 3300005441 Bacteria 1094
41 Ga0070700_100518507 3300005441 Unclassified 920
42 Ga0070700_100585129 3300005441 Unclassified 872
43 Ga0070700_101004437 3300005441 Bacteria 686
44 Ga0070708_101757987 3300005445 Unclassified 576
45 Ga0070663_100398514 3300005455 Unclassified 1124
46 Ga0070678_100324572 3300005456 Bacteria 1315
47 Ga0070662_101748764 3300005457 Unclassified 537
48 Ga0070681_10311221 3300005458 Bacteria 1484
49 Ga0070681_11211835 3300005458 Bacteria 677
50 Ga0070707_100347515 3300005468 Bacteria 1441
51 Ga0070698_100436355 3300005471 Bacteria 1245
52 Ga0070698_100812333 3300005471 Unclassified 879
53 Ga0070699_100614872 3300005518 Bacteria 991
54 Ga0070684_101618188 3300005535 Unclassified 611
55 Ga0070672_100072985 3300005543 Bacteria 2734
56 Ga0070672_100080889 3300005543 Unclassified 2604
57 Ga0070672_100373369 3300005543 Unclassified 1219
58 Ga0070686_100294332 3300005544 Bacteria 1202
59 Ga0070696_100451843 3300005546 Bacteria 1014
60 Ga0070665_101153031 3300005548 Bacteria 786
61 Ga0070664_100076729 3300005564 Unclassified 2872
62 Ga0068856_101269474 3300005614 Unclassified 752
63 Ga0068859_100632187 3300005617 Unclassified 1163
64 Ga0068859_100731321 3300005617 Bacteria 1079
65 Ga0068866_10473836 3300005718 Bacteria 823
66 Ga0068861_101437654 3300005719 Bacteria 675
67 Ga0068870_10474444 3300005840 Unclassified 829
68 Ga0068863_100552454 3300005841 Bacteria 1137
69 Ga0068858_100289845 3300005842 Bacteria 1560
70 Ga0068860_101195041 3300005843 Unclassified 781
71 Ga0068862_100378268 3300005844 Bacteria 1320
72 Ga0068862_100494235 3300005844 Unclassified 1160
73 Ga0070717_10058644 3300006028 Bacteria 3183
74 Ga0075366_10356029 3300006195 Bacteria 899
75 Ga0097621_100472845 3300006237 Unclassified 1132
76 Ga0068871_100291868 3300006358 Unclassified 1429
77 Ga0075428_100065331 3300006844 Bacteria 3984
78 Ga0075428_100505342 3300006844 Unclassified 1293
79 Ga0075430_100080876 3300006846 Bacteria 2722
80 Ga0075430_100085251 3300006846 Unclassified 2645
81 Ga0075430_100358764 3300006846 Unclassified 1204
82 Ga0075430_101516131 3300006846 Bacteria 551
83 Ga0075431_100324132 3300006847 Bacteria 1553
84 Ga0075431_100366369 3300006847 Unclassified 1447
85 Ga0075431_100919648 3300006847 Bacteria 844
86 Ga0075433_10001803 3300006852 Bacteria 16067
87 Ga0075433_10331778 3300006852 Bacteria 1345
88 Ga0075434_100004391 3300006871 Bacteria 12704
89 Ga0075434_100011123 3300006871 Bacteria 8467
90 Ga0075429_100024892 3300006880 Bacteria 5195
91 Ga0075429_100029502 3300006880 Bacteria 4764
92 Ga0068865_100540546 3300006881 Bacteria 977
93 Ga0068865_100611529 3300006881 Bacteria 922
94 Ga0097620_100632140 3300006931 Unclassified 1163
95 Ga0097620_100731308 3300006931 Bacteria 1079
96 Ga0075435_101084094 3300007076 Unclassified 700
97 Ga0111539_10000150 3300009094 Bacteria 79163
98 Ga0111539_10879038 3300009094 Bacteria 1042
99 Ga0105245_10039861 3300009098 Bacteria 4182
100 Ga0105245_10633626 3300009098 Bacteria 1098
101 Ga0105245_11889491 3300009098 Unclassified 650
102 Ga0114129_10014524 3300009147 Bacteria 11223
103 Ga0114129_10653077 3300009147 Bacteria 1357
104 Ga0114129_11254313 3300009147 Bacteria 921
105 Ga0105243_10594124 3300009148 Bacteria 1065
106 Ga0105242_10084392 3300009176 Unclassified 2661
107 Ga0105242_10979580 3300009176 Bacteria 852
108 Ga0105248_10109344 3300009177 Unclassified 3117
109 Ga0105248_10853504 3300009177 Bacteria 1028
110 Ga0105248_12897767 3300009177 Bacteria 547
111 Ga0105238_11221785 3300009551 Unclassified 776
112 Ga0105249_10154164 3300009553 Bacteria 2214
113 Ga0105249_13054278 3300009553 Unclassified 538
114 Ga0157374_12954089 3300013296 Bacteria 502
115 Ga0157375_10070491 3300013308 Bacteria 3505
116 Ga0157380_10840309 3300014326 Bacteria 939
117 Ga0157377_10151187 3300014745 Bacteria 1435
118 Ga0157379_11656597 3300014968 Unclassified 626
119 Ga0157376_10261979 3300014969 Bacteria 1620
120 Ga0213875_10105725 3300021388 Unclassified 1314
121 Ga0213875_10395519 3300021388 Bacteria 659
122 Ga0209233_1042839 3300025261 Bacteria 969
123 Ga0207682_10084724 3300025893 Bacteria 1364
124 Ga0207642_10607521 3300025899 Bacteria 681
125 Ga0207680_10353815 3300025903 Unclassified 1032
126 Ga0207699_10384299 3300025906 Unclassified 997
127 Ga0207707_10854195 3300025912 Bacteria 755
128 Ga0207660_10110957 3300025917 Bacteria 2064
129 Ga0207649_10321900 3300025920 Unclassified 1136
130 Ga0207681_10087635 3300025923 Unclassified 2215
131 Ga0207650_10951153 3300025925 Bacteria 730
132 Ga0207659_10015685 3300025926 Bacteria 4917
133 Ga0207659_10481752 3300025926 Bacteria 1048
134 Ga0207687_10335401 3300025927 Bacteria 1228
135 Ga0207687_10668711 3300025927 Bacteria 880
136 Ga0207687_11364677 3300025927 Bacteria 609
137 Ga0207700_10501685 3300025928 Unclassified 1074
138 Ga0207700_10681631 3300025928 Unclassified 917
139 Ga0207644_11597227 3300025931 Bacteria 547
140 Ga0207706_10166859 3300025933 Bacteria 1935
141 Ga0207706_10351051 3300025933 Unclassified 1282
142 Ga0207686_10080189 3300025934 Bacteria 2127
143 Ga0207709_10473510 3300025935 Bacteria 972
144 Ga0207670_10998928 3300025936 Bacteria 704
145 Ga0207669_10423152 3300025937 Bacteria 1049
146 Ga0207669_10976666 3300025937 Unclassified 711
147 Ga0207704_10168654 3300025938 Bacteria 1567
148 Ga0207704_10284616 3300025938 Bacteria 1258
149 Ga0207691_10012031 3300025940 Bacteria 8300
150 Ga0207691_10120738 3300025940 Unclassified 2323
151 Ga0207691_10150819 3300025940 Bacteria 2044
152 Ga0207711_10122362 3300025941 Bacteria 2324
153 Ga0207711_10124794 3300025941 Bacteria 2302
154 Ga0207711_10525858 3300025941 Bacteria 1103
155 Ga0207689_10169408 3300025942 Bacteria 1800
156 Ga0207661_10028248 3300025944 Unclassified 4294
157 Ga0207679_10055190 3300025945 Unclassified 2927
158 Ga0207651_10004119 3300025960 Bacteria 7261
159 Ga0207651_10265465 3300025960 Unclassified 1411
160 Ga0207712_11556756 3300025961 Unclassified 592
161 Ga0207658_10459889 3300025986 Bacteria 1128
162 Ga0207678_10488015 3300026067 Unclassified 1073
163 Ga0207708_10270093 3300026075 Bacteria 1375
164 Ga0207708_10512969 3300026075 Bacteria 1006
165 Ga0207641_10290489 3300026088 Bacteria 1541
166 Ga0207641_11100502 3300026088 Bacteria 793
167 Ga0207648_10458459 3300026089 Bacteria 1162
168 Ga0207683_10131614 3300026121 Bacteria 2250
169 Ga0209971_1154681 3300027682 Bacteria 566
170 Ga0209966_1021325 3300027695 Unclassified 1260
171 Ga0209974_10382350 3300027876 Bacteria 550
172 Ga0207428_10009025 3300027907 Bacteria 8976
173 Ga0207428_10011053 3300027907 Bacteria 8021
174 Ga0268265_10012569 3300028380 Bacteria 5740
175 Ga0268264_11682804 3300028381 Bacteria 645
176 Ga0265338_10140647 3300028800 Unclassified 1891
177 Ga0265338_10690187 3300028800 Bacteria 705
178 Ga0265332_10043046 3300031238 Bacteria 1951
179 Ga0265325_10250201 3300031241 Unclassified 803
180 Ga0265340_10013279 3300031247 Bacteria 4332
181 Ga0307408_100729550 3300031548 Bacteria 893
182 Ga0265314_10238123 3300031711 Bacteria 1052
183 Ga0307405_10746230 3300031731 Unclassified 815
184 Ga0307409_101580027 3300031995 Bacteria 684
185 Ga0307411_10332755 3300032005 Unclassified 1231
186 Ga0307415_102191893 3300032126 Bacteria 541
187 Ga0436364_0096684 3300037853 Bacteria 659
188 Ga0436364_0391371 3300037853 Unclassified 669
189 Ga0436364_0846558 3300037853 Bacteria 2765
190 Ga0395901_1372575 3300038443 Unclassified 666
191 Ga0451802_0271317 3300041460 Unclassified 760
192 Ga0439454_086314 3300042011 Bacteria 575
193 Ga0450896_070624 3300042133 Unclassified 578
194 Ga0439435_0047313 3300042436 Bacteria 1221
195 Ga0439464_0179463 3300042439 Unclassified 670
196 Ga0466963_0448793 3300044694 Bacteria 910
197 Ga0451576_0557762 3300045051 Unclassified 1204
198 Ga0451576_2135412 3300045051 Unclassified 576
199 Ga0495650_0123089 3300046471 Unclassified 953
200 Ga0495594_0025327 3300046499 Unclassified 3189
201 Ga0495594_0428459 3300046499 Unclassified 752
202 Ga0495594_0717090 3300046499 Unclassified 565
203 Ga0495621_0284190 3300046539 Bacteria 682
204 Ga0495656_0001415 3300046615 Bacteria 7843
205 Ga0495656_0688571 3300046615 Unclassified 550
206 Ga0495668_0654266 3300046616 Unclassified 581
207 Ga0495599_0289409 3300046678 Bacteria 991
208 Ga0495658_0698331 3300046683 Bacteria 650
209 Ga0495684_0517959 3300047471 Unclassified 817
210 Ga0501290_008952 3300049513 Bacteria 1270
211 Ga0501298_009336 3300049521 Bacteria 1666
212 Ga0501032_0401674 3300049569 Bacteria 880
213 Ga0501036_0011720 3300049572 Bacteria 7264
214 Ga0501037_0205144 3300049573 Bacteria 1392
215 Ga0501038_0113070 3300049574 Bacteria 2247
216 Ga0501039_0259016 3300049575 Bacteria 1367
217 Ga0501040_0004589 3300049576 Bacteria 8963
218 Ga0501041_0064709 3300049577 Bacteria 2239
219 Ga0501042_0072461 3300049578 Bacteria 2465
220 Ga0501046_0255292 3300049580 Bacteria 1289
221 Ga0501048_0115957 3300049582 Bacteria 1892
222 Ga0501067_0707647 3300049583 Bacteria 566
223 Ga0501068_0704152 3300049584 Unclassified 660
224 Ga0501071_0106698 3300049587 Unclassified 2068
225 Ga0501072_0067115 3300049588 Bacteria 2830
226 Ga0501072_1470779 3300049588 Unclassified 526
227 Ga0501075_0072556 3300049591 Bacteria 2602
228 Ga0501075_0101619 3300049591 Unclassified 2184
229 Ga0501075_0597500 3300049591 Unclassified 842
230 Ga0501076_0000473 3300049592 Bacteria 25423
231 Ga0501076_0807296 3300049592 Unclassified 774
232 Ga0501076_1487869 3300049592 Unclassified 556
233 Ga0501077_0126023 3300049593 Bacteria 1623
234 Ga0501202_064563 3300049652 Bacteria 834
235 Ga0501206_025580 3300049653 Bacteria 859
236 Ga0501217_300154 3300049661 Unclassified 530
237 Ga0501246_024584 3300049676 Unclassified 644
238 Ga0501249_002407 3300049679 Bacteria 3779
239 Ga0501253_166347 3300049683 Unclassified 565
240 Ga0501257_073494 3300049686 Bacteria 876
241 Ga0501261_043561 3300049690 Unclassified 715
242 Ga0501079_0313892 3300049741 Bacteria 1227
243 Ga0501079_0447901 3300049741 Bacteria 1014
244 Ga0501080_0213549 3300049742 Bacteria 1768
245 Ga0501081_0056025 3300049743 Bacteria 2723
246 Ga0501081_1216019 3300049743 Unclassified 571
247 Ga0501266_082694 3300049763 Unclassified 547
248 Ga0501267_031301 3300049764 Unclassified 628
249 Ga0501275_022717 3300049772 Bacteria 782
250 Ga0501283_033983 3300049779 Bacteria 865
251 Ga0501035_0406813 3300049822 Bacteria 1131
252 Ga0501044_0191485 3300049823 Unclassified 2008
253 Ga0501045_0042572 3300049824 Bacteria 3305
254 nmdc:mga0k408_154746_c1 3300050493 Bacteria 899
255 nmdc:mga0k408_239151_c1 3300050493 Bacteria 1084
256 nmdc:mga05p37_129001_c1 3300050507 Bacteria 3104
257 nmdc:mga05p37_413521_c1 3300050507 Unclassified 1572
258 nmdc:mga05p37_557639_c1 3300050507 Unclassified 1303
259 nmdc:mga05p37_823396_c1 3300050507 Bacteria 1012
260 nmdc:mga05p37_823471_c1 3300050507 Bacteria 1012
261 nmdc:mga09592_220909_c1 3300050508 Unclassified 1246
262 nmdc:mga09592_373882_c1 3300050508 Bacteria 1233
263 nmdc:mga09592_7421_c1 3300050508 Bacteria 8912
264 nmdc:mga0qj67_294145_c1 3300050509 Bacteria 1316
265 nmdc:mga0qj67_309782_c1 3300050509 Bacteria 1279
266 nmdc:mga0qj67_35467_c1 3300050509 Bacteria 3900
267 nmdc:mga06r32_121043_c1 3300050510 Unclassified 2582
268 nmdc:mga06r32_435312_c1 3300050510 Bacteria 1292
269 nmdc:mga06r32_655435_c1 3300050510 Bacteria 1018
270 nmdc:mga08y16_235_c1 3300050511 Bacteria 48485
271 nmdc:mga08y16_272005_c1 3300050511 Unclassified 1749
272 nmdc:mga08y16_39664_c1 3300050511 Bacteria 4940
273 nmdc:mga0n895_11163_c1 3300050512 Bacteria 7996
274 nmdc:mga0n895_8115_c1 3300050512 Bacteria 9069
275 nmdc:mga0rr50_1284800_c1 3300050513 Bacteria 621
276 nmdc:mga0a205_13567_c1 3300050515 Bacteria 7590
277 nmdc:mga0a205_636910_c1 3300050515 Bacteria 918
278 nmdc:mga0a205_815058_c1 3300050515 Bacteria 781
279 nmdc:mga0a205_906_c2 3300050515 Bacteria 21167
280 Ga0495619_0290948 3300053085 Bacteria 1132
281 Ga0500616_0012649 3300053153 Bacteria 4934
282 Ga0501084_0055739 3300054114 Bacteria 3307
283 Ga0501082_0000692 3300060353 Bacteria 29748
284 Ga0530510_0003092 3300061734 Bacteria 11430
285 Ga0075433_10000534
286 Ga0065712_10153987
287 Ga0065715_10032438
288 Ga0065715_11090889
289 Ga0065707_10014618
290 Ga0065707_10553188
291 Ga0070683_100021832
292 Ga0070690_100211016
293 Ga0070690_101019282
294 Ga0070670_101052634
295 Ga0068869_100165211
296 Ga0070666_10030911
297 Ga0070666_10113965
298 Ga0070680_100714630
299 Ga0070680_100724613
300 Ga0070689_100994255
301 Ga0070691_10157774
302 Ga0070687_100050440
303 Ga0070687_100752493
304 Ga0070692_10545265
305 Ga0070668_101084422
306 Ga0070669_100102831
307 Ga0070675_100051801
308 Ga0070675_100236385
309 Ga0070671_100147548
310 Ga0070671_100617610
311 Ga0070674_100925291
312 Ga0070674_100960427
313 Ga0070674_101449735
314 Ga0070673_100316330
315 Ga0070688_100040044
316 Ga0070688_100530462
317 Ga0070667_100290043
318 Ga0070667_100895493
319 Ga0070709_10249936
320 Ga0070714_100772443
321 Ga0070713_100074763
322 Ga0070713_100569101
323 Ga0070701_10176521
324 Ga0070700_100350812
325 Ga0070700_100518507
326 Ga0070700_100585129
327 Ga0070700_101004437
328 Ga0070708_101757987
329 Ga0070663_100398514
330 Ga0070678_100324572
331 Ga0070662_101748764
332 Ga0070681_10311221
333 Ga0070681_11211835
334 Ga0070707_100347515
335 Ga0070698_100436355
336 Ga0070698_100812333
337 Ga0070699_100614872
338 Ga0070684_101618188
339 Ga0070672_100072985
340 Ga0070672_100080889
341 Ga0070672_100373369
342 Ga0070686_100294332
343 Ga0070696_100451843
344 Ga0070665_101153031
345 Ga0070664_100076729
346 Ga0068856_101269474
347 Ga0068859_100632187
348 Ga0068859_100731321
349 Ga0068866_10473836
350 Ga0068861_101437654
351 Ga0068870_10474444
352 Ga0068863_100552454
353 Ga0068858_100289845
354 Ga0068860_101195041
355 Ga0068862_100378268
356 Ga0068862_100494235
357 Ga0070717_10058644
358 Ga0075366_10356029
359 Ga0097621_100472845
360 Ga0068871_100291868
361 Ga0075428_100065331
362 Ga0075428_100505342
363 Ga0075430_100080876
364 Ga0075430_100085251
365 Ga0075430_100358764
366 Ga0075430_101516131
367 Ga0075431_100324132
368 Ga0075431_100366369
369 Ga0075431_100919648
370 Ga0075433_10001803
371 Ga0075433_10331778
372 Ga0075434_100004391
373 Ga0075434_100011123
374 Ga0075429_100024892
375 Ga0075429_100029502
376 Ga0068865_100540546
377 Ga0068865_100611529
378 Ga0097620_100632140
379 Ga0097620_100731308
380 Ga0075435_101084094
381 Ga0111539_10000150
382 Ga0111539_10879038
383 Ga0105245_10039861
384 Ga0105245_10633626
385 Ga0105245_11889491
386 Ga0114129_10014524
387 Ga0114129_10653077
388 Ga0114129_11254313
389 Ga0105243_10594124
390 Ga0105242_10084392
391 Ga0105242_10979580
392 Ga0105248_10109344
393 Ga0105248_10853504
394 Ga0105248_12897767
395 Ga0105238_11221785
396 Ga0105249_10154164
397 Ga0105249_13054278
398 Ga0157374_12954089
399 Ga0157375_10070491
400 Ga0157380_10840309
401 Ga0157377_10151187
402 Ga0157379_11656597
403 Ga0157376_10261979
404 Ga0213875_10105725
405 Ga0213875_10395519
406 Ga0209233_1042839
407 Ga0207682_10084724
408 Ga0207642_10607521
409 Ga0207680_10353815
410 Ga0207699_10384299
411 Ga0207707_10854195
412 Ga0207660_10110957
413 Ga0207649_10321900
414 Ga0207681_10087635
415 Ga0207650_10951153
416 Ga0207659_10015685
417 Ga0207659_10481752
418 Ga0207687_10335401
419 Ga0207687_10668711
420 Ga0207687_11364677
421 Ga0207700_10501685
422 Ga0207700_10681631
423 Ga0207644_11597227
424 Ga0207706_10166859
425 Ga0207706_10351051
426 Ga0207686_10080189
427 Ga0207709_10473510
428 Ga0207670_10998928
429 Ga0207669_10423152
430 Ga0207669_10976666
431 Ga0207704_10168654
432 Ga0207704_10284616
433 Ga0207691_10012031
434 Ga0207691_10120738
435 Ga0207691_10150819
436 Ga0207711_10122362
437 Ga0207711_10124794
438 Ga0207711_10525858
439 Ga0207689_10169408
440 Ga0207661_10028248
441 Ga0207679_10055190
442 Ga0207651_10004119
443 Ga0207651_10265465
444 Ga0207712_11556756
445 Ga0207658_10459889
446 Ga0207678_10488015
447 Ga0207708_10270093
448 Ga0207708_10512969
449 Ga0207641_10290489
450 Ga0207641_11100502
451 Ga0207648_10458459
452 Ga0207683_10131614
453 Ga0209971_1154681
454 Ga0209966_1021325
455 Ga0209974_10382350
456 Ga0207428_10009025
457 Ga0207428_10011053
458 Ga0268265_10012569
459 Ga0268264_11682804
460 Ga0265338_10140647
461 Ga0265338_10690187
462 Ga0265332_10043046
463 Ga0265325_10250201
464 Ga0265340_10013279
465 Ga0307408_100729550
466 Ga0265314_10238123
467 Ga0307405_10746230
468 Ga0307409_101580027
469 Ga0307411_10332755
470 Ga0307415_102191893
471 Ga0436364_0096684
472 Ga0436364_0391371
473 Ga0436364_0846558
474 Ga0395901_1372575
475 Ga0451802_0271317
476 Ga0439454_086314
477 Ga0450896_070624
478 Ga0439435_0047313
479 Ga0439464_0179463
480 Ga0466963_0448793
481 Ga0451576_0557762
482 Ga0451576_2135412
483 Ga0495650_0123089
484 Ga0495594_0025327
485 Ga0495594_0428459
486 Ga0495594_0717090
487 Ga0495621_0284190
488 Ga0495656_0001415
489 Ga0495656_0688571
490 Ga0495668_0654266
491 Ga0495599_0289409
492 Ga0495658_0698331
493 Ga0495684_0517959
494 Ga0501290_008952
495 Ga0501298_009336
496 Ga0501032_0401674
497 Ga0501036_0011720
498 Ga0501037_0205144
499 Ga0501038_0113070
500 Ga0501039_0259016
501 Ga0501040_0004589
502 Ga0501041_0064709
503 Ga0501042_0072461
504 Ga0501046_0255292
505 Ga0501048_0115957
506 Ga0501067_0707647
507 Ga0501068_0704152
508 Ga0501071_0106698
509 Ga0501072_0067115
510 Ga0501072_1470779
511 Ga0501075_0072556
512 Ga0501075_0101619
513 Ga0501075_0597500
514 Ga0501076_0000473
515 Ga0501076_0807296
516 Ga0501076_1487869
517 Ga0501077_0126023
518 Ga0501202_064563
519 Ga0501206_025580
520 Ga0501217_300154
521 Ga0501246_024584
522 Ga0501249_002407
523 Ga0501253_166347
524 Ga0501257_073494
525 Ga0501261_043561
526 Ga0501079_0313892
527 Ga0501079_0447901
528 Ga0501080_0213549
529 Ga0501081_0056025
530 Ga0501081_1216019
531 Ga0501266_082694
532 Ga0501267_031301
533 Ga0501275_022717
534 Ga0501283_033983
535 Ga0501035_0406813
536 Ga0501044_0191485
537 Ga0501045_0042572
538 nmdc:mga0k408_154746_c1
539 nmdc:mga0k408_239151_c1
540 nmdc:mga05p37_129001_c1
541 nmdc:mga05p37_413521_c1
542 nmdc:mga05p37_557639_c1
543 nmdc:mga05p37_823396_c1
544 nmdc:mga05p37_823471_c1
545 nmdc:mga09592_220909_c1
546 nmdc:mga09592_373882_c1
547 nmdc:mga09592_7421_c1
548 nmdc:mga0qj67_294145_c1
549 nmdc:mga0qj67_309782_c1
550 nmdc:mga0qj67_35467_c1
551 nmdc:mga06r32_121043_c1
552 nmdc:mga06r32_435312_c1
553 nmdc:mga06r32_655435_c1
554 nmdc:mga08y16_235_c1
555 nmdc:mga08y16_272005_c1
556 nmdc:mga08y16_39664_c1
557 nmdc:mga0n895_11163_c1
558 nmdc:mga0n895_8115_c1
559 nmdc:mga0rr50_1284800_c1
560 nmdc:mga0a205_13567_c1
561 nmdc:mga0a205_636910_c1
562 nmdc:mga0a205_815058_c1
563 nmdc:mga0a205_906_c2
564 Ga0495619_0290948
565 Ga0500616_0012649
566 Ga0501084_0055739
567 Ga0501082_0000692
568 Ga0530510_0003092

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03965

Penicillinase_R

Penicillinase repressor

6

120

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9015 9 72
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.8874 9 72
7ne9-assembly1.cif.gz_CCC a single sensor controls large variations in zinc quotas in a marine cyanobacterium 0.8813 4 70
7ne9-assembly1.cif.gz_DDD a single sensor controls large variations in zinc quotas in a marine cyanobacterium 0.8786 4 70
4ija-assembly1.cif.gz_A structure of s. aureus methicillin resistance factor mecr2 0.8605 9 70
ID Description Score Start End Superfamily
4lb5B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9015 9 72 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8918 6 69 1.10.10.10
5j6xB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8874 9 72 1.10.10.10
1saxB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8868 7 70 1.10.10.10
2g9wB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8781 3 71 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2V9LQU5-F1-model_v4 Transcriptional regulator 0.9383 1 122 GO:0003677
GO:0045892
AF-A0A3M2BFY9-F1-model_v4 BlaI/MecI/CopY family transcriptional regulator 0.9374 6 88 GO:0003677
GO:0045892
AF-A0A7C2JAI3-F1-model_v4 BlaI/MecI/CopY family transcriptional regulator 0.9329 5 126 GO:0003677
GO:0045892
AF-A0A3D5P045-F1-model_v4 BlaI/MecI/CopY family transcriptional regulator 0.9323 6 83 GO:0003677
GO:0045892
AF-A0A2V5TXF2-F1-model_v4 BlaI family transcriptional regulator 0.9305 5 103 GO:0003677
GO:0045892

Map